F479347
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 756 | 386 | 675 | 330 |
Family's Representative Sequence
| Representative Sequence | 3300030732|Ga0316176_1221375|Ga0316176_12213752 |
| Length | 376 |
| Sequence | LIIIDKQKDFYRNFDKKSGRWTQHDYCNHQRLHLALEKQNIKQMKYRNLSNATEQLSAIGLGCMGMSFAYGPTDDVESIATLNKALDLGINFWDTADMYGNGLNEELISKVLVPNRDKVFIATKFGFRFKDGIAGPSNASGTYFDGSPAWIKVAVENSLRRLKIDTIDLYYAHRVDPNIPIEETVGAMAELVKEGKVRYLGLSEASANSLKRAHAVHPIAALQSEYSLLTRDIEAEILGTARSLNVTLVPYSPLARGLVTNALDVTSLAETDFRRTLPRYSGENLANNQSLAMEFAAIAAEKNATPAQLALAWVLAQGEDIIPIPGTKKRKYLEENAKAVDLNLSKSDLEAIQKLTEKYPNTGERYSEGALKLVNN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 4 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 5 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 6 | 2551306352 | Acinetobacter sp. GG2 | Isolate | Rhizosphere |
| 7 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 8 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 9 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 10 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 11 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 12 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 13 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 14 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 15 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 16 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 17 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 18 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 19 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 20 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 21 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 22 | 2639762793 | Acinetobacter calcoaceticus GK1 | Isolate | Rhizosphere |
| 23 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 24 | 2675903507 | Acinetobacter calcoaceticus GK2 | Isolate | Unclassified |
| 25 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 26 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 27 | 2738541273 | Elizabethkingia sp. YR214 | Isolate | Unclassified |
| 28 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 29 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 30 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 31 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 32 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 33 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 34 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 35 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 36 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 37 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 38 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 39 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 40 | 2773857761 | Acinetobacter sp. 3664 | Isolate | Unclassified |
| 41 | 2773857770 | Acinetobacter sp. 3636 | Isolate | Unclassified |
| 42 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 43 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 44 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 45 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 46 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 47 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 48 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 49 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 50 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 51 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 52 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 53 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 54 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 55 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 56 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 57 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 58 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 59 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 60 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 61 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 62 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 63 | 2919097161 | Chryseobacterium ginsenosidimutans 1394 | Isolate | Rhizosphere |
| 64 | 2919182534 | Acinetobacter calcoaceticus 2589 | Isolate | Rhizosphere |
| 65 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 66 | 2919399522 | Chryseobacterium sp. 2987 | Isolate | Unclassified |
| 67 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 68 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 69 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 70 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 71 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 72 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 73 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 74 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 75 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 76 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 77 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 78 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 79 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 80 | 2993372514 | Chryseobacterium sp. SLBN-27 | Isolate | Rhizosphere |
| 81 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
| 82 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 83 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 84 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 85 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 86 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 87 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 88 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 89 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 90 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 91 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 92 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 93 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 94 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 95 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 96 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 97 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 98 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 99 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 100 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 101 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 102 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 103 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 104 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 107 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 108 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 110 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 112 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 113 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 114 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 116 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 123 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 129 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 130 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 131 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 132 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 133 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 134 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 135 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 136 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 138 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 140 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 141 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 142 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 144 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 145 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 146 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 147 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 148 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 149 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 150 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 151 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 152 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 153 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 154 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 155 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 157 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 158 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 187 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 191 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 192 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 193 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 194 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 195 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 196 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 199 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 200 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 259 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 260 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 261 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 262 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 263 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 264 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 265 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 266 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 267 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 268 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 269 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 270 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 271 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 272 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 273 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 274 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 275 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 276 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 277 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 278 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 279 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 280 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 281 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 282 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 283 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 284 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 285 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 286 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 287 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 288 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 289 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 290 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 291 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 292 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 293 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 294 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 295 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 296 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 297 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 298 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 299 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 300 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 301 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 331 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 332 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 333 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 334 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 335 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 336 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 337 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 338 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 339 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 340 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 341 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 342 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 343 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 344 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 345 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 349 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 350 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 351 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 352 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 353 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 354 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 355 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 356 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 357 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 358 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 359 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 362 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 363 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 365 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 366 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 367 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 368 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 369 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 370 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 371 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 372 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 373 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 374 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 375 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 376 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 377 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 378 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 379 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 380 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 381 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 382 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 383 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 384 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 385 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 386 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.29 |
| Metatranscriptomes | 0 |
| Isolates | 10.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.4 |
| Bulb | 0 |
| Endosphere | 7.8 |
| Nodule | 0.13 |
| Rhizoplane | 0.93 |
| Rhizosphere | 76.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_301064 | 2162886007 | Bacteria | 32696 |
| 2 | MRS1b_contig_8779386 | 2162886011 | Bacteria | 1332 |
| 3 | JGI24740J21852_10003561 | 3300001979 | Bacteria | 6814 |
| 4 | JGI24740J21852_10026941 | 3300001979 | Bacteria | 1918 |
| 5 | JGI24740J21852_10038301 | 3300001979 | Bacteria | 1472 |
| 6 | JGI24737J22298_10012381 | 3300001990 | Bacteria | 2782 |
| 7 | JGI24737J22298_10020942 | 3300001990 | Bacteria | 2085 |
| 8 | JGI24735J21928_10000002 | 3300002067 | Bacteria | 624895 |
| 9 | JGI24735J21928_10006150 | 3300002067 | Bacteria | 3963 |
| 10 | JGI25154J39366_1000025 | 3300002738 | Bacteria | 211189 |
| 11 | JGI25157J39369_1006040 | 3300002741 | Bacteria | 1893 |
| 12 | JGI25159J45721_1017468 | 3300002987 | Bacteria | 1482 |
| 13 | JGI25406J46586_10040573 | 3300003203 | Bacteria | 1649 |
| 14 | JGI25153J46596_10003683 | 3300003215 | Bacteria | 8483 |
| 15 | rootH1_10003905 | 3300003316 | Bacteria | 4614 |
| 16 | rootH1_10028754 | 3300003316 | Bacteria | 4651 |
| 17 | rootH1_10071229 | 3300003316 | Bacteria | 10970 |
| 18 | rootH1_10084445 | 3300003316 | Bacteria | 2033 |
| 19 | rootH2_10001801 | 3300003320 | Bacteria | 92828 |
| 20 | rootH2_10011484 | 3300003320 | Bacteria | 18209 |
| 21 | rootH2_10020406 | 3300003320 | Bacteria | 5976 |
| 22 | rootH2_10050819 | 3300003320 | Bacteria | 3694 |
| 23 | rootH2_10054169 | 3300003320 | Bacteria | 16718 |
| 24 | rootH2_10062956 | 3300003320 | Bacteria | 2229 |
| 25 | rootH2_10245769 | 3300003320 | Bacteria | 1397 |
| 26 | rootL2_10009807 | 3300003322 | Bacteria | 4554 |
| 27 | rootL2_10066242 | 3300003322 | Bacteria | 2074 |
| 28 | rootL2_10132642 | 3300003322 | Bacteria | 6071 |
| 29 | rootL2_10165344 | 3300003322 | Bacteria | 3030 |
| 30 | rootL2_10189861 | 3300003322 | Bacteria | 2698 |
| 31 | rootH1_10006845 | 3300003323 | Bacteria | 5177 |
| 32 | rootH1_10017652 | 3300003316 | Bacteria | 4049 |
| 33 | rootH1_10017652 | 3300003323 | Bacteria | 1745 |
| 34 | rootH1_10017957 | 3300003323 | Bacteria | 14637 |
| 35 | rootH1_10048169 | 3300003323 | Bacteria | 8811 |
| 36 | rootH1_10081119 | 3300003323 | Bacteria | 3298 |
| 37 | rootH1_10092177 | 3300003323 | Bacteria | 4808 |
| 38 | rootH1_10157014 | 3300003323 | Bacteria | 1494 |
| 39 | rootH1_10260771 | 3300003323 | Bacteria | 1696 |
| 40 | JGI25160J50197_1004797 | 3300003354 | Bacteria | 5768 |
| 41 | Ga0055535_1001728 | 3300003761 | Bacteria | 9813 |
| 42 | Ga0055536_1009986 | 3300003781 | Bacteria | 3838 |
| 43 | Ga0055531_10000071 | 3300003794 | Bacteria | 110534 |
| 44 | Ga0058692_1000007 | 3300003856 | Bacteria | 366313 |
| 45 | Ga0065165_1000057 | 3300005262 | Bacteria | 185971 |
| 46 | Ga0065703_1000113 | 3300005272 | Bacteria | 60359 |
| 47 | Ga0065714_10002864 | 3300005288 | Bacteria | 54801 |
| 48 | Ga0065714_10002993 | 3300005288 | Bacteria | 18963 |
| 49 | Ga0065714_10078522 | 3300005288 | Bacteria | 2592 |
| 50 | Ga0065714_10083886 | 3300005288 | Bacteria | 2226 |
| 51 | Ga0065714_10084831 | 3300005288 | Bacteria | 2178 |
| 52 | Ga0065714_10136971 | 3300005288 | Bacteria | 1201 |
| 53 | Ga0065704_10000229 | 3300005289 | Bacteria | 80338 |
| 54 | Ga0065704_10004724 | 3300005289 | Bacteria | 3390 |
| 55 | Ga0065704_10015826 | 3300005289 | Bacteria | 1331 |
| 56 | Ga0065704_10087427 | 3300005289 | Bacteria | 3026 |
| 57 | Ga0065704_10169842 | 3300005289 | Bacteria | 1298 |
| 58 | Ga0065712_10141975 | 3300005290 | Bacteria | 1442 |
| 59 | Ga0070658_10000025 | 3300005327 | Bacteria | 174551 |
| 60 | Ga0070658_10225671 | 3300005327 | Bacteria | 1585 |
| 61 | Ga0070658_10228455 | 3300005327 | Unclassified | 1575 |
| 62 | Ga0070676_10000058 | 3300005328 | Bacteria | 36261 |
| 63 | Ga0070676_10013674 | 3300005328 | Bacteria | 4448 |
| 64 | Ga0070683_100020914 | 3300005329 | Bacteria | 5834 |
| 65 | Ga0070683_100022739 | 3300005329 | Bacteria | 5607 |
| 66 | Ga0070683_100093455 | 3300005329 | Bacteria | 2826 |
| 67 | Ga0070690_100014466 | 3300005330 | Bacteria | 4682 |
| 68 | Ga0070690_100127628 | 3300005330 | Unclassified | 1714 |
| 69 | Ga0070670_100097515 | 3300005331 | Bacteria | 2529 |
| 70 | Ga0068869_100010539 | 3300005334 | Bacteria | 6031 |
| 71 | Ga0068869_100049154 | 3300005334 | Bacteria | 3052 |
| 72 | Ga0068869_100062633 | 3300005334 | Bacteria | 2730 |
| 73 | Ga0068869_100115391 | 3300005334 | Bacteria | 2048 |
| 74 | Ga0070666_10000174 | 3300005335 | Bacteria | 43931 |
| 75 | Ga0070666_10050561 | 3300005335 | Bacteria | 2796 |
| 76 | Ga0070666_10051528 | 3300005335 | Bacteria | 2772 |
| 77 | Ga0070680_100022362 | 3300005336 | Bacteria | 5037 |
| 78 | Ga0070680_100082320 | 3300005336 | Bacteria | 2656 |
| 79 | Ga0070682_100000605 | 3300005337 | Bacteria | 21844 |
| 80 | Ga0068868_100008858 | 3300005338 | Bacteria | 7210 |
| 81 | Ga0070660_100098392 | 3300005339 | Bacteria | 2315 |
| 82 | Ga0070689_100297457 | 3300005340 | Bacteria | 1343 |
| 83 | Ga0070661_100000394 | 3300005344 | Bacteria | 33858 |
| 84 | Ga0070661_100002053 | 3300005344 | Bacteria | 13879 |
| 85 | Ga0070668_100113403 | 3300005347 | Unclassified | 2159 |
| 86 | Ga0070669_100006597 | 3300005353 | Bacteria | 8353 |
| 87 | Ga0070675_100014913 | 3300005354 | Bacteria | 6137 |
| 88 | Ga0070671_100171890 | 3300005355 | Bacteria | 1833 |
| 89 | Ga0070673_100005738 | 3300005364 | Bacteria | 7984 |
| 90 | Ga0070673_100139440 | 3300005364 | Bacteria | 2044 |
| 91 | Ga0070688_100002798 | 3300005365 | Bacteria | 8863 |
| 92 | Ga0070688_100003235 | 3300005365 | Bacteria | 8344 |
| 93 | Ga0070659_100000333 | 3300005366 | Bacteria | 36448 |
| 94 | Ga0070659_100004546 | 3300005366 | Bacteria | 9911 |
| 95 | Ga0070667_100036633 | 3300005367 | Bacteria | 4113 |
| 96 | Ga0070667_100039197 | 3300005367 | Bacteria | 3971 |
| 97 | Ga0070667_100142098 | 3300005367 | Unclassified | 2103 |
| 98 | Ga0070663_100092934 | 3300005455 | Bacteria | 2238 |
| 99 | Ga0070678_100012232 | 3300005456 | Bacteria | 5325 |
| 100 | Ga0070678_100087892 | 3300005456 | Bacteria | 2375 |
| 101 | Ga0070662_100000055 | 3300005457 | Bacteria | 60567 |
| 102 | Ga0070662_100005182 | 3300005457 | Bacteria | 8315 |
| 103 | Ga0070662_100024544 | 3300005457 | Bacteria | 4155 |
| 104 | Ga0070662_100026860 | 3300005457 | Bacteria | 3990 |
| 105 | Ga0070662_100165477 | 3300005457 | Bacteria | 1733 |
| 106 | Ga0070681_10015115 | 3300005458 | Bacteria | 7678 |
| 107 | Ga0070681_10273117 | 3300005458 | Bacteria | 1602 |
| 108 | Ga0068867_100001957 | 3300005459 | Bacteria | 14352 |
| 109 | Ga0070685_10010745 | 3300005466 | Bacteria | 4767 |
| 110 | Ga0070698_100065707 | 3300005471 | Bacteria | 3652 |
| 111 | Ga0070679_100064512 | 3300005530 | Bacteria | 3650 |
| 112 | Ga0070684_100000214 | 3300005535 | Bacteria | 40555 |
| 113 | Ga0070684_100040721 | 3300005535 | Bacteria | 4002 |
| 114 | Ga0070684_100106567 | 3300005535 | Bacteria | 2509 |
| 115 | Ga0070684_100222471 | 3300005535 | Bacteria | 1722 |
| 116 | Ga0068853_100001864 | 3300005539 | Bacteria | 15492 |
| 117 | Ga0068853_100011469 | 3300005539 | Bacteria | 7204 |
| 118 | Ga0068853_100068624 | 3300005539 | Bacteria | 3082 |
| 119 | Ga0068853_100126393 | 3300005539 | Bacteria | 2284 |
| 120 | Ga0068853_100183632 | 3300005539 | Bacteria | 1898 |
| 121 | Ga0068853_100256855 | 3300005539 | Bacteria | 1605 |
| 122 | Ga0070686_100055842 | 3300005544 | Bacteria | 2531 |
| 123 | Ga0070665_100000006 | 3300005548 | Bacteria | 718034 |
| 124 | Ga0070665_100000034 | 3300005548 | Bacteria | 324289 |
| 125 | Ga0070665_100001787 | 3300005548 | Bacteria | 24481 |
| 126 | Ga0070665_100105863 | 3300005548 | Bacteria | 2815 |
| 127 | Ga0068855_100041771 | 3300005563 | Bacteria | 5434 |
| 128 | Ga0068855_100100099 | 3300005563 | Bacteria | 3338 |
| 129 | Ga0068855_100130904 | 3300005563 | Bacteria | 2865 |
| 130 | Ga0068855_100594950 | 3300005563 | Bacteria | 1193 |
| 131 | Ga0068855_100607187 | 3300005563 | Bacteria | 1179 |
| 132 | Ga0070664_100003687 | 3300005564 | Bacteria | 12351 |
| 133 | Ga0068857_100005631 | 3300005577 | Bacteria | 10706 |
| 134 | Ga0068857_100006534 | 3300005577 | Bacteria | 10006 |
| 135 | Ga0068857_100009540 | 3300005577 | Bacteria | 8428 |
| 136 | Ga0068857_100009916 | 3300005577 | Bacteria | 8267 |
| 137 | Ga0068857_100096038 | 3300005577 | Bacteria | 2656 |
| 138 | Ga0068854_100014991 | 3300005578 | Bacteria | 5123 |
| 139 | Ga0068856_100001729 | 3300005614 | Bacteria | 22841 |
| 140 | Ga0068856_100016408 | 3300005614 | Bacteria | 7165 |
| 141 | Ga0068856_100126311 | 3300005614 | Bacteria | 2561 |
| 142 | Ga0068856_100133388 | 3300005614 | Bacteria | 2489 |
| 143 | Ga0070702_100023869 | 3300005615 | Bacteria | 3256 |
| 144 | Ga0068852_100015157 | 3300005616 | Bacteria | 5966 |
| 145 | Ga0068852_100020101 | 3300005616 | Bacteria | 5304 |
| 146 | Ga0068852_100113673 | 3300005616 | Bacteria | 2466 |
| 147 | Ga0068852_100172245 | 3300005616 | Bacteria | 2030 |
| 148 | Ga0068852_100325910 | 3300005616 | Bacteria | 1493 |
| 149 | Ga0068852_100423063 | 3300005616 | Bacteria | 1314 |
| 150 | Ga0068859_100001134 | 3300005617 | Bacteria | 27162 |
| 151 | Ga0068859_100024970 | 3300005617 | Bacteria | 5998 |
| 152 | Ga0068859_100105082 | 3300005617 | Bacteria | 2883 |
| 153 | Ga0068859_100184228 | 3300005617 | Bacteria | 2171 |
| 154 | Ga0068864_100011569 | 3300005618 | Bacteria | 7285 |
| 155 | Ga0068864_100055735 | 3300005618 | Bacteria | 3413 |
| 156 | Ga0068866_10045142 | 3300005718 | Bacteria | 2208 |
| 157 | Ga0068861_100319800 | 3300005719 | Bacteria | 1351 |
| 158 | Ga0068851_10060615 | 3300005834 | Bacteria | 1937 |
| 159 | Ga0068851_10127309 | 3300005834 | Bacteria | 1374 |
| 160 | Ga0068863_100025030 | 3300005841 | Bacteria | 5692 |
| 161 | Ga0068863_100312112 | 3300005841 | Bacteria | 1526 |
| 162 | Ga0068858_100006604 | 3300005842 | Bacteria | 11285 |
| 163 | Ga0068858_100162571 | 3300005842 | Bacteria | 2102 |
| 164 | Ga0068860_100000005 | 3300005843 | Bacteria | 472349 |
| 165 | Ga0068860_100016689 | 3300005843 | Bacteria | 7162 |
| 166 | Ga0068860_100024943 | 3300005843 | Bacteria | 5772 |
| 167 | Ga0068860_100040364 | 3300005843 | Bacteria | 4461 |
| 168 | Ga0068860_100120760 | 3300005843 | Bacteria | 2509 |
| 169 | Ga0068862_100076911 | 3300005844 | Bacteria | 2889 |
| 170 | Ga0081539_10000147 | 3300005985 | Bacteria | 164274 |
| 171 | Ga0075366_10001295 | 3300006195 | Bacteria | 12474 |
| 172 | Ga0075366_10022084 | 3300006195 | Bacteria | 3700 |
| 173 | Ga0075366_10081002 | 3300006195 | Bacteria | 1939 |
| 174 | Ga0075366_10090686 | 3300006195 | Bacteria | 1831 |
| 175 | Ga0097621_100001787 | 3300006237 | Bacteria | 14759 |
| 176 | Ga0068871_100000099 | 3300006358 | Bacteria | 51278 |
| 177 | Ga0068871_100119257 | 3300006358 | Bacteria | 2227 |
| 178 | Ga0068865_100000055 | 3300006881 | Bacteria | 62584 |
| 179 | Ga0068865_100050491 | 3300006881 | Bacteria | 2874 |
| 180 | Ga0068865_100066543 | 3300006881 | Bacteria | 2542 |
| 181 | Ga0097620_100001134 | 3300006931 | Bacteria | 27162 |
| 182 | Ga0097620_100024970 | 3300006931 | Bacteria | 5998 |
| 183 | Ga0097620_100105080 | 3300006931 | Bacteria | 2883 |
| 184 | Ga0097620_100411609 | 3300006931 | Bacteria | 1448 |
| 185 | Ga0105251_10058269 | 3300009011 | Bacteria | 1824 |
| 186 | Ga0105244_10000007 | 3300009036 | Bacteria | 352275 |
| 187 | Ga0105244_10000050 | 3300009036 | Bacteria | 138868 |
| 188 | Ga0105244_10001222 | 3300009036 | Bacteria | 21064 |
| 189 | Ga0105244_10104398 | 3300009036 | Bacteria | 1383 |
| 190 | Ga0105250_10012506 | 3300009092 | Bacteria | 3502 |
| 191 | Ga0105250_10013417 | 3300009092 | Bacteria | 3375 |
| 192 | Ga0105240_10000147 | 3300009093 | Bacteria | 142340 |
| 193 | Ga0105240_10000168 | 3300009093 | Bacteria | 133212 |
| 194 | Ga0105240_10001071 | 3300009093 | Bacteria | 48359 |
| 195 | Ga0105240_10003601 | 3300009093 | Bacteria | 23998 |
| 196 | Ga0105240_10006315 | 3300009093 | Bacteria | 17443 |
| 197 | Ga0105240_10036262 | 3300009093 | Bacteria | 6346 |
| 198 | Ga0105240_10399573 | 3300009093 | Bacteria | 1548 |
| 199 | Ga0105245_10041124 | 3300009098 | Bacteria | 4120 |
| 200 | Ga0105245_10133751 | 3300009098 | Bacteria | 2328 |
| 201 | Ga0105247_10000560 | 3300009101 | Bacteria | 30230 |
| 202 | Ga0105247_10018189 | 3300009101 | Bacteria | 4215 |
| 203 | Ga0105247_10040956 | 3300009101 | Bacteria | 2833 |
| 204 | Ga0114129_10016698 | 3300009147 | Bacteria | 10455 |
| 205 | Ga0105243_10000012 | 3300009148 | Bacteria | 300885 |
| 206 | Ga0105243_10000052 | 3300009148 | Bacteria | 138341 |
| 207 | Ga0105243_10003425 | 3300009148 | Bacteria | 12847 |
| 208 | Ga0105243_10033408 | 3300009148 | Bacteria | 3978 |
| 209 | Ga0105243_10149190 | 3300009148 | Bacteria | 2004 |
| 210 | Ga0105241_10000646 | 3300009174 | Bacteria | 26122 |
| 211 | Ga0105241_10000727 | 3300009174 | Bacteria | 24962 |
| 212 | Ga0105241_10002072 | 3300009174 | Bacteria | 15154 |
| 213 | Ga0105241_10004327 | 3300009174 | Bacteria | 10505 |
| 214 | Ga0105241_10011531 | 3300009174 | Bacteria | 6480 |
| 215 | Ga0105241_10099616 | 3300009174 | Bacteria | 2308 |
| 216 | Ga0105241_10461176 | 3300009174 | Bacteria | 1126 |
| 217 | Ga0105242_10050853 | 3300009176 | Bacteria | 3376 |
| 218 | Ga0105242_10101430 | 3300009176 | Bacteria | 2439 |
| 219 | Ga0105248_10163029 | 3300009177 | Bacteria | 2514 |
| 220 | Ga0105237_10000052 | 3300009545 | Bacteria | 160459 |
| 221 | Ga0105237_10000465 | 3300009545 | Bacteria | 57393 |
| 222 | Ga0105237_10004647 | 3300009545 | Bacteria | 15820 |
| 223 | Ga0105237_10006979 | 3300009545 | Bacteria | 12452 |
| 224 | Ga0105237_10007788 | 3300009545 | Bacteria | 11682 |
| 225 | Ga0105237_10008058 | 3300009545 | Bacteria | 11457 |
| 226 | Ga0105237_10019455 | 3300009545 | Bacteria | 7011 |
| 227 | Ga0105237_10136018 | 3300009545 | Bacteria | 2452 |
| 228 | Ga0105238_10276334 | 3300009551 | Bacteria | 1660 |
| 229 | Ga0105249_10007645 | 3300009553 | Bacteria | 9421 |
| 230 | Ga0105249_10045035 | 3300009553 | Bacteria | 4012 |
| 231 | Ga0105249_10146373 | 3300009553 | Bacteria | 2270 |
| 232 | Ga0105239_10000277 | 3300010375 | Bacteria | 75496 |
| 233 | Ga0105239_10000896 | 3300010375 | Bacteria | 42315 |
| 234 | Ga0105239_10003342 | 3300010375 | Bacteria | 19721 |
| 235 | Ga0105239_10006368 | 3300010375 | Bacteria | 13715 |
| 236 | Ga0105239_10031149 | 3300010375 | Bacteria | 5868 |
| 237 | Ga0105239_10031395 | 3300010375 | Bacteria | 5843 |
| 238 | Ga0105239_10070587 | 3300010375 | Bacteria | 3837 |
| 239 | Ga0105246_10006728 | 3300011119 | Bacteria | 7029 |
| 240 | Ga0105246_10052685 | 3300011119 | Bacteria | 2798 |
| 241 | Ga0105246_10327969 | 3300011119 | Bacteria | 1246 |
| 242 | Ga0157373_10000089 | 3300013100 | Bacteria | 78449 |
| 243 | Ga0157373_10000261 | 3300013100 | Bacteria | 42879 |
| 244 | Ga0157373_10005929 | 3300013100 | Bacteria | 9144 |
| 245 | Ga0157373_10008339 | 3300013100 | Bacteria | 7698 |
| 246 | Ga0157373_10039389 | 3300013100 | Bacteria | 3384 |
| 247 | Ga0157373_10069209 | 3300013100 | Bacteria | 2495 |
| 248 | Ga0157371_10000009 | 3300013102 | Bacteria | 392895 |
| 249 | Ga0157371_10001830 | 3300013102 | Bacteria | 21442 |
| 250 | Ga0157371_10010803 | 3300013102 | Bacteria | 7087 |
| 251 | Ga0157371_10016929 | 3300013102 | Bacteria | 5429 |
| 252 | Ga0157371_10023778 | 3300013102 | Bacteria | 4479 |
| 253 | Ga0157371_10056955 | 3300013102 | Bacteria | 2772 |
| 254 | Ga0157370_10007408 | 3300013104 | Bacteria | 11952 |
| 255 | Ga0157370_10023356 | 3300013104 | Bacteria | 6140 |
| 256 | Ga0157370_10052976 | 3300013104 | Bacteria | 3871 |
| 257 | Ga0157370_10343322 | 3300013104 | Bacteria | 1376 |
| 258 | Ga0157369_10000033 | 3300013105 | Bacteria | 201124 |
| 259 | Ga0157369_10018848 | 3300013105 | Bacteria | 7733 |
| 260 | Ga0157369_10079919 | 3300013105 | Bacteria | 3502 |
| 261 | Ga0157374_10000002 | 3300013296 | Bacteria | 1054226 |
| 262 | Ga0157374_10000051 | 3300013296 | Bacteria | 126876 |
| 263 | Ga0157374_10000660 | 3300013296 | Bacteria | 30313 |
| 264 | Ga0157374_10006360 | 3300013296 | Bacteria | 10022 |
| 265 | Ga0157374_10009338 | 3300013296 | Bacteria | 8414 |
| 266 | Ga0157374_10234627 | 3300013296 | Bacteria | 1803 |
| 267 | Ga0157378_10070743 | 3300013297 | Bacteria | 3133 |
| 268 | Ga0163162_10000018 | 3300013306 | Bacteria | 226257 |
| 269 | Ga0163162_10000854 | 3300013306 | Bacteria | 28384 |
| 270 | Ga0163162_10002414 | 3300013306 | Bacteria | 17587 |
| 271 | Ga0163162_10004463 | 3300013306 | Bacteria | 13484 |
| 272 | Ga0163162_10025890 | 3300013306 | Bacteria | 5798 |
| 273 | Ga0157372_10000621 | 3300013307 | Bacteria | 38766 |
| 274 | Ga0157372_10006504 | 3300013307 | Bacteria | 12440 |
| 275 | Ga0157372_10018242 | 3300013307 | Bacteria | 7543 |
| 276 | Ga0157372_10018251 | 3300013307 | Bacteria | 7542 |
| 277 | Ga0157372_10066801 | 3300013307 | Bacteria | 4041 |
| 278 | Ga0157372_10083990 | 3300013307 | Bacteria | 3608 |
| 279 | Ga0157372_10151463 | 3300013307 | Unclassified | 2677 |
| 280 | Ga0157375_10000222 | 3300013308 | Bacteria | 53493 |
| 281 | Ga0157375_10002786 | 3300013308 | Bacteria | 15120 |
| 282 | Ga0157375_10106326 | 3300013308 | Bacteria | 2898 |
| 283 | Ga0157375_10426170 | 3300013308 | Bacteria | 1493 |
| 284 | Ga0163163_10002002 | 3300014325 | Bacteria | 17218 |
| 285 | Ga0163163_10126423 | 3300014325 | Bacteria | 2594 |
| 286 | Ga0157380_10000947 | 3300014326 | Bacteria | 18382 |
| 287 | Ga0157380_10003364 | 3300014326 | Bacteria | 10973 |
| 288 | Ga0157380_10494883 | 3300014326 | Bacteria | 1186 |
| 289 | Ga0182008_10000237 | 3300014497 | Bacteria | 42829 |
| 290 | Ga0157377_10043007 | 3300014745 | Bacteria | 2512 |
| 291 | Ga0157377_10044107 | 3300014745 | Bacteria | 2485 |
| 292 | Ga0157379_10032319 | 3300014968 | Bacteria | 4666 |
| 293 | Ga0157379_10080993 | 3300014968 | Bacteria | 2909 |
| 294 | Ga0157376_10010852 | 3300014969 | Bacteria | 6688 |
| 295 | Ga0157376_10063455 | 3300014969 | Bacteria | 3112 |
| 296 | Ga0157376_10084223 | 3300014969 | Unclassified | 2737 |
| 297 | Ga0182006_1000012 | 3300015261 | Bacteria | 394239 |
| 298 | Ga0182006_1001110 | 3300015261 | Bacteria | 17169 |
| 299 | Ga0182007_10000015 | 3300015262 | Bacteria | 207893 |
| 300 | Ga0182005_1000023 | 3300015265 | Bacteria | 246328 |
| 301 | Ga0183373_1013 | 3300015682 | Bacteria | 112340 |
| 302 | Ga0163161_10000012 | 3300017792 | Bacteria | 264639 |
| 303 | Ga0163161_10000178 | 3300017792 | Bacteria | 58130 |
| 304 | Ga0163161_10001618 | 3300017792 | Bacteria | 16584 |
| 305 | Ga0163161_10001922 | 3300017792 | Bacteria | 15167 |
| 306 | Ga0163161_10022450 | 3300017792 | Bacteria | 4445 |
| 307 | Ga0213872_10013765 | 3300021361 | Bacteria | 3786 |
| 308 | Ga0209436_101671 | 3300025208 | Bacteria | 7370 |
| 309 | Ga0209258_100161 | 3300025242 | Bacteria | 151992 |
| 310 | Ga0209646_1000037 | 3300025246 | Bacteria | 355116 |
| 311 | Ga0209026_1000819 | 3300025250 | Bacteria | 16669 |
| 312 | Ga0209026_1000903 | 3300025250 | Bacteria | 15274 |
| 313 | Ga0209026_1004184 | 3300025250 | Bacteria | 4405 |
| 314 | Ga0209148_1000161 | 3300025254 | Bacteria | 138759 |
| 315 | Ga0209130_1001704 | 3300025284 | Bacteria | 13290 |
| 316 | Ga0209676_1000558 | 3300025292 | Bacteria | 56412 |
| 317 | Ga0209050_1003096 | 3300025298 | Bacteria | 12763 |
| 318 | Ga0207426_1000034 | 3300025302 | Bacteria | 454016 |
| 319 | Ga0207426_1000052 | 3300025302 | Bacteria | 389825 |
| 320 | Ga0207426_1000959 | 3300025302 | Bacteria | 28423 |
| 321 | Ga0207426_1007449 | 3300025302 | Bacteria | 4581 |
| 322 | Ga0209257_1000001 | 3300025304 | Bacteria | 2274655 |
| 323 | Ga0207696_1001450 | 3300025711 | Bacteria | 12868 |
| 324 | Ga0207696_1001460 | 3300025711 | Bacteria | 12812 |
| 325 | Ga0207696_1003489 | 3300025711 | Bacteria | 7126 |
| 326 | Ga0207655_1000066 | 3300025728 | Bacteria | 246358 |
| 327 | Ga0207655_1000423 | 3300025728 | Bacteria | 57574 |
| 328 | Ga0207655_1000480 | 3300025728 | Bacteria | 51524 |
| 329 | Ga0207655_1000941 | 3300025728 | Bacteria | 30166 |
| 330 | Ga0207713_1002097 | 3300025735 | Bacteria | 14883 |
| 331 | Ga0207713_1002622 | 3300025735 | Bacteria | 12934 |
| 332 | Ga0207713_1004893 | 3300025735 | Bacteria | 8569 |
| 333 | Ga0207710_10000018 | 3300025900 | Bacteria | 346727 |
| 334 | Ga0207680_10001491 | 3300025903 | Bacteria | 11058 |
| 335 | Ga0207680_10060199 | 3300025903 | Bacteria | 2310 |
| 336 | Ga0207647_10000067 | 3300025904 | Bacteria | 81496 |
| 337 | Ga0207647_10009112 | 3300025904 | Bacteria | 7066 |
| 338 | Ga0207647_10024458 | 3300025904 | Bacteria | 3982 |
| 339 | Ga0207647_10135957 | 3300025904 | Unclassified | 1443 |
| 340 | Ga0207645_10000046 | 3300025907 | Bacteria | 85043 |
| 341 | Ga0207645_10002079 | 3300025907 | Bacteria | 16016 |
| 342 | Ga0207705_10000088 | 3300025909 | Bacteria | 113694 |
| 343 | Ga0207654_10002278 | 3300025911 | Bacteria | 9832 |
| 344 | Ga0207654_10011225 | 3300025911 | Bacteria | 4566 |
| 345 | Ga0207707_10068888 | 3300025912 | Bacteria | 3083 |
| 346 | Ga0207707_10229243 | 3300025912 | Bacteria | 1616 |
| 347 | Ga0207695_10000023 | 3300025913 | Bacteria | 657903 |
| 348 | Ga0207695_10000031 | 3300025913 | Bacteria | 526801 |
| 349 | Ga0207695_10005530 | 3300025913 | Bacteria | 16713 |
| 350 | Ga0207695_10013245 | 3300025913 | Bacteria | 9840 |
| 351 | Ga0207695_10015486 | 3300025913 | Bacteria | 8973 |
| 352 | Ga0207671_10000103 | 3300025914 | Bacteria | 129408 |
| 353 | Ga0207671_10005853 | 3300025914 | Bacteria | 11171 |
| 354 | Ga0207671_10007952 | 3300025914 | Bacteria | 9088 |
| 355 | Ga0207671_10009391 | 3300025914 | Bacteria | 8177 |
| 356 | Ga0207671_10011734 | 3300025914 | Bacteria | 7099 |
| 357 | Ga0207671_10046626 | 3300025914 | Bacteria | 3207 |
| 358 | Ga0207671_10070556 | 3300025914 | Bacteria | 2605 |
| 359 | Ga0207657_10054302 | 3300025919 | Bacteria | 3465 |
| 360 | Ga0207657_10096489 | 3300025919 | Bacteria | 2459 |
| 361 | Ga0207657_10107054 | 3300025919 | Bacteria | 2313 |
| 362 | Ga0207649_10007482 | 3300025920 | Bacteria | 5939 |
| 363 | Ga0207652_10004883 | 3300025921 | Bacteria | 10849 |
| 364 | Ga0207652_10157306 | 3300025921 | Bacteria | 2036 |
| 365 | Ga0207681_10023476 | 3300025923 | Bacteria | 3945 |
| 366 | Ga0207681_10171034 | 3300025923 | Bacteria | 1647 |
| 367 | Ga0207694_10007148 | 3300025924 | Bacteria | 8486 |
| 368 | Ga0207694_10221379 | 3300025924 | Bacteria | 1544 |
| 369 | Ga0207650_10112789 | 3300025925 | Bacteria | 2107 |
| 370 | Ga0207659_10013415 | 3300025926 | Bacteria | 5247 |
| 371 | Ga0207644_10022476 | 3300025931 | Bacteria | 4310 |
| 372 | Ga0207644_10038320 | 3300025931 | Unclassified | 3376 |
| 373 | Ga0207644_10369555 | 3300025931 | Bacteria | 1168 |
| 374 | Ga0207690_10000304 | 3300025932 | Bacteria | 34321 |
| 375 | Ga0207690_10004369 | 3300025932 | Bacteria | 8346 |
| 376 | Ga0207706_10000123 | 3300025933 | Bacteria | 83810 |
| 377 | Ga0207706_10002340 | 3300025933 | Bacteria | 18514 |
| 378 | Ga0207706_10005267 | 3300025933 | Bacteria | 12062 |
| 379 | Ga0207706_10012285 | 3300025933 | Bacteria | 7804 |
| 380 | Ga0207706_10019359 | 3300025933 | Bacteria | 6123 |
| 381 | Ga0207706_10057267 | 3300025933 | Bacteria | 3434 |
| 382 | Ga0207686_10025826 | 3300025934 | Bacteria | 3422 |
| 383 | Ga0207709_10000006 | 3300025935 | Bacteria | 800946 |
| 384 | Ga0207709_10000016 | 3300025935 | Bacteria | 478406 |
| 385 | Ga0207709_10002381 | 3300025935 | Bacteria | 11855 |
| 386 | Ga0207709_10024406 | 3300025935 | Bacteria | 3452 |
| 387 | Ga0207670_10301655 | 3300025936 | Unclassified | 1254 |
| 388 | Ga0207704_10000058 | 3300025938 | Bacteria | 77010 |
| 389 | Ga0207704_10015198 | 3300025938 | Bacteria | 3915 |
| 390 | Ga0207704_10083725 | 3300025938 | Bacteria | 2071 |
| 391 | Ga0207691_10326762 | 3300025940 | Bacteria | 1314 |
| 392 | Ga0207711_10235340 | 3300025941 | Bacteria | 1678 |
| 393 | Ga0207689_10001814 | 3300025942 | Bacteria | 20165 |
| 394 | Ga0207689_10001835 | 3300025942 | Bacteria | 20086 |
| 395 | Ga0207689_10008457 | 3300025942 | Bacteria | 8964 |
| 396 | Ga0207689_10037062 | 3300025942 | Bacteria | 4047 |
| 397 | Ga0207689_10050425 | 3300025942 | Bacteria | 3432 |
| 398 | Ga0207661_10004101 | 3300025944 | Bacteria | 10182 |
| 399 | Ga0207661_10119273 | 3300025944 | Bacteria | 2244 |
| 400 | Ga0207679_10001053 | 3300025945 | Bacteria | 17570 |
| 401 | Ga0207667_10040535 | 3300025949 | Bacteria | 4959 |
| 402 | Ga0207667_10059918 | 3300025949 | Bacteria | 3985 |
| 403 | Ga0207667_10534462 | 3300025949 | Bacteria | 1187 |
| 404 | Ga0207667_10535569 | 3300025949 | Bacteria | 1185 |
| 405 | Ga0207651_10014198 | 3300025960 | Bacteria | 4591 |
| 406 | Ga0207712_10018768 | 3300025961 | Bacteria | 4509 |
| 407 | Ga0207712_10088846 | 3300025961 | Bacteria | 2270 |
| 408 | Ga0207668_10260329 | 3300025972 | Bacteria | 1413 |
| 409 | Ga0207640_10080731 | 3300025981 | Bacteria | 2221 |
| 410 | Ga0207658_10016984 | 3300025986 | Bacteria | 5009 |
| 411 | Ga0207658_10063447 | 3300025986 | Bacteria | 2769 |
| 412 | Ga0207658_10132702 | 3300025986 | Bacteria | 2003 |
| 413 | Ga0207703_10083665 | 3300026035 | Unclassified | 2667 |
| 414 | Ga0207639_10007717 | 3300026041 | Bacteria | 7347 |
| 415 | Ga0207639_10017822 | 3300026041 | Bacteria | 5036 |
| 416 | Ga0207639_10118270 | 3300026041 | Bacteria | 2173 |
| 417 | Ga0207639_10266404 | 3300026041 | Bacteria | 1501 |
| 418 | Ga0207678_10030091 | 3300026067 | Bacteria | 4741 |
| 419 | Ga0207678_10250732 | 3300026067 | Bacteria | 1516 |
| 420 | Ga0207702_10067209 | 3300026078 | Bacteria | 3076 |
| 421 | Ga0207702_10088269 | 3300026078 | Bacteria | 2708 |
| 422 | Ga0207702_10095754 | 3300026078 | Bacteria | 2609 |
| 423 | Ga0207641_10001176 | 3300026088 | Bacteria | 26293 |
| 424 | Ga0207641_10357856 | 3300026088 | Bacteria | 1393 |
| 425 | Ga0207648_10003611 | 3300026089 | Bacteria | 16173 |
| 426 | Ga0207648_10028421 | 3300026089 | Bacteria | 4958 |
| 427 | Ga0207648_10133267 | 3300026089 | Bacteria | 2187 |
| 428 | Ga0207676_10002233 | 3300026095 | Bacteria | 13913 |
| 429 | Ga0207674_10004608 | 3300026116 | Bacteria | 16555 |
| 430 | Ga0207674_10007362 | 3300026116 | Bacteria | 12820 |
| 431 | Ga0207674_10058405 | 3300026116 | Bacteria | 3908 |
| 432 | Ga0207674_10069769 | 3300026116 | Bacteria | 3534 |
| 433 | Ga0207674_10110220 | 3300026116 | Bacteria | 2728 |
| 434 | Ga0207675_100432483 | 3300026118 | Bacteria | 1301 |
| 435 | Ga0207683_10031011 | 3300026121 | Bacteria | 4638 |
| 436 | Ga0207683_10269286 | 3300026121 | Bacteria | 1556 |
| 437 | Ga0207698_10024002 | 3300026142 | Bacteria | 4271 |
| 438 | Ga0207698_10039738 | 3300026142 | Bacteria | 3488 |
| 439 | Ga0207698_10151798 | 3300026142 | Bacteria | 2012 |
| 440 | Ga0207698_10217600 | 3300026142 | Bacteria | 1724 |
| 441 | Ga0207698_10322447 | 3300026142 | Bacteria | 1447 |
| 442 | Ga0209371_1000024 | 3300027312 | Bacteria | 477286 |
| 443 | Ga0268266_10000010 | 3300028379 | Bacteria | 1030233 |
| 444 | Ga0268266_10000111 | 3300028379 | Bacteria | 169743 |
| 445 | Ga0268266_10001914 | 3300028379 | Bacteria | 23412 |
| 446 | Ga0268266_10111680 | 3300028379 | Unclassified | 2422 |
| 447 | Ga0268265_10016052 | 3300028380 | Bacteria | 5138 |
| 448 | Ga0268265_10406664 | 3300028380 | Bacteria | 1260 |
| 449 | Ga0268264_10000012 | 3300028381 | Bacteria | 521740 |
| 450 | Ga0268264_10005699 | 3300028381 | Bacteria | 10558 |
| 451 | Ga0268264_10011858 | 3300028381 | Bacteria | 7180 |
| 452 | Ga0268264_10045884 | 3300028381 | Bacteria | 3630 |
| 453 | Ga0268264_10049332 | 3300028381 | Bacteria | 3502 |
| 454 | Ga0265323_10015106 | 3300028653 | Bacteria | 3042 |
| 455 | Ga0307517_10013867 | 3300028786 | Bacteria | 10894 |
| 456 | Ga0307517_10029907 | 3300028786 | Bacteria | 6408 |
| 457 | Ga0268256_1000026 | 3300030500 | Bacteria | 477260 |
| 458 | Ga0307511_10000264 | 3300030521 | Bacteria | 54303 |
| 459 | Ga0316176_1221375 | 3300030732 | Bacteria | 6020 |
| 460 | Ga0316183_1025751 | 3300030742 | Bacteria | 35611 |
| 461 | Ga0316181_1238304 | 3300030744 | Bacteria | 22220 |
| 462 | Ga0307509_10060456 | 3300031507 | Bacteria | 4005 |
| 463 | Ga0307509_10096439 | 3300031507 | Bacteria | 3009 |
| 464 | Ga0307509_10208674 | 3300031507 | Unclassified | 1781 |
| 465 | Ga0307408_100008446 | 3300031548 | Bacteria | 6798 |
| 466 | Ga0307408_100034619 | 3300031548 | Bacteria | 3538 |
| 467 | Ga0307508_10000926 | 3300031616 | Bacteria | 34077 |
| 468 | Ga0307516_10000959 | 3300031730 | Bacteria | 39813 |
| 469 | Ga0307516_10191775 | 3300031730 | Bacteria | 1769 |
| 470 | Ga0307405_10000038 | 3300031731 | Bacteria | 86305 |
| 471 | Ga0307405_10029137 | 3300031731 | Bacteria | 3223 |
| 472 | Ga0307405_10227588 | 3300031731 | Bacteria | 1372 |
| 473 | Ga0307413_10000190 | 3300031824 | Bacteria | 17657 |
| 474 | Ga0307406_10004300 | 3300031901 | Bacteria | 7745 |
| 475 | Ga0307407_10000005 | 3300031903 | Bacteria | 233125 |
| 476 | Ga0307412_10000007 | 3300031911 | Bacteria | 486267 |
| 477 | Ga0307412_10000045 | 3300031911 | Bacteria | 165021 |
| 478 | Ga0307412_10000175 | 3300031911 | Bacteria | 45704 |
| 479 | Ga0307409_100014401 | 3300031995 | Bacteria | 5144 |
| 480 | Ga0307416_100000001 | 3300032002 | Bacteria | 515017 |
| 481 | Ga0307416_100000003 | 3300032002 | Bacteria | 509060 |
| 482 | Ga0307414_10000722 | 3300032004 | Bacteria | 16914 |
| 483 | Ga0307414_10001496 | 3300032004 | Bacteria | 12126 |
| 484 | Ga0307414_10003547 | 3300032004 | Bacteria | 8354 |
| 485 | Ga0307414_10011808 | 3300032004 | Bacteria | 5140 |
| 486 | Ga0307414_10057710 | 3300032004 | Bacteria | 2730 |
| 487 | Ga0307414_10081914 | 3300032004 | Bacteria | 2364 |
| 488 | Ga0307414_10208661 | 3300032004 | Bacteria | 1595 |
| 489 | Ga0307411_10000007 | 3300032005 | Bacteria | 332057 |
| 490 | Ga0307510_10002234 | 3300033180 | Bacteria | 21891 |
| 491 | Ga0307510_10002335 | 3300033180 | Bacteria | 21445 |
| 492 | Ga0373957_0116055 | 3300035120 | Bacteria | 1081 |
| 493 | Ga0373933_0026277 | 3300035724 | Bacteria | 3343 |
| 494 | Ga0395899_0002435 | 3300037312 | Bacteria | 15139 |
| 495 | Ga0395900_0000141 | 3300037418 | Bacteria | 121159 |
| 496 | Ga0395900_0004558 | 3300037418 | Bacteria | 14641 |
| 497 | Ga0395900_0611609 | 3300037418 | Bacteria | 1029 |
| 498 | Ga0395898_0016196 | 3300037466 | Bacteria | 7635 |
| 499 | Ga0395898_0139976 | 3300037466 | Bacteria | 2316 |
| 500 | Ga0395905_0000124 | 3300037471 | Bacteria | 126707 |
| 501 | Ga0395905_0001156 | 3300037471 | Bacteria | 33041 |
| 502 | Ga0395901_0000138 | 3300038443 | Bacteria | 94944 |
| 503 | Ga0395901_0001199 | 3300038443 | Bacteria | 27585 |
| 504 | Ga0436361_0166876 | 3300039447 | Bacteria | 8411 |
| 505 | Ga0439436_0002217 | 3300041404 | Bacteria | 5820 |
| 506 | Ga0439436_0016924 | 3300041404 | Bacteria | 2185 |
| 507 | Ga0439466_0002102 | 3300041411 | Bacteria | 7800 |
| 508 | Ga0439465_0001390 | 3300041413 | Bacteria | 7812 |
| 509 | Ga0451800_0887562 | 3300041459 | Bacteria | 1472 |
| 510 | Ga0439442_008724 | 3300042002 | Bacteria | 2047 |
| 511 | Ga0439445_0001732 | 3300042004 | Bacteria | 4803 |
| 512 | Ga0450894_004765 | 3300042131 | Unclassified | 1758 |
| 513 | Ga0466969_0000207 | 3300044656 | Bacteria | 32129 |
| 514 | Ga0466972_0000009 | 3300044658 | Bacteria | 256374 |
| 515 | Ga0466972_0000010 | 3300044658 | Bacteria | 256339 |
| 516 | Ga0466972_0000027 | 3300044658 | Bacteria | 174082 |
| 517 | Ga0466972_0010416 | 3300044658 | Bacteria | 4668 |
| 518 | Ga0466972_0010519 | 3300044658 | Bacteria | 4644 |
| 519 | Ga0466972_0122304 | 3300044658 | Bacteria | 1227 |
| 520 | Ga0466966_0132959 | 3300044684 | Bacteria | 1522 |
| 521 | Ga0466964_0057289 | 3300044706 | Bacteria | 1613 |
| 522 | Ga0466968_0015936 | 3300044735 | Bacteria | 2986 |
| 523 | Ga0466968_0062379 | 3300044735 | Bacteria | 1609 |
| 524 | Ga0466970_0000405 | 3300044765 | Bacteria | 20994 |
| 525 | Ga0466970_0170214 | 3300044765 | Bacteria | 1207 |
| 526 | Ga0466959_0000236 | 3300045049 | Bacteria | 34631 |
| 527 | Ga0466959_0049484 | 3300045049 | Bacteria | 3088 |
| 528 | Ga0495627_000002 | 3300046453 | Bacteria | 903861 |
| 529 | Ga0495627_022153 | 3300046453 | Bacteria | 2094 |
| 530 | Ga0495638_0046148 | 3300046460 | Bacteria | 2738 |
| 531 | Ga0495638_0081583 | 3300046460 | Bacteria | 1963 |
| 532 | Ga0495650_0000003 | 3300046471 | Bacteria | 900730 |
| 533 | Ga0495585_0000771 | 3300046492 | Bacteria | 28305 |
| 534 | Ga0495596_0003434 | 3300046500 | Bacteria | 8018 |
| 535 | Ga0495607_0140002 | 3300046501 | Bacteria | 1249 |
| 536 | Ga0495583_0030894 | 3300046506 | Bacteria | 2603 |
| 537 | Ga0495606_0000116 | 3300046507 | Bacteria | 134901 |
| 538 | Ga0495606_0020040 | 3300046507 | Bacteria | 4947 |
| 539 | Ga0495610_0000009 | 3300046512 | Bacteria | 554843 |
| 540 | Ga0495610_0000064 | 3300046512 | Bacteria | 125922 |
| 541 | Ga0495610_0011164 | 3300046512 | Bacteria | 5510 |
| 542 | Ga0495610_0054794 | 3300046512 | Bacteria | 1925 |
| 543 | Ga0495616_0010178 | 3300046513 | Bacteria | 5457 |
| 544 | Ga0495618_0205499 | 3300046514 | Bacteria | 1246 |
| 545 | Ga0495628_0073998 | 3300046516 | Bacteria | 2654 |
| 546 | Ga0495630_0011490 | 3300046517 | Bacteria | 6412 |
| 547 | Ga0495631_0037602 | 3300046518 | Bacteria | 2156 |
| 548 | Ga0495632_0001668 | 3300046519 | Bacteria | 18183 |
| 549 | Ga0495632_0005176 | 3300046519 | Bacteria | 8703 |
| 550 | Ga0495637_0063632 | 3300046520 | Bacteria | 1507 |
| 551 | Ga0495637_0071355 | 3300046520 | Bacteria | 1401 |
| 552 | Ga0495648_0009686 | 3300046524 | Bacteria | 7426 |
| 553 | Ga0495663_0000315 | 3300046525 | Bacteria | 18182 |
| 554 | Ga0495654_0000001 | 3300046530 | Bacteria | 1513197 |
| 555 | Ga0495609_0017858 | 3300046538 | Bacteria | 3293 |
| 556 | Ga0495609_0117341 | 3300046538 | Bacteria | 1146 |
| 557 | Ga0495633_0000002 | 3300046558 | Bacteria | 488754 |
| 558 | Ga0495633_0000894 | 3300046558 | Bacteria | 25504 |
| 559 | Ga0495633_0010869 | 3300046558 | Bacteria | 4948 |
| 560 | Ga0495633_0091543 | 3300046558 | Bacteria | 1414 |
| 561 | Ga0495668_0000616 | 3300046616 | Bacteria | 43040 |
| 562 | Ga0495668_0003175 | 3300046616 | Bacteria | 12632 |
| 563 | Ga0495611_0001388 | 3300046648 | Bacteria | 12117 |
| 564 | Ga0495625_0000219 | 3300046660 | Bacteria | 90690 |
| 565 | Ga0495625_0000899 | 3300046660 | Bacteria | 40086 |
| 566 | Ga0495625_0052379 | 3300046660 | Bacteria | 2923 |
| 567 | Ga0495625_0072031 | 3300046660 | Bacteria | 2424 |
| 568 | Ga0495661_0001366 | 3300046665 | Bacteria | 20602 |
| 569 | Ga0495661_0023473 | 3300046665 | Bacteria | 4004 |
| 570 | Ga0495661_0025387 | 3300046665 | Bacteria | 3827 |
| 571 | Ga0495649_0000037 | 3300046694 | Bacteria | 133848 |
| 572 | Ga0495683_0011413 | 3300047323 | Bacteria | 4675 |
| 573 | Ga0495687_000009 | 3300047443 | Bacteria | 419317 |
| 574 | Ga0495687_001565 | 3300047443 | Bacteria | 20768 |
| 575 | Ga0495687_001658 | 3300047443 | Bacteria | 19993 |
| 576 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 577 | Ga0495686_0000095 | 3300047472 | Bacteria | 184643 |
| 578 | Ga0495686_0000298 | 3300047472 | Bacteria | 85528 |
| 579 | Ga0495686_0009867 | 3300047472 | Bacteria | 6843 |
| 580 | Ga0495686_0061103 | 3300047472 | Bacteria | 2341 |
| 581 | Ga0496102_0083518 | 3300048905 | Bacteria | 2947 |
| 582 | Ga0496103_0021329 | 3300048906 | Bacteria | 3897 |
| 583 | Ga0496104_0175747 | 3300048907 | Bacteria | 2052 |
| 584 | Ga0496105_0198964 | 3300048908 | Bacteria | 1636 |
| 585 | Ga0496106_0135021 | 3300048909 | Bacteria | 1937 |
| 586 | Ga0496116_0000022 | 3300048919 | Bacteria | 482506 |
| 587 | Ga0496116_0009389 | 3300048919 | Bacteria | 8343 |
| 588 | Ga0496117_0000074 | 3300048920 | Bacteria | 232732 |
| 589 | Ga0496117_0001473 | 3300048920 | Bacteria | 33842 |
| 590 | Ga0496118_0001613 | 3300048921 | Bacteria | 33370 |
| 591 | Ga0496118_0046262 | 3300048921 | Bacteria | 3388 |
| 592 | Ga0496119_0000017 | 3300048922 | Bacteria | 309779 |
| 593 | Ga0496121_0000010 | 3300048924 | Bacteria | 793488 |
| 594 | Ga0496121_0063112 | 3300048924 | Bacteria | 3030 |
| 595 | Ga0496122_0000159 | 3300048925 | Bacteria | 159297 |
| 596 | Ga0496122_0000354 | 3300048925 | Bacteria | 98798 |
| 597 | Ga0496122_0000357 | 3300048925 | Bacteria | 98456 |
| 598 | Ga0496122_0000591 | 3300048925 | Bacteria | 74549 |
| 599 | Ga0496122_0002282 | 3300048925 | Bacteria | 27757 |
| 600 | Ga0496122_0002637 | 3300048925 | Bacteria | 25070 |
| 601 | Ga0496122_0005231 | 3300048925 | Bacteria | 15573 |
| 602 | Ga0496123_0001157 | 3300048926 | Bacteria | 39190 |
| 603 | Ga0496123_0002468 | 3300048926 | Bacteria | 22867 |
| 604 | Ga0496123_0003951 | 3300048926 | Bacteria | 16069 |
| 605 | Ga0496123_0010609 | 3300048926 | Bacteria | 8109 |
| 606 | Ga0496123_0047728 | 3300048926 | Bacteria | 2889 |
| 607 | Ga0496124_0015613 | 3300048927 | Bacteria | 7269 |
| 608 | Ga0496125_0001036 | 3300048928 | Bacteria | 43109 |
| 609 | Ga0496125_0001152 | 3300048928 | Bacteria | 40077 |
| 610 | Ga0496125_0003480 | 3300048928 | Bacteria | 19037 |
| 611 | Ga0496125_0011088 | 3300048928 | Bacteria | 9042 |
| 612 | Ga0496125_0011573 | 3300048928 | Bacteria | 8814 |
| 613 | Ga0496125_0067715 | 3300048928 | Bacteria | 2812 |
| 614 | Ga0496125_0160243 | 3300048928 | Bacteria | 1529 |
| 615 | Ga0496126_0001468 | 3300048929 | Bacteria | 36714 |
| 616 | Ga0496126_0172745 | 3300048929 | Bacteria | 1840 |
| 617 | Ga0501034_0082568 | 3300049571 | Bacteria | 3215 |
| 618 | Ga0501034_0188035 | 3300049571 | Bacteria | 2028 |
| 619 | Ga0501038_0032093 | 3300049574 | Bacteria | 4637 |
| 620 | Ga0501047_0228685 | 3300049581 | Bacteria | 1714 |
| 621 | Ga0501217_000800 | 3300049661 | Bacteria | 5490 |
| 622 | Ga0501236_004922 | 3300049670 | Bacteria | 1602 |
| 623 | Ga0501247_003325 | 3300049677 | Unclassified | 1719 |
| 624 | Ga0501249_000001 | 3300049679 | Bacteria | 268580 |
| 625 | Ga0501249_001838 | 3300049679 | Bacteria | 4322 |
| 626 | Ga0501250_004298 | 3300049680 | Bacteria | 1410 |
| 627 | Ga0501219_001632 | 3300049703 | Bacteria | 2009 |
| 628 | Ga0501225_0040220 | 3300049705 | Unclassified | 1288 |
| 629 | Ga0501241_000254 | 3300049758 | Bacteria | 11801 |
| 630 | Ga0501241_013384 | 3300049758 | Bacteria | 1490 |
| 631 | Ga0501264_000029 | 3300049761 | Bacteria | 22049 |
| 632 | Ga0501266_000010 | 3300049763 | Bacteria | 214932 |
| 633 | Ga0501269_000185 | 3300049766 | Bacteria | 19129 |
| 634 | Ga0501035_0266402 | 3300049822 | Bacteria | 1451 |
| 635 | Ga0501044_0080712 | 3300049823 | Bacteria | 3294 |
| 636 | Ga0501044_0324314 | 3300049823 | Bacteria | 1464 |
| 637 | Ga0501284_00027 | 3300050005 | Bacteria | 76239 |
| 638 | nmdc:mga0k408_25502_c1 | 3300050493 | Bacteria | 3348 |
| 639 | nmdc:mga0k408_784_c1 | 3300050493 | Bacteria | 17473 |
| 640 | nmdc:mga05p37_11042_c1 | 3300050507 | Bacteria | 10730 |
| 641 | Ga0500578_0000386 | 3300053086 | Bacteria | 54049 |
| 642 | Ga0500644_0000070 | 3300053088 | Bacteria | 61261 |
| 643 | Ga0500583_0000035 | 3300053092 | Bacteria | 96248 |
| 644 | Ga0500583_0016285 | 3300053092 | Bacteria | 2964 |
| 645 | Ga0500651_0194340 | 3300053093 | Bacteria | 1200 |
| 646 | Ga0500641_0017392 | 3300053096 | Bacteria | 2688 |
| 647 | Ga0500556_0009571 | 3300053104 | Bacteria | 2820 |
| 648 | Ga0500556_0055830 | 3300053104 | Bacteria | 1441 |
| 649 | Ga0500618_009191 | 3300053125 | Bacteria | 2711 |
| 650 | Ga0500642_0058694 | 3300053130 | Bacteria | 1721 |
| 651 | Ga0500652_012210 | 3300053131 | Bacteria | 3007 |
| 652 | Ga0500652_042276 | 3300053131 | Unclassified | 1838 |
| 653 | Ga0500658_0000019 | 3300053134 | Bacteria | 141013 |
| 654 | Ga0500658_0023115 | 3300053134 | Bacteria | 2371 |
| 655 | Ga0500561_0035796 | 3300053137 | Bacteria | 1283 |
| 656 | Ga0500568_0011971 | 3300053139 | Bacteria | 4003 |
| 657 | Ga0500568_0015938 | 3300053139 | Bacteria | 3353 |
| 658 | Ga0500577_0001728 | 3300053142 | Bacteria | 5597 |
| 659 | Ga0500588_0002998 | 3300053146 | Bacteria | 3519 |
| 660 | Ga0500588_0010301 | 3300053146 | Bacteria | 2253 |
| 661 | Ga0500604_0001088 | 3300053151 | Bacteria | 7567 |
| 662 | Ga0500616_0005269 | 3300053153 | Bacteria | 8838 |
| 663 | Ga0500616_0006531 | 3300053153 | Bacteria | 7620 |
| 664 | Ga0500622_0000010 | 3300053156 | Bacteria | 398804 |
| 665 | Ga0500622_0000035 | 3300053156 | Bacteria | 182924 |
| 666 | Ga0500622_0000222 | 3300053156 | Bacteria | 59404 |
| 667 | Ga0500622_0000869 | 3300053156 | Bacteria | 25724 |
| 668 | Ga0500622_0000915 | 3300053156 | Bacteria | 25127 |
| 669 | Ga0500622_0002688 | 3300053156 | Bacteria | 12598 |
| 670 | Ga0500622_0038362 | 3300053156 | Bacteria | 2499 |
| 671 | Ga0500627_0002684 | 3300053158 | Bacteria | 5329 |
| 672 | Ga0500634_0126772 | 3300053161 | Bacteria | 1233 |
| 673 | Ga0500636_0023141 | 3300053177 | Bacteria | 3672 |
| 674 | Ga0500611_011417 | 3300053727 | Bacteria | 1469 |
| 675 | Ga0500656_011869 | 3300053732 | Bacteria | 976 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053732 | Ga0500656_011869 | Ga0500656_011869_23_913 | 295 |
| 2 | 3300037418 | Ga0395900_0611609 | Ga0395900_0611609_111_1013 | 299 |
| 3 | 3300035120 | Ga0373957_0116055 | Ga0373957_0116055_116_1036 | 304 |
| 4 | 3300013100 | Ga0157373_10005929 | Ga0157373_100059293 | 305 |
| 5 | 3300053156 | Ga0500622_0000035 | Ga0500622_0000035_164312_165232 | 305 |
| 6 | 3300053156 | Ga0500622_0000222 | Ga0500622_0000222_39697_40617 | 305 |
| 7 | 3300009174 | Ga0105241_10461176 | Ga0105241_104611762 | 306 |
| 8 | 3300009093 | Ga0105240_10000168 | Ga0105240_100001682 | 307 |
| 9 | 3300025913 | Ga0207695_10000023 | Ga0207695_10000023305 | 307 |
| 10 | 3300025913 | Ga0207695_10000031 | Ga0207695_10000031269 | 307 |
| 11 | 3300046512 | Ga0495610_0054794 | Ga0495610_0054794_943_1869 | 307 |
| 12 | 3300046538 | Ga0495609_0117341 | Ga0495609_0117341_163_1089 | 307 |
| 13 | 3300046648 | Ga0495611_0001388 | Ga0495611_0001388_3637_4563 | 307 |
| 14 | 3300053088 | Ga0500644_0000070 | Ga0500644_0000070_40396_41322 | 307 |
| 15 | 3300053134 | Ga0500658_0023115 | Ga0500658_0023115_479_1405 | 307 |
| 16 | 3300053137 | Ga0500561_0035796 | Ga0500561_0035796_32_958 | 307 |
| 17 | 3300053142 | Ga0500577_0001728 | Ga0500577_0001728_2088_3014 | 307 |
| 18 | 3300053146 | Ga0500588_0010301 | Ga0500588_0010301_984_1910 | 307 |
| 19 | 3300053153 | Ga0500616_0005269 | Ga0500616_0005269_7005_7931 | 307 |
| 20 | 3300005563 | Ga0068855_100041771 | Ga0068855_1000417712 | 311 |
| 21 | 3300009174 | Ga0105241_10099616 | Ga0105241_100996162 | 311 |
| 22 | 3300009545 | Ga0105237_10136018 | Ga0105237_101360182 | 311 |
| 23 | 3300025949 | Ga0207667_10040535 | Ga0207667_100405352 | 311 |
| 24 | 2162886011 | MRS1b_contig_8779386 | MRS1b_0045.00003160 | 312 |
| 25 | 3300005617 | Ga0068859_100184228 | Ga0068859_1001842282 | 312 |
| 26 | 3300048924 | Ga0496121_0000010 | Ga0496121_0000010_667579_668517 | 312 |
| 27 | 3300003781 | Ga0055536_1009986 | Ga0055536_10099863 | 313 |
| 28 | 3300005262 | Ga0065165_1000057 | Ga0065165_1000057116 | 313 |
| 29 | 3300005614 | Ga0068856_100126311 | Ga0068856_1001263112 | 313 |
| 30 | 3300013104 | Ga0157370_10343322 | Ga0157370_103433222 | 313 |
| 31 | 3300025911 | Ga0207654_10011225 | Ga0207654_100112253 | 313 |
| 32 | 3300025914 | Ga0207671_10007952 | Ga0207671_100079523 | 313 |
| 33 | 3300025924 | Ga0207694_10007148 | Ga0207694_100071483 | 313 |
| 34 | 3300026078 | Ga0207702_10088269 | Ga0207702_100882692 | 313 |
| 35 | 3300026142 | Ga0207698_10151798 | Ga0207698_101517981 | 313 |
| 36 | 3300031731 | Ga0307405_10227588 | Ga0307405_102275882 | 313 |
| 37 | 3300032004 | Ga0307414_10057710 | Ga0307414_100577102 | 313 |
| 38 | 3300053093 | Ga0500651_0194340 | Ga0500651_0194340_13_954 | 313 |
| 39 | 3300053131 | Ga0500652_012210 | Ga0500652_012210_1636_2577 | 313 |
| 40 | 3300053139 | Ga0500568_0011971 | Ga0500568_0011971_2410_3351 | 313 |
| 41 | 3300053139 | Ga0500568_0015938 | Ga0500568_0015938_1292_2233 | 313 |
| 42 | 3300053161 | Ga0500634_0126772 | Ga0500634_0126772_263_1204 | 313 |
| 43 | 3300025904 | Ga0207647_10009112 | Ga0207647_100091123 | 315 |
| 44 | 3300025298 | Ga0209050_1003096 | Ga0209050_100309610 | 320 |
| 45 | iso_pu_bacteria | 2910245624 | 2910246631 | 321 |
| 46 | iso_pu_bacteria | 2896109856 | 2896111023 | 322 |
| 47 | iso_pu_bacteria | 2599185184 | 2599478560 | 323 |
| 48 | iso_pu_bacteria | 2818991460 | 2819681295 | 323 |
| 49 | iso_pu_bacteria | 2852623160 | 2852624970 | 323 |
| 50 | iso_pu_bacteria | 2884933994 | 2884936005 | 323 |
| 51 | iso_pu_bacteria | 2928078545 | 2928080386 | 323 |
| 52 | iso_pu_bacteria | 2928147474 | 2928149441 | 323 |
| 53 | iso_pu_bacteria | 2929239360 | 2929242649 | 323 |
| 54 | iso_pu_bacteria | 2932082852 | 2932083270 | 323 |
| 55 | 3300009545 | Ga0105237_10004647 | Ga0105237_100046472 | 324 |
| 56 | 3300025914 | Ga0207671_10000103 | Ga0207671_1000010314 | 324 |
| 57 | 3300026118 | Ga0207675_100432483 | Ga0207675_1004324831 | 324 |
| 58 | 3300001979 | JGI24740J21852_10026941 | JGI24740J21852_100269412 | 325 |
| 59 | 3300001979 | JGI24740J21852_10038301 | JGI24740J21852_100383012 | 325 |
| 60 | 3300001990 | JGI24737J22298_10012381 | JGI24737J22298_100123812 | 325 |
| 61 | 3300002067 | JGI24735J21928_10006150 | JGI24735J21928_100061503 | 325 |
| 62 | 3300003316 | rootH1_10003905 | rootH1_100039053 | 325 |
| 63 | 3300003320 | rootH2_10011484 | rootH2_1001148410 | 325 |
| 64 | 3300003322 | rootL2_10066242 | rootL2_100662422 | 325 |
| 65 | 3300005334 | Ga0068869_100115391 | Ga0068869_1001153913 | 325 |
| 66 | 3300005339 | Ga0070660_100098392 | Ga0070660_1000983922 | 325 |
| 67 | 3300005366 | Ga0070659_100000333 | Ga0070659_10000033322 | 325 |
| 68 | 3300005367 | Ga0070667_100039197 | Ga0070667_1000391976 | 325 |
| 69 | 3300005457 | Ga0070662_100005182 | Ga0070662_1000051823 | 325 |
| 70 | 3300005577 | Ga0068857_100009916 | Ga0068857_1000099169 | 325 |
| 71 | 3300005616 | Ga0068852_100172245 | Ga0068852_1001722452 | 325 |
| 72 | 3300005843 | Ga0068860_100040364 | Ga0068860_1000403646 | 325 |
| 73 | 3300005844 | Ga0068862_100076911 | Ga0068862_1000769114 | 325 |
| 74 | 3300006195 | Ga0075366_10090686 | Ga0075366_100906862 | 325 |
| 75 | 3300009545 | Ga0105237_10007788 | Ga0105237_100077883 | 325 |
| 76 | 3300010375 | Ga0105239_10006368 | Ga0105239_1000636810 | 325 |
| 77 | 3300013307 | Ga0157372_10083990 | Ga0157372_100839903 | 325 |
| 78 | 3300025904 | Ga0207647_10135957 | Ga0207647_101359571 | 325 |
| 79 | 3300025914 | Ga0207671_10046626 | Ga0207671_100466263 | 325 |
| 80 | 3300025919 | Ga0207657_10107054 | Ga0207657_101070542 | 325 |
| 81 | 3300025932 | Ga0207690_10000304 | Ga0207690_1000030412 | 325 |
| 82 | 3300025933 | Ga0207706_10002340 | Ga0207706_1000234023 | 325 |
| 83 | 3300025942 | Ga0207689_10050425 | Ga0207689_100504253 | 325 |
| 84 | 3300026116 | Ga0207674_10007362 | Ga0207674_100073622 | 325 |
| 85 | 3300026142 | Ga0207698_10217600 | Ga0207698_102176002 | 325 |
| 86 | 3300028380 | Ga0268265_10016052 | Ga0268265_100160523 | 325 |
| 87 | 3300028381 | Ga0268264_10049332 | Ga0268264_100493321 | 325 |
| 88 | 3300031548 | Ga0307408_100008446 | Ga0307408_1000084464 | 325 |
| 89 | 3300031548 | Ga0307408_100034619 | Ga0307408_1000346193 | 325 |
| 90 | 3300031731 | Ga0307405_10029137 | Ga0307405_100291372 | 325 |
| 91 | 3300031901 | Ga0307406_10004300 | Ga0307406_100043007 | 325 |
| 92 | 3300046616 | Ga0495668_0003175 | Ga0495668_0003175_10410_11393 | 325 |
| 93 | 3300049661 | Ga0501217_000800 | Ga0501217_000800_3010_3990 | 325 |
| 94 | 3300049670 | Ga0501236_004922 | Ga0501236_004922_323_1303 | 325 |
| 95 | 3300049677 | Ga0501247_003325 | Ga0501247_003325_701_1681 | 325 |
| 96 | 3300049703 | Ga0501219_001632 | Ga0501219_001632_483_1469 | 325 |
| 97 | 3300049705 | Ga0501225_0040220 | Ga0501225_0040220_211_1197 | 325 |
| 98 | 3300049758 | Ga0501241_013384 | Ga0501241_013384_294_1280 | 325 |
| 99 | 3300049761 | Ga0501264_000029 | Ga0501264_000029_1034_2014 | 325 |
| 100 | 3300050005 | Ga0501284_00027 | Ga0501284_00027_74865_75851 | 325 |
| 101 | 3300053151 | Ga0500604_0001088 | Ga0500604_0001088_3657_4637 | 325 |
| 102 | 3300053156 | Ga0500622_0000010 | Ga0500622_0000010_20961_21941 | 325 |
| 103 | iso_pu_bacteria | 2914759650 | 2914760489 | 325 |
| 104 | 3300001990 | JGI24737J22298_10020942 | JGI24737J22298_100209422 | 326 |
| 105 | 3300003316 | rootH1_10028754 | rootH1_100287542 | 326 |
| 106 | 3300003320 | rootH2_10001801 | rootH2_1000180185 | 326 |
| 107 | 3300003322 | rootL2_10189861 | rootL2_101898612 | 326 |
| 108 | 3300003323 | rootH1_10157014 | rootH1_101570142 | 326 |
| 109 | 3300003794 | Ga0055531_10000071 | Ga0055531_1000007154 | 326 |
| 110 | 3300005290 | Ga0065712_10141975 | Ga0065712_101419752 | 326 |
| 111 | 3300005327 | Ga0070658_10000025 | Ga0070658_10000025177 | 326 |
| 112 | 3300005328 | Ga0070676_10000058 | Ga0070676_1000005811 | 326 |
| 113 | 3300005328 | Ga0070676_10013674 | Ga0070676_100136742 | 326 |
| 114 | 3300005329 | Ga0070683_100022739 | Ga0070683_1000227397 | 326 |
| 115 | 3300005329 | Ga0070683_100093455 | Ga0070683_1000934553 | 326 |
| 116 | 3300005330 | Ga0070690_100014466 | Ga0070690_1000144666 | 326 |
| 117 | 3300005331 | Ga0070670_100097515 | Ga0070670_1000975152 | 326 |
| 118 | 3300005334 | Ga0068869_100010539 | Ga0068869_1000105397 | 326 |
| 119 | 3300005334 | Ga0068869_100062633 | Ga0068869_1000626333 | 326 |
| 120 | 3300005335 | Ga0070666_10050561 | Ga0070666_100505612 | 326 |
| 121 | 3300005335 | Ga0070666_10051528 | Ga0070666_100515282 | 326 |
| 122 | 3300005338 | Ga0068868_100008858 | Ga0068868_1000088587 | 326 |
| 123 | 3300005340 | Ga0070689_100297457 | Ga0070689_1002974572 | 326 |
| 124 | 3300005344 | Ga0070661_100000394 | Ga0070661_10000039424 | 326 |
| 125 | 3300005344 | Ga0070661_100002053 | Ga0070661_1000020531 | 326 |
| 126 | 3300005354 | Ga0070675_100014913 | Ga0070675_1000149136 | 326 |
| 127 | 3300005355 | Ga0070671_100171890 | Ga0070671_1001718902 | 326 |
| 128 | 3300005364 | Ga0070673_100005738 | Ga0070673_1000057388 | 326 |
| 129 | 3300005364 | Ga0070673_100139440 | Ga0070673_1001394402 | 326 |
| 130 | 3300005365 | Ga0070688_100002798 | Ga0070688_1000027982 | 326 |
| 131 | 3300005365 | Ga0070688_100003235 | Ga0070688_10000323510 | 326 |
| 132 | 3300005366 | Ga0070659_100004546 | Ga0070659_1000045469 | 326 |
| 133 | 3300005367 | Ga0070667_100036633 | Ga0070667_1000366334 | 326 |
| 134 | 3300005456 | Ga0070678_100012232 | Ga0070678_1000122323 | 326 |
| 135 | 3300005456 | Ga0070678_100087892 | Ga0070678_1000878922 | 326 |
| 136 | 3300005457 | Ga0070662_100000055 | Ga0070662_10000005559 | 326 |
| 137 | 3300005457 | Ga0070662_100024544 | Ga0070662_1000245445 | 326 |
| 138 | 3300005457 | Ga0070662_100026860 | Ga0070662_1000268602 | 326 |
| 139 | 3300005457 | Ga0070662_100165477 | Ga0070662_1001654771 | 326 |
| 140 | 3300005459 | Ga0068867_100001957 | Ga0068867_10000195712 | 326 |
| 141 | 3300005466 | Ga0070685_10010745 | Ga0070685_100107453 | 326 |
| 142 | 3300005535 | Ga0070684_100000214 | Ga0070684_10000021423 | 326 |
| 143 | 3300005535 | Ga0070684_100106567 | Ga0070684_1001065674 | 326 |
| 144 | 3300005535 | Ga0070684_100222471 | Ga0070684_1002224711 | 326 |
| 145 | 3300005539 | Ga0068853_100011469 | Ga0068853_1000114694 | 326 |
| 146 | 3300005539 | Ga0068853_100068624 | Ga0068853_1000686242 | 326 |
| 147 | 3300005544 | Ga0070686_100055842 | Ga0070686_1000558423 | 326 |
| 148 | 3300005548 | Ga0070665_100000034 | Ga0070665_100000034216 | 326 |
| 149 | 3300005548 | Ga0070665_100105863 | Ga0070665_1001058632 | 326 |
| 150 | 3300005563 | Ga0068855_100100099 | Ga0068855_1001000992 | 326 |
| 151 | 3300005563 | Ga0068855_100607187 | Ga0068855_1006071871 | 326 |
| 152 | 3300005564 | Ga0070664_100003687 | Ga0070664_1000036872 | 326 |
| 153 | 3300005577 | Ga0068857_100005631 | Ga0068857_1000056318 | 326 |
| 154 | 3300005577 | Ga0068857_100006534 | Ga0068857_1000065349 | 326 |
| 155 | 3300005578 | Ga0068854_100014991 | Ga0068854_1000149915 | 326 |
| 156 | 3300005614 | Ga0068856_100001729 | Ga0068856_1000017292 | 326 |
| 157 | 3300005615 | Ga0070702_100023869 | Ga0070702_1000238695 | 326 |
| 158 | 3300005616 | Ga0068852_100020101 | Ga0068852_1000201013 | 326 |
| 159 | 3300005616 | Ga0068852_100423063 | Ga0068852_1004230632 | 326 |
| 160 | 3300005617 | Ga0068859_100024970 | Ga0068859_1000249707 | 326 |
| 161 | 3300005617 | Ga0068859_100105082 | Ga0068859_1001050823 | 326 |
| 162 | 3300005618 | Ga0068864_100011569 | Ga0068864_1000115696 | 326 |
| 163 | 3300005618 | Ga0068864_100055735 | Ga0068864_1000557353 | 326 |
| 164 | 3300005718 | Ga0068866_10045142 | Ga0068866_100451422 | 326 |
| 165 | 3300005834 | Ga0068851_10127309 | Ga0068851_101273092 | 326 |
| 166 | 3300005841 | Ga0068863_100312112 | Ga0068863_1003121122 | 326 |
| 167 | 3300005842 | Ga0068858_100162571 | Ga0068858_1001625713 | 326 |
| 168 | 3300006237 | Ga0097621_100001787 | Ga0097621_1000017875 | 326 |
| 169 | 3300006358 | Ga0068871_100000099 | Ga0068871_10000009936 | 326 |
| 170 | 3300006358 | Ga0068871_100119257 | Ga0068871_1001192572 | 326 |
| 171 | 3300006881 | Ga0068865_100000055 | Ga0068865_10000005516 | 326 |
| 172 | 3300006881 | Ga0068865_100050491 | Ga0068865_1000504913 | 326 |
| 173 | 3300006881 | Ga0068865_100066543 | Ga0068865_1000665433 | 326 |
| 174 | 3300006931 | Ga0097620_100024970 | Ga0097620_1000249707 | 326 |
| 175 | 3300006931 | Ga0097620_100105080 | Ga0097620_1001050803 | 326 |
| 176 | 3300009011 | Ga0105251_10058269 | Ga0105251_100582691 | 326 |
| 177 | 3300009093 | Ga0105240_10006315 | Ga0105240_100063154 | 326 |
| 178 | 3300009093 | Ga0105240_10036262 | Ga0105240_100362622 | 326 |
| 179 | 3300009093 | Ga0105240_10399573 | Ga0105240_103995732 | 326 |
| 180 | 3300009098 | Ga0105245_10133751 | Ga0105245_101337512 | 326 |
| 181 | 3300009148 | Ga0105243_10033408 | Ga0105243_100334082 | 326 |
| 182 | 3300009174 | Ga0105241_10000727 | Ga0105241_100007275 | 326 |
| 183 | 3300009174 | Ga0105241_10011531 | Ga0105241_100115313 | 326 |
| 184 | 3300009176 | Ga0105242_10050853 | Ga0105242_100508532 | 326 |
| 185 | 3300009177 | Ga0105248_10163029 | Ga0105248_101630292 | 326 |
| 186 | 3300009545 | Ga0105237_10000465 | Ga0105237_1000046535 | 326 |
| 187 | 3300009545 | Ga0105237_10006979 | Ga0105237_100069792 | 326 |
| 188 | 3300009553 | Ga0105249_10045035 | Ga0105249_100450354 | 326 |
| 189 | 3300010375 | Ga0105239_10031395 | Ga0105239_100313952 | 326 |
| 190 | 3300010375 | Ga0105239_10070587 | Ga0105239_100705875 | 326 |
| 191 | 3300011119 | Ga0105246_10052685 | Ga0105246_100526853 | 326 |
| 192 | 3300011119 | Ga0105246_10327969 | Ga0105246_103279692 | 326 |
| 193 | 3300013100 | Ga0157373_10000089 | Ga0157373_1000008958 | 326 |
| 194 | 3300013100 | Ga0157373_10039389 | Ga0157373_100393891 | 326 |
| 195 | 3300013100 | Ga0157373_10069209 | Ga0157373_100692092 | 326 |
| 196 | 3300013102 | Ga0157371_10010803 | Ga0157371_100108033 | 326 |
| 197 | 3300013102 | Ga0157371_10056955 | Ga0157371_100569552 | 326 |
| 198 | 3300013104 | Ga0157370_10023356 | Ga0157370_100233564 | 326 |
| 199 | 3300013296 | Ga0157374_10000051 | Ga0157374_10000051119 | 326 |
| 200 | 3300013296 | Ga0157374_10000660 | Ga0157374_1000066015 | 326 |
| 201 | 3300013296 | Ga0157374_10006360 | Ga0157374_100063602 | 326 |
| 202 | 3300013296 | Ga0157374_10009338 | Ga0157374_100093385 | 326 |
| 203 | 3300013297 | Ga0157378_10070743 | Ga0157378_100707432 | 326 |
| 204 | 3300013306 | Ga0163162_10000018 | Ga0163162_10000018180 | 326 |
| 205 | 3300013306 | Ga0163162_10002414 | Ga0163162_100024144 | 326 |
| 206 | 3300013306 | Ga0163162_10025890 | Ga0163162_100258903 | 326 |
| 207 | 3300013307 | Ga0157372_10000621 | Ga0157372_1000062123 | 326 |
| 208 | 3300013307 | Ga0157372_10018242 | Ga0157372_100182425 | 326 |
| 209 | 3300013307 | Ga0157372_10018251 | Ga0157372_100182515 | 326 |
| 210 | 3300013307 | Ga0157372_10151463 | Ga0157372_101514634 | 326 |
| 211 | 3300013308 | Ga0157375_10002786 | Ga0157375_1000278610 | 326 |
| 212 | 3300013308 | Ga0157375_10106326 | Ga0157375_101063264 | 326 |
| 213 | 3300013308 | Ga0157375_10426170 | Ga0157375_104261702 | 326 |
| 214 | 3300014325 | Ga0163163_10002002 | Ga0163163_100020024 | 326 |
| 215 | 3300014325 | Ga0163163_10126423 | Ga0163163_101264232 | 326 |
| 216 | 3300014745 | Ga0157377_10043007 | Ga0157377_100430072 | 326 |
| 217 | 3300014745 | Ga0157377_10044107 | Ga0157377_100441073 | 326 |
| 218 | 3300014968 | Ga0157379_10032319 | Ga0157379_100323194 | 326 |
| 219 | 3300014969 | Ga0157376_10063455 | Ga0157376_100634552 | 326 |
| 220 | 3300017792 | Ga0163161_10001922 | Ga0163161_100019223 | 326 |
| 221 | 3300017792 | Ga0163161_10022450 | Ga0163161_100224504 | 326 |
| 222 | 3300021361 | Ga0213872_10013765 | Ga0213872_100137652 | 326 |
| 223 | 3300025250 | Ga0209026_1000903 | Ga0209026_10009036 | 326 |
| 224 | 3300025304 | Ga0209257_1000001 | Ga0209257_1000001584 | 326 |
| 225 | 3300025903 | Ga0207680_10060199 | Ga0207680_100601994 | 326 |
| 226 | 3300025904 | Ga0207647_10000067 | Ga0207647_1000006772 | 326 |
| 227 | 3300025904 | Ga0207647_10024458 | Ga0207647_100244583 | 326 |
| 228 | 3300025907 | Ga0207645_10000046 | Ga0207645_1000004654 | 326 |
| 229 | 3300025907 | Ga0207645_10002079 | Ga0207645_1000207913 | 326 |
| 230 | 3300025909 | Ga0207705_10000088 | Ga0207705_100000886 | 326 |
| 231 | 3300025911 | Ga0207654_10002278 | Ga0207654_100022787 | 326 |
| 232 | 3300025913 | Ga0207695_10005530 | Ga0207695_1000553010 | 326 |
| 233 | 3300025913 | Ga0207695_10015486 | Ga0207695_100154868 | 326 |
| 234 | 3300025914 | Ga0207671_10005853 | Ga0207671_100058532 | 326 |
| 235 | 3300025919 | Ga0207657_10054302 | Ga0207657_100543022 | 326 |
| 236 | 3300025920 | Ga0207649_10007482 | Ga0207649_100074828 | 326 |
| 237 | 3300025923 | Ga0207681_10171034 | Ga0207681_101710342 | 326 |
| 238 | 3300025925 | Ga0207650_10112789 | Ga0207650_101127892 | 326 |
| 239 | 3300025926 | Ga0207659_10013415 | Ga0207659_100134154 | 326 |
| 240 | 3300025931 | Ga0207644_10038320 | Ga0207644_100383204 | 326 |
| 241 | 3300025931 | Ga0207644_10369555 | Ga0207644_103695551 | 326 |
| 242 | 3300025932 | Ga0207690_10004369 | Ga0207690_100043698 | 326 |
| 243 | 3300025933 | Ga0207706_10000123 | Ga0207706_100001239 | 326 |
| 244 | 3300025933 | Ga0207706_10005267 | Ga0207706_1000526713 | 326 |
| 245 | 3300025933 | Ga0207706_10012285 | Ga0207706_100122855 | 326 |
| 246 | 3300025933 | Ga0207706_10019359 | Ga0207706_100193597 | 326 |
| 247 | 3300025933 | Ga0207706_10057267 | Ga0207706_100572674 | 326 |
| 248 | 3300025934 | Ga0207686_10025826 | Ga0207686_100258264 | 326 |
| 249 | 3300025935 | Ga0207709_10024406 | Ga0207709_100244061 | 326 |
| 250 | 3300025936 | Ga0207670_10301655 | Ga0207670_103016551 | 326 |
| 251 | 3300025938 | Ga0207704_10000058 | Ga0207704_1000005837 | 326 |
| 252 | 3300025938 | Ga0207704_10015198 | Ga0207704_100151983 | 326 |
| 253 | 3300025938 | Ga0207704_10083725 | Ga0207704_100837252 | 326 |
| 254 | 3300025940 | Ga0207691_10326762 | Ga0207691_103267621 | 326 |
| 255 | 3300025941 | Ga0207711_10235340 | Ga0207711_102353402 | 326 |
| 256 | 3300025942 | Ga0207689_10001814 | Ga0207689_1000181412 | 326 |
| 257 | 3300025942 | Ga0207689_10001835 | Ga0207689_1000183518 | 326 |
| 258 | 3300025942 | Ga0207689_10008457 | Ga0207689_1000845711 | 326 |
| 259 | 3300025944 | Ga0207661_10119273 | Ga0207661_101192734 | 326 |
| 260 | 3300025945 | Ga0207679_10001053 | Ga0207679_100010538 | 326 |
| 261 | 3300025949 | Ga0207667_10059918 | Ga0207667_100599182 | 326 |
| 262 | 3300025949 | Ga0207667_10535569 | Ga0207667_105355691 | 326 |
| 263 | 3300025960 | Ga0207651_10014198 | Ga0207651_100141982 | 326 |
| 264 | 3300025981 | Ga0207640_10080731 | Ga0207640_100807313 | 326 |
| 265 | 3300025986 | Ga0207658_10063447 | Ga0207658_100634473 | 326 |
| 266 | 3300025986 | Ga0207658_10132702 | Ga0207658_101327022 | 326 |
| 267 | 3300026035 | Ga0207703_10083665 | Ga0207703_100836652 | 326 |
| 268 | 3300026041 | Ga0207639_10017822 | Ga0207639_100178223 | 326 |
| 269 | 3300026041 | Ga0207639_10266404 | Ga0207639_102664041 | 326 |
| 270 | 3300026067 | Ga0207678_10030091 | Ga0207678_100300915 | 326 |
| 271 | 3300026088 | Ga0207641_10357856 | Ga0207641_103578562 | 326 |
| 272 | 3300026089 | Ga0207648_10003611 | Ga0207648_100036113 | 326 |
| 273 | 3300026089 | Ga0207648_10133267 | Ga0207648_101332672 | 326 |
| 274 | 3300026095 | Ga0207676_10002233 | Ga0207676_1000223312 | 326 |
| 275 | 3300026116 | Ga0207674_10004608 | Ga0207674_100046087 | 326 |
| 276 | 3300026121 | Ga0207683_10031011 | Ga0207683_100310113 | 326 |
| 277 | 3300026142 | Ga0207698_10024002 | Ga0207698_100240023 | 326 |
| 278 | 3300026142 | Ga0207698_10322447 | Ga0207698_103224471 | 326 |
| 279 | 3300028379 | Ga0268266_10000111 | Ga0268266_1000011141 | 326 |
| 280 | 3300028379 | Ga0268266_10111680 | Ga0268266_101116804 | 326 |
| 281 | 3300028786 | Ga0307517_10013867 | Ga0307517_100138677 | 326 |
| 282 | 3300033180 | Ga0307510_10002335 | Ga0307510_100023351 | 326 |
| 283 | 3300035724 | Ga0373933_0026277 | Ga0373933_0026277_380_1366 | 326 |
| 284 | 3300037312 | Ga0395899_0002435 | Ga0395899_0002435_13903_14886 | 326 |
| 285 | 3300037418 | Ga0395900_0000141 | Ga0395900_0000141_64440_65423 | 326 |
| 286 | 3300037418 | Ga0395900_0004558 | Ga0395900_0004558_11353_12336 | 326 |
| 287 | 3300037466 | Ga0395898_0016196 | Ga0395898_0016196_305_1288 | 326 |
| 288 | 3300037466 | Ga0395898_0139976 | Ga0395898_0139976_1167_2150 | 326 |
| 289 | 3300037471 | Ga0395905_0000124 | Ga0395905_0000124_70232_71215 | 326 |
| 290 | 3300037471 | Ga0395905_0001156 | Ga0395905_0001156_20690_21673 | 326 |
| 291 | 3300038443 | Ga0395901_0000138 | Ga0395901_0000138_68005_68988 | 326 |
| 292 | 3300038443 | Ga0395901_0001199 | Ga0395901_0001199_6982_7965 | 326 |
| 293 | 3300039447 | Ga0436361_0166876 | Ga0436361_0166876_2644_3627 | 326 |
| 294 | 3300046512 | Ga0495610_0000064 | Ga0495610_0000064_78811_79791 | 326 |
| 295 | 3300046514 | Ga0495618_0205499 | Ga0495618_0205499_181_1167 | 326 |
| 296 | 3300046516 | Ga0495628_0073998 | Ga0495628_0073998_157_1143 | 326 |
| 297 | 3300046517 | Ga0495630_0011490 | Ga0495630_0011490_2836_3822 | 326 |
| 298 | 3300046518 | Ga0495631_0037602 | Ga0495631_0037602_431_1414 | 326 |
| 299 | 3300046520 | Ga0495637_0071355 | Ga0495637_0071355_129_1109 | 326 |
| 300 | 3300047323 | Ga0495683_0011413 | Ga0495683_0011413_1743_2726 | 326 |
| 301 | 3300047443 | Ga0495687_001658 | Ga0495687_001658_17155_18138 | 326 |
| 302 | 3300047472 | Ga0495686_0000298 | Ga0495686_0000298_63353_64333 | 326 |
| 303 | 3300048907 | Ga0496104_0175747 | Ga0496104_0175747_552_1538 | 326 |
| 304 | 3300048908 | Ga0496105_0198964 | Ga0496105_0198964_251_1237 | 326 |
| 305 | 3300048909 | Ga0496106_0135021 | Ga0496106_0135021_847_1833 | 326 |
| 306 | 3300048929 | Ga0496126_0172745 | Ga0496126_0172745_283_1266 | 326 |
| 307 | 3300053130 | Ga0500642_0058694 | Ga0500642_0058694_381_1364 | 326 |
| 308 | 3300053156 | Ga0500622_0000869 | Ga0500622_0000869_13064_14044 | 326 |
| 309 | 3300002067 | JGI24735J21928_10000002 | JGI24735J21928_10000002393 | 327 |
| 310 | 3300002741 | JGI25157J39369_1006040 | JGI25157J39369_10060401 | 327 |
| 311 | 3300002987 | JGI25159J45721_1017468 | JGI25159J45721_10174682 | 327 |
| 312 | 3300003316 | rootH1_10071229 | rootH1_100712293 | 327 |
| 313 | 3300003320 | rootH2_10020406 | rootH2_100204061 | 327 |
| 314 | 3300003320 | rootH2_10062956 | rootH2_100629564 | 327 |
| 315 | 3300003322 | rootL2_10165344 | rootL2_101653442 | 327 |
| 316 | 3300003323 | rootH1_10017652 | rootH1_100176523 | 327 |
| 317 | 3300003323 | rootH1_10092177 | rootH1_100921774 | 327 |
| 318 | 3300003323 | rootH1_10260771 | rootH1_102607711 | 327 |
| 319 | 3300005539 | Ga0068853_100001864 | Ga0068853_1000018642 | 327 |
| 320 | 3300005539 | Ga0068853_100126393 | Ga0068853_1001263933 | 327 |
| 321 | 3300005577 | Ga0068857_100096038 | Ga0068857_1000960381 | 327 |
| 322 | 3300005616 | Ga0068852_100113673 | Ga0068852_1001136732 | 327 |
| 323 | 3300006195 | Ga0075366_10001295 | Ga0075366_100012952 | 327 |
| 324 | 3300009093 | Ga0105240_10000147 | Ga0105240_100001472 | 327 |
| 325 | 3300009545 | Ga0105237_10000052 | Ga0105237_1000005233 | 327 |
| 326 | 3300009551 | Ga0105238_10276334 | Ga0105238_102763342 | 327 |
| 327 | 3300010375 | Ga0105239_10000277 | Ga0105239_1000027715 | 327 |
| 328 | 3300010375 | Ga0105239_10000896 | Ga0105239_1000089615 | 327 |
| 329 | 3300013296 | Ga0157374_10000002 | Ga0157374_1000000229 | 327 |
| 330 | 3300013307 | Ga0157372_10006504 | Ga0157372_100065045 | 327 |
| 331 | 3300014969 | Ga0157376_10010852 | Ga0157376_100108523 | 327 |
| 332 | 3300025208 | Ga0209436_101671 | Ga0209436_1016716 | 327 |
| 333 | 3300025250 | Ga0209026_1004184 | Ga0209026_10041843 | 327 |
| 334 | 3300025284 | Ga0209130_1001704 | Ga0209130_10017042 | 327 |
| 335 | 3300025302 | Ga0207426_1000034 | Ga0207426_100003412 | 327 |
| 336 | 3300025914 | Ga0207671_10070556 | Ga0207671_100705562 | 327 |
| 337 | 3300025924 | Ga0207694_10221379 | Ga0207694_102213792 | 327 |
| 338 | 3300026041 | Ga0207639_10007717 | Ga0207639_100077172 | 327 |
| 339 | 3300030521 | Ga0307511_10000264 | Ga0307511_1000026421 | 327 |
| 340 | 3300031507 | Ga0307509_10060456 | Ga0307509_100604563 | 327 |
| 341 | 3300031507 | Ga0307509_10096439 | Ga0307509_100964393 | 327 |
| 342 | 3300031616 | Ga0307508_10000926 | Ga0307508_1000092628 | 327 |
| 343 | 3300031730 | Ga0307516_10191775 | Ga0307516_101917752 | 327 |
| 344 | 3300033180 | Ga0307510_10002234 | Ga0307510_100022342 | 327 |
| 345 | 3300044658 | Ga0466972_0000010 | Ga0466972_0000010_126432_127418 | 327 |
| 346 | 3300044658 | Ga0466972_0122304 | Ga0466972_0122304_55_1041 | 327 |
| 347 | 3300044706 | Ga0466964_0057289 | Ga0466964_0057289_377_1363 | 327 |
| 348 | 3300044765 | Ga0466970_0170214 | Ga0466970_0170214_94_1080 | 327 |
| 349 | 3300045049 | Ga0466959_0049484 | Ga0466959_0049484_2043_3029 | 327 |
| 350 | 3300046460 | Ga0495638_0081583 | Ga0495638_0081583_573_1559 | 327 |
| 351 | 3300046471 | Ga0495650_0000003 | Ga0495650_0000003_835190_836176 | 327 |
| 352 | 3300046492 | Ga0495585_0000771 | Ga0495585_0000771_25089_26075 | 327 |
| 353 | 3300046501 | Ga0495607_0140002 | Ga0495607_0140002_137_1123 | 327 |
| 354 | 3300046506 | Ga0495583_0030894 | Ga0495583_0030894_1319_2305 | 327 |
| 355 | 3300046507 | Ga0495606_0000116 | Ga0495606_0000116_15015_16001 | 327 |
| 356 | 3300046512 | Ga0495610_0011164 | Ga0495610_0011164_1216_2202 | 327 |
| 357 | 3300046513 | Ga0495616_0010178 | Ga0495616_0010178_176_1162 | 327 |
| 358 | 3300046520 | Ga0495637_0063632 | Ga0495637_0063632_421_1407 | 327 |
| 359 | 3300046538 | Ga0495609_0017858 | Ga0495609_0017858_2168_3154 | 327 |
| 360 | 3300046558 | Ga0495633_0010869 | Ga0495633_0010869_1865_2851 | 327 |
| 361 | 3300046660 | Ga0495625_0000219 | Ga0495625_0000219_70815_71801 | 327 |
| 362 | 3300046660 | Ga0495625_0052379 | Ga0495625_0052379_1238_2227 | 327 |
| 363 | 3300046665 | Ga0495661_0001366 | Ga0495661_0001366_11493_12479 | 327 |
| 364 | 3300046665 | Ga0495661_0023473 | Ga0495661_0023473_115_1101 | 327 |
| 365 | 3300046665 | Ga0495661_0025387 | Ga0495661_0025387_1753_2739 | 327 |
| 366 | 3300046694 | Ga0495649_0000037 | Ga0495649_0000037_70614_71600 | 327 |
| 367 | 3300047443 | Ga0495687_001565 | Ga0495687_001565_3719_4705 | 327 |
| 368 | 3300047472 | Ga0495686_0000004 | Ga0495686_0000004_712061_713047 | 327 |
| 369 | 3300047472 | Ga0495686_0061103 | Ga0495686_0061103_284_1270 | 327 |
| 370 | 3300050493 | nmdc:mga0k408_784_c1 | nmdc:mga0k408_784_c1_4931_5920 | 327 |
| 371 | 3300053125 | Ga0500618_009191 | Ga0500618_009191_887_1873 | 327 |
| 372 | 3300053146 | Ga0500588_0002998 | Ga0500588_0002998_1065_2051 | 327 |
| 373 | 3300053153 | Ga0500616_0006531 | Ga0500616_0006531_2864_3850 | 327 |
| 374 | 3300053156 | Ga0500622_0000915 | Ga0500622_0000915_14634_15623 | 327 |
| 375 | 3300053177 | Ga0500636_0023141 | Ga0500636_0023141_1556_2542 | 327 |
| 376 | 3300003322 | rootL2_10132642 | rootL2_101326423 | 328 |
| 377 | 3300003323 | rootH1_10048169 | rootH1_100481694 | 328 |
| 378 | 3300028653 | Ga0265323_10015106 | Ga0265323_100151062 | 328 |
| 379 | 3300028786 | Ga0307517_10029907 | Ga0307517_100299075 | 328 |
| 380 | 3300031730 | Ga0307516_10000959 | Ga0307516_1000095914 | 328 |
| 381 | 3300046616 | Ga0495668_0000616 | Ga0495668_0000616_24834_25931 | 328 |
| 382 | 3300049680 | Ga0501250_004298 | Ga0501250_004298_285_1274 | 328 |
| 383 | 3300053104 | Ga0500556_0009571 | Ga0500556_0009571_1597_2694 | 328 |
| 384 | 3300053158 | Ga0500627_0002684 | Ga0500627_0002684_3564_4553 | 328 |
| 385 | iso_pu_bacteria | 2821136567 | 2821140266 | 328 |
| 386 | iso_pu_bacteria | 2904467357 | 2904472391 | 328 |
| 387 | iso_pu_bacteria | 2511231000 | 2511231440 | 329 |
| 388 | iso_pu_bacteria | 2513020052 | 2513236445 | 329 |
| 389 | iso_pu_bacteria | 2522125168 | 2522547824 | 329 |
| 390 | iso_pu_bacteria | 2551306352 | 2552748453 | 329 |
| 391 | iso_pu_bacteria | 2582581278 | 2585145480 | 329 |
| 392 | iso_pu_bacteria | 2582581281 | 2585158856 | 329 |
| 393 | iso_pu_bacteria | 2582581282 | 2585163144 | 329 |
| 394 | iso_pu_bacteria | 2585428045 | 2587677670 | 329 |
| 395 | iso_pu_bacteria | 2585428060 | 2587746820 | 329 |
| 396 | iso_pu_bacteria | 2585428115 | 2587943335 | 329 |
| 397 | iso_pu_bacteria | 2585428182 | 2588209587 | 329 |
| 398 | iso_pu_bacteria | 2585428183 | 2588213880 | 329 |
| 399 | iso_pu_bacteria | 2585428184 | 2588218503 | 329 |
| 400 | iso_pu_bacteria | 2585428185 | 2588225812 | 329 |
| 401 | iso_pu_bacteria | 2585428187 | 2588233837 | 329 |
| 402 | iso_pu_bacteria | 2588253712 | 2588444948 | 329 |
| 403 | iso_pu_bacteria | 2588254255 | 2590604478 | 329 |
| 404 | iso_pu_bacteria | 2588254257 | 2590612468 | 329 |
| 405 | iso_pu_bacteria | 2639762793 | 2640736041 | 329 |
| 406 | iso_pu_bacteria | 2643221667 | 2644370726 | 329 |
| 407 | iso_pu_bacteria | 2675903507 | 2678229281 | 329 |
| 408 | iso_pu_bacteria | 2721755487 | 2722729233 | 329 |
| 409 | iso_pu_bacteria | 2728369107 | 2729199195 | 329 |
| 410 | iso_pu_bacteria | 2738541273 | 2738701588 | 329 |
| 411 | iso_pu_bacteria | 2738541279 | 2738732259 | 329 |
| 412 | iso_pu_bacteria | 2738541283 | 2738757263 | 329 |
| 413 | iso_pu_bacteria | 2738541285 | 2738764824 | 329 |
| 414 | iso_pu_bacteria | 2738543007 | 2739213839 | 329 |
| 415 | iso_pu_bacteria | 2738543014 | 2739255886 | 329 |
| 416 | iso_pu_bacteria | 2738543023 | 2739300226 | 329 |
| 417 | iso_pu_bacteria | 2739367857 | 2740001474 | 329 |
| 418 | iso_pu_bacteria | 2739367858 | 2740006290 | 329 |
| 419 | iso_pu_bacteria | 2739367874 | 2740058389 | 329 |
| 420 | iso_pu_bacteria | 2751185877 | 2753671184 | 329 |
| 421 | iso_pu_bacteria | 2765235839 | 2765573295 | 329 |
| 422 | iso_pu_bacteria | 2772190705 | 2772605367 | 329 |
| 423 | iso_pu_bacteria | 2773857761 | 2774390192 | 329 |
| 424 | iso_pu_bacteria | 2773857770 | 2774437960 | 329 |
| 425 | iso_pu_bacteria | 2775506739 | 2775672518 | 329 |
| 426 | iso_pu_bacteria | 2816332188 | 2816873694 | 329 |
| 427 | iso_pu_bacteria | 2842083920 | 2842085089 | 329 |
| 428 | iso_pu_bacteria | 2842722452 | 2842722731 | 329 |
| 429 | iso_pu_bacteria | 2842909656 | 2842913433 | 329 |
| 430 | iso_pu_bacteria | 2849281842 | 2849285710 | 329 |
| 431 | iso_pu_bacteria | 2857618242 | 2857618417 | 329 |
| 432 | iso_pu_bacteria | 2857627736 | 2857628815 | 329 |
| 433 | iso_pu_bacteria | 2871720351 | 2871720746 | 329 |
| 434 | iso_pu_bacteria | 2889290771 | 2889291032 | 329 |
| 435 | iso_pu_bacteria | 2905999023 | 2905999636 | 329 |
| 436 | iso_pu_bacteria | 2919097161 | 2919100664 | 329 |
| 437 | iso_pu_bacteria | 2919182534 | 2919184547 | 329 |
| 438 | iso_pu_bacteria | 2919186247 | 2919188731 | 329 |
| 439 | iso_pu_bacteria | 2919399522 | 2919400480 | 329 |
| 440 | iso_pu_bacteria | 2919692658 | 2919697059 | 329 |
| 441 | iso_pu_bacteria | 2929921140 | 2929925775 | 329 |
| 442 | iso_pu_bacteria | 2945924605 | 2945927939 | 329 |
| 443 | iso_pu_bacteria | 2946019816 | 2946021943 | 329 |
| 444 | iso_pu_bacteria | 2954016120 | 2954016384 | 329 |
| 445 | iso_pu_bacteria | 2977243572 | 2977245713 | 329 |
| 446 | iso_pu_bacteria | 2984572630 | 2984575360 | 329 |
| 447 | iso_pu_bacteria | 2984572630 | 2984575361 | 329 |
| 448 | iso_pu_bacteria | 2984606641 | 2984608812 | 329 |
| 449 | iso_pu_bacteria | 2993372514 | 2993374135 | 329 |
| 450 | iso_pu_bacteria | 2993480792 | 2993481035 | 329 |
| 451 | iso_pu_bacteria | 8003151029 | 8003153248 | 329 |
| 452 | 3300005330 | Ga0070690_100127628 | Ga0070690_1001276281 | 330 |
| 453 | 3300005334 | Ga0068869_100049154 | Ga0068869_1000491543 | 330 |
| 454 | 3300005335 | Ga0070666_10000174 | Ga0070666_1000017415 | 330 |
| 455 | 3300005347 | Ga0070668_100113403 | Ga0070668_1001134032 | 330 |
| 456 | 3300005367 | Ga0070667_100142098 | Ga0070667_1001420982 | 330 |
| 457 | 3300005616 | Ga0068852_100015157 | Ga0068852_1000151572 | 330 |
| 458 | 3300005617 | Ga0068859_100001134 | Ga0068859_10000113413 | 330 |
| 459 | 3300005834 | Ga0068851_10060615 | Ga0068851_100606152 | 330 |
| 460 | 3300005841 | Ga0068863_100025030 | Ga0068863_1000250303 | 330 |
| 461 | 3300005842 | Ga0068858_100006604 | Ga0068858_1000066044 | 330 |
| 462 | 3300005843 | Ga0068860_100024943 | Ga0068860_1000249433 | 330 |
| 463 | 3300006931 | Ga0097620_100001134 | Ga0097620_10000113416 | 330 |
| 464 | 3300009098 | Ga0105245_10041124 | Ga0105245_100411243 | 330 |
| 465 | 3300009101 | Ga0105247_10040956 | Ga0105247_100409563 | 330 |
| 466 | 3300009174 | Ga0105241_10002072 | Ga0105241_100020729 | 330 |
| 467 | 3300009545 | Ga0105237_10008058 | Ga0105237_100080588 | 330 |
| 468 | 3300009553 | Ga0105249_10007645 | Ga0105249_100076453 | 330 |
| 469 | 3300011119 | Ga0105246_10006728 | Ga0105246_100067283 | 330 |
| 470 | 3300013296 | Ga0157374_10234627 | Ga0157374_102346272 | 330 |
| 471 | 3300013306 | Ga0163162_10004463 | Ga0163162_100044638 | 330 |
| 472 | 3300014968 | Ga0157379_10080993 | Ga0157379_100809932 | 330 |
| 473 | 3300014969 | Ga0157376_10084223 | Ga0157376_100842232 | 330 |
| 474 | 3300025903 | Ga0207680_10001491 | Ga0207680_100014918 | 330 |
| 475 | 3300025914 | Ga0207671_10009391 | Ga0207671_100093913 | 330 |
| 476 | 3300025931 | Ga0207644_10022476 | Ga0207644_100224762 | 330 |
| 477 | 3300025942 | Ga0207689_10037062 | Ga0207689_100370622 | 330 |
| 478 | 3300025961 | Ga0207712_10018768 | Ga0207712_100187683 | 330 |
| 479 | 3300025972 | Ga0207668_10260329 | Ga0207668_102603292 | 330 |
| 480 | 3300025986 | Ga0207658_10016984 | Ga0207658_100169843 | 330 |
| 481 | 3300026088 | Ga0207641_10001176 | Ga0207641_1000117613 | 330 |
| 482 | 3300028381 | Ga0268264_10005699 | Ga0268264_100056992 | 330 |
| 483 | 3300044658 | Ga0466972_0000027 | Ga0466972_0000027_132298_133293 | 331 |
| 484 | 3300044765 | Ga0466970_0000405 | Ga0466970_0000405_866_1861 | 331 |
| 485 | 3300003203 | JGI25406J46586_10040573 | JGI25406J46586_100405731 | 332 |
| 486 | 3300003316 | rootH1_10084445 | rootH1_100844452 | 332 |
| 487 | 3300003323 | rootH1_10081119 | rootH1_100811192 | 332 |
| 488 | 3300005327 | Ga0070658_10225671 | Ga0070658_102256712 | 332 |
| 489 | 3300005336 | Ga0070680_100022362 | Ga0070680_1000223623 | 332 |
| 490 | 3300005458 | Ga0070681_10015115 | Ga0070681_100151152 | 332 |
| 491 | 3300005458 | Ga0070681_10273117 | Ga0070681_102731172 | 332 |
| 492 | 3300005530 | Ga0070679_100064512 | Ga0070679_1000645122 | 332 |
| 493 | 3300005539 | Ga0068853_100183632 | Ga0068853_1001836321 | 332 |
| 494 | 3300005548 | Ga0070665_100000006 | Ga0070665_100000006287 | 332 |
| 495 | 3300005563 | Ga0068855_100130904 | Ga0068855_1001309043 | 332 |
| 496 | 3300005563 | Ga0068855_100594950 | Ga0068855_1005949501 | 332 |
| 497 | 3300005614 | Ga0068856_100133388 | Ga0068856_1001333881 | 332 |
| 498 | 3300005616 | Ga0068852_100325910 | Ga0068852_1003259102 | 332 |
| 499 | 3300005719 | Ga0068861_100319800 | Ga0068861_1003198001 | 332 |
| 500 | 3300005843 | Ga0068860_100016689 | Ga0068860_1000166893 | 332 |
| 501 | 3300005985 | Ga0081539_10000147 | Ga0081539_1000014735 | 332 |
| 502 | 3300009174 | Ga0105241_10004327 | Ga0105241_100043274 | 332 |
| 503 | 3300009176 | Ga0105242_10101430 | Ga0105242_101014302 | 332 |
| 504 | 3300010375 | Ga0105239_10031149 | Ga0105239_100311495 | 332 |
| 505 | 3300013100 | Ga0157373_10008339 | Ga0157373_100083396 | 332 |
| 506 | 3300013102 | Ga0157371_10023778 | Ga0157371_100237782 | 332 |
| 507 | 3300013105 | Ga0157369_10000033 | Ga0157369_100000331 | 332 |
| 508 | 3300013105 | Ga0157369_10079919 | Ga0157369_100799193 | 332 |
| 509 | 3300014326 | Ga0157380_10000947 | Ga0157380_1000094716 | 332 |
| 510 | 3300015265 | Ga0182005_1000023 | Ga0182005_1000023211 | 332 |
| 511 | 3300025302 | Ga0207426_1000052 | Ga0207426_100005285 | 332 |
| 512 | 3300025302 | Ga0207426_1007449 | Ga0207426_10074493 | 332 |
| 513 | 3300025912 | Ga0207707_10068888 | Ga0207707_100688882 | 332 |
| 514 | 3300025912 | Ga0207707_10229243 | Ga0207707_102292431 | 332 |
| 515 | 3300025921 | Ga0207652_10004883 | Ga0207652_100048835 | 332 |
| 516 | 3300025949 | Ga0207667_10534462 | Ga0207667_105344621 | 332 |
| 517 | 3300026142 | Ga0207698_10039738 | Ga0207698_100397384 | 332 |
| 518 | 3300028379 | Ga0268266_10000010 | Ga0268266_10000010368 | 332 |
| 519 | 3300028381 | Ga0268264_10011858 | Ga0268264_100118588 | 332 |
| 520 | 3300049574 | Ga0501038_0032093 | Ga0501038_0032093_870_1874 | 332 |
| 521 | 3300049822 | Ga0501035_0266402 | Ga0501035_0266402_89_1093 | 332 |
| 522 | 3300049823 | Ga0501044_0080712 | Ga0501044_0080712_81_1085 | 332 |
| 523 | 3300049823 | Ga0501044_0324314 | Ga0501044_0324314_435_1433 | 332 |
| 524 | iso_pu_bacteria | 2818991442 | 2819572366 | 332 |
| 525 | 2162886007 | SwRhRL2b_contig_301064 | SwRhRL2b_0634.00006890 | 333 |
| 526 | 3300001979 | JGI24740J21852_10003561 | JGI24740J21852_100035612 | 333 |
| 527 | 3300002738 | JGI25154J39366_1000025 | JGI25154J39366_100002567 | 333 |
| 528 | 3300003215 | JGI25153J46596_10003683 | JGI25153J46596_1000368312 | 333 |
| 529 | 3300003320 | rootH2_10050819 | rootH2_100508192 | 333 |
| 530 | 3300003320 | rootH2_10054169 | rootH2_1005416915 | 333 |
| 531 | 3300003320 | rootH2_10245769 | rootH2_102457692 | 333 |
| 532 | 3300003322 | rootL2_10009807 | rootL2_100098074 | 333 |
| 533 | 3300003323 | rootH1_10006845 | rootH1_100068454 | 333 |
| 534 | 3300003323 | rootH1_10017957 | rootH1_100179576 | 333 |
| 535 | 3300003354 | JGI25160J50197_1004797 | JGI25160J50197_10047973 | 333 |
| 536 | 3300003761 | Ga0055535_1001728 | Ga0055535_10017286 | 333 |
| 537 | 3300003856 | Ga0058692_1000007 | Ga0058692_1000007145 | 333 |
| 538 | 3300005272 | Ga0065703_1000113 | Ga0065703_100011367 | 333 |
| 539 | 3300005288 | Ga0065714_10002864 | Ga0065714_1000286425 | 333 |
| 540 | 3300005288 | Ga0065714_10002993 | Ga0065714_100029932 | 333 |
| 541 | 3300005288 | Ga0065714_10078522 | Ga0065714_100785223 | 333 |
| 542 | 3300005288 | Ga0065714_10083886 | Ga0065714_100838861 | 333 |
| 543 | 3300005288 | Ga0065714_10084831 | Ga0065714_100848312 | 333 |
| 544 | 3300005288 | Ga0065714_10136971 | Ga0065714_101369711 | 333 |
| 545 | 3300005289 | Ga0065704_10000229 | Ga0065704_1000022926 | 333 |
| 546 | 3300005289 | Ga0065704_10004724 | Ga0065704_100047242 | 333 |
| 547 | 3300005289 | Ga0065704_10015826 | Ga0065704_100158262 | 333 |
| 548 | 3300005289 | Ga0065704_10087427 | Ga0065704_100874272 | 333 |
| 549 | 3300005289 | Ga0065704_10169842 | Ga0065704_101698421 | 333 |
| 550 | 3300005327 | Ga0070658_10228455 | Ga0070658_102284552 | 333 |
| 551 | 3300005329 | Ga0070683_100020914 | Ga0070683_1000209144 | 333 |
| 552 | 3300005336 | Ga0070680_100082320 | Ga0070680_1000823202 | 333 |
| 553 | 3300005337 | Ga0070682_100000605 | Ga0070682_10000060514 | 333 |
| 554 | 3300005353 | Ga0070669_100006597 | Ga0070669_1000065977 | 333 |
| 555 | 3300005455 | Ga0070663_100092934 | Ga0070663_1000929343 | 333 |
| 556 | 3300005471 | Ga0070698_100065707 | Ga0070698_1000657073 | 333 |
| 557 | 3300005535 | Ga0070684_100040721 | Ga0070684_1000407212 | 333 |
| 558 | 3300005539 | Ga0068853_100256855 | Ga0068853_1002568552 | 333 |
| 559 | 3300005548 | Ga0070665_100001787 | Ga0070665_10000178725 | 333 |
| 560 | 3300005577 | Ga0068857_100009540 | Ga0068857_10000954010 | 333 |
| 561 | 3300005614 | Ga0068856_100016408 | Ga0068856_1000164087 | 333 |
| 562 | 3300005843 | Ga0068860_100000005 | Ga0068860_100000005227 | 333 |
| 563 | 3300005843 | Ga0068860_100120760 | Ga0068860_1001207603 | 333 |
| 564 | 3300006195 | Ga0075366_10022084 | Ga0075366_100220841 | 333 |
| 565 | 3300006195 | Ga0075366_10081002 | Ga0075366_100810022 | 333 |
| 566 | 3300006931 | Ga0097620_100411609 | Ga0097620_1004116092 | 333 |
| 567 | 3300009036 | Ga0105244_10000007 | Ga0105244_10000007205 | 333 |
| 568 | 3300009036 | Ga0105244_10000050 | Ga0105244_1000005057 | 333 |
| 569 | 3300009036 | Ga0105244_10001222 | Ga0105244_100012221 | 333 |
| 570 | 3300009036 | Ga0105244_10104398 | Ga0105244_101043982 | 333 |
| 571 | 3300009092 | Ga0105250_10012506 | Ga0105250_100125062 | 333 |
| 572 | 3300009092 | Ga0105250_10013417 | Ga0105250_100134173 | 333 |
| 573 | 3300009093 | Ga0105240_10001071 | Ga0105240_1000107114 | 333 |
| 574 | 3300009093 | Ga0105240_10003601 | Ga0105240_1000360115 | 333 |
| 575 | 3300009101 | Ga0105247_10000560 | Ga0105247_1000056017 | 333 |
| 576 | 3300009101 | Ga0105247_10018189 | Ga0105247_100181893 | 333 |
| 577 | 3300009147 | Ga0114129_10016698 | Ga0114129_100166985 | 333 |
| 578 | 3300009148 | Ga0105243_10000012 | Ga0105243_10000012110 | 333 |
| 579 | 3300009148 | Ga0105243_10000052 | Ga0105243_1000005233 | 333 |
| 580 | 3300009148 | Ga0105243_10003425 | Ga0105243_100034253 | 333 |
| 581 | 3300009148 | Ga0105243_10149190 | Ga0105243_101491901 | 333 |
| 582 | 3300009174 | Ga0105241_10000646 | Ga0105241_100006468 | 333 |
| 583 | 3300009545 | Ga0105237_10019455 | Ga0105237_100194556 | 333 |
| 584 | 3300009553 | Ga0105249_10146373 | Ga0105249_101463732 | 333 |
| 585 | 3300010375 | Ga0105239_10003342 | Ga0105239_100033427 | 333 |
| 586 | 3300013100 | Ga0157373_10000261 | Ga0157373_1000026124 | 333 |
| 587 | 3300013102 | Ga0157371_10000009 | Ga0157371_1000000992 | 333 |
| 588 | 3300013102 | Ga0157371_10001830 | Ga0157371_1000183016 | 333 |
| 589 | 3300013102 | Ga0157371_10016929 | Ga0157371_100169292 | 333 |
| 590 | 3300013104 | Ga0157370_10007408 | Ga0157370_100074087 | 333 |
| 591 | 3300013104 | Ga0157370_10052976 | Ga0157370_100529764 | 333 |
| 592 | 3300013105 | Ga0157369_10018848 | Ga0157369_100188484 | 333 |
| 593 | 3300013306 | Ga0163162_10000854 | Ga0163162_1000085417 | 333 |
| 594 | 3300013307 | Ga0157372_10066801 | Ga0157372_100668013 | 333 |
| 595 | 3300013308 | Ga0157375_10000222 | Ga0157375_1000022219 | 333 |
| 596 | 3300014326 | Ga0157380_10003364 | Ga0157380_1000336410 | 333 |
| 597 | 3300014326 | Ga0157380_10494883 | Ga0157380_104948831 | 333 |
| 598 | 3300014497 | Ga0182008_10000237 | Ga0182008_100002377 | 333 |
| 599 | 3300015261 | Ga0182006_1000012 | Ga0182006_100001295 | 333 |
| 600 | 3300015261 | Ga0182006_1001110 | Ga0182006_100111014 | 333 |
| 601 | 3300015262 | Ga0182007_10000015 | Ga0182007_10000015148 | 333 |
| 602 | 3300015682 | Ga0183373_1013 | Ga0183373_101317 | 333 |
| 603 | 3300017792 | Ga0163161_10000012 | Ga0163161_10000012249 | 333 |
| 604 | 3300017792 | Ga0163161_10000178 | Ga0163161_1000017813 | 333 |
| 605 | 3300017792 | Ga0163161_10001618 | Ga0163161_100016182 | 333 |
| 606 | 3300025242 | Ga0209258_100161 | Ga0209258_100161123 | 333 |
| 607 | 3300025246 | Ga0209646_1000037 | Ga0209646_100003768 | 333 |
| 608 | 3300025250 | Ga0209026_1000819 | Ga0209026_10008193 | 333 |
| 609 | 3300025254 | Ga0209148_1000161 | Ga0209148_100016192 | 333 |
| 610 | 3300025292 | Ga0209676_1000558 | Ga0209676_100055839 | 333 |
| 611 | 3300025302 | Ga0207426_1000959 | Ga0207426_100095923 | 333 |
| 612 | 3300025711 | Ga0207696_1001450 | Ga0207696_100145014 | 333 |
| 613 | 3300025711 | Ga0207696_1001460 | Ga0207696_100146012 | 333 |
| 614 | 3300025711 | Ga0207696_1003489 | Ga0207696_10034893 | 333 |
| 615 | 3300025728 | Ga0207655_1000066 | Ga0207655_100006661 | 333 |
| 616 | 3300025728 | Ga0207655_1000423 | Ga0207655_100042331 | 333 |
| 617 | 3300025728 | Ga0207655_1000480 | Ga0207655_100048037 | 333 |
| 618 | 3300025728 | Ga0207655_1000941 | Ga0207655_100094132 | 333 |
| 619 | 3300025735 | Ga0207713_1002097 | Ga0207713_10020976 | 333 |
| 620 | 3300025735 | Ga0207713_1002622 | Ga0207713_100262216 | 333 |
| 621 | 3300025735 | Ga0207713_1004893 | Ga0207713_100489311 | 333 |
| 622 | 3300025900 | Ga0207710_10000018 | Ga0207710_10000018122 | 333 |
| 623 | 3300025913 | Ga0207695_10013245 | Ga0207695_100132457 | 333 |
| 624 | 3300025914 | Ga0207671_10011734 | Ga0207671_100117346 | 333 |
| 625 | 3300025919 | Ga0207657_10096489 | Ga0207657_100964892 | 333 |
| 626 | 3300025921 | Ga0207652_10157306 | Ga0207652_101573062 | 333 |
| 627 | 3300025923 | Ga0207681_10023476 | Ga0207681_100234763 | 333 |
| 628 | 3300025935 | Ga0207709_10000006 | Ga0207709_10000006633 | 333 |
| 629 | 3300025935 | Ga0207709_10000016 | Ga0207709_10000016268 | 333 |
| 630 | 3300025935 | Ga0207709_10002381 | Ga0207709_100023813 | 333 |
| 631 | 3300025944 | Ga0207661_10004101 | Ga0207661_100041016 | 333 |
| 632 | 3300025944 | Ga0207661_10004101 | Ga0207661_100041017 | 333 |
| 633 | 3300025961 | Ga0207712_10088846 | Ga0207712_100888461 | 333 |
| 634 | 3300026041 | Ga0207639_10118270 | Ga0207639_101182702 | 333 |
| 635 | 3300026067 | Ga0207678_10250732 | Ga0207678_102507321 | 333 |
| 636 | 3300026078 | Ga0207702_10067209 | Ga0207702_100672092 | 333 |
| 637 | 3300026078 | Ga0207702_10095754 | Ga0207702_100957544 | 333 |
| 638 | 3300026089 | Ga0207648_10028421 | Ga0207648_100284212 | 333 |
| 639 | 3300026116 | Ga0207674_10058405 | Ga0207674_100584055 | 333 |
| 640 | 3300026116 | Ga0207674_10069769 | Ga0207674_100697693 | 333 |
| 641 | 3300026116 | Ga0207674_10110220 | Ga0207674_101102202 | 333 |
| 642 | 3300026121 | Ga0207683_10269286 | Ga0207683_102692861 | 333 |
| 643 | 3300027312 | Ga0209371_1000024 | Ga0209371_1000024210 | 333 |
| 644 | 3300028379 | Ga0268266_10001914 | Ga0268266_100019148 | 333 |
| 645 | 3300028380 | Ga0268265_10406664 | Ga0268265_104066641 | 333 |
| 646 | 3300028381 | Ga0268264_10000012 | Ga0268264_10000012209 | 333 |
| 647 | 3300028381 | Ga0268264_10045884 | Ga0268264_100458841 | 333 |
| 648 | 3300030500 | Ga0268256_1000026 | Ga0268256_1000026210 | 333 |
| 649 | 3300030732 | Ga0316176_1221375 | Ga0316176_12213752 | 333 |
| 650 | 3300030742 | Ga0316183_1025751 | Ga0316183_102575116 | 333 |
| 651 | 3300030744 | Ga0316181_1238304 | Ga0316181_12383042 | 333 |
| 652 | 3300031507 | Ga0307509_10208674 | Ga0307509_102086742 | 333 |
| 653 | 3300031731 | Ga0307405_10000038 | Ga0307405_1000003821 | 333 |
| 654 | 3300031824 | Ga0307413_10000190 | Ga0307413_100001908 | 333 |
| 655 | 3300031903 | Ga0307407_10000005 | Ga0307407_10000005121 | 333 |
| 656 | 3300031911 | Ga0307412_10000007 | Ga0307412_10000007324 | 333 |
| 657 | 3300031911 | Ga0307412_10000045 | Ga0307412_10000045127 | 333 |
| 658 | 3300031911 | Ga0307412_10000175 | Ga0307412_1000017536 | 333 |
| 659 | 3300031995 | Ga0307409_100014401 | Ga0307409_1000144012 | 333 |
| 660 | 3300032002 | Ga0307416_100000001 | Ga0307416_10000000162 | 333 |
| 661 | 3300032002 | Ga0307416_100000003 | Ga0307416_100000003229 | 333 |
| 662 | 3300032004 | Ga0307414_10000722 | Ga0307414_100007225 | 333 |
| 663 | 3300032004 | Ga0307414_10001496 | Ga0307414_1000149610 | 333 |
| 664 | 3300032004 | Ga0307414_10003547 | Ga0307414_100035478 | 333 |
| 665 | 3300032004 | Ga0307414_10011808 | Ga0307414_100118082 | 333 |
| 666 | 3300032004 | Ga0307414_10081914 | Ga0307414_100819143 | 333 |
| 667 | 3300032004 | Ga0307414_10208661 | Ga0307414_102086612 | 333 |
| 668 | 3300032005 | Ga0307411_10000007 | Ga0307411_10000007141 | 333 |
| 669 | 3300041404 | Ga0439436_0002217 | Ga0439436_0002217_534_1580 | 333 |
| 670 | 3300041404 | Ga0439436_0016924 | Ga0439436_0016924_735_1736 | 333 |
| 671 | 3300041411 | Ga0439466_0002102 | Ga0439466_0002102_2397_3398 | 333 |
| 672 | 3300041413 | Ga0439465_0001390 | Ga0439465_0001390_2742_3743 | 333 |
| 673 | 3300041459 | Ga0451800_0887562 | Ga0451800_0887562_449_1456 | 333 |
| 674 | 3300042002 | Ga0439442_008724 | Ga0439442_008724_767_1774 | 333 |
| 675 | 3300042004 | Ga0439445_0001732 | Ga0439445_0001732_1831_2832 | 333 |
| 676 | 3300042131 | Ga0450894_004765 | Ga0450894_004765_697_1704 | 333 |
| 677 | 3300044656 | Ga0466969_0000207 | Ga0466969_0000207_6538_7545 | 333 |
| 678 | 3300044658 | Ga0466972_0000009 | Ga0466972_0000009_95001_96011 | 333 |
| 679 | 3300044658 | Ga0466972_0010416 | Ga0466972_0010416_1354_2355 | 333 |
| 680 | 3300044658 | Ga0466972_0010519 | Ga0466972_0010519_2896_3903 | 333 |
| 681 | 3300044684 | Ga0466966_0132959 | Ga0466966_0132959_167_1174 | 333 |
| 682 | 3300044735 | Ga0466968_0015936 | Ga0466968_0015936_445_1452 | 333 |
| 683 | 3300044735 | Ga0466968_0062379 | Ga0466968_0062379_345_1346 | 333 |
| 684 | 3300045049 | Ga0466959_0000236 | Ga0466959_0000236_17609_18616 | 333 |
| 685 | 3300046453 | Ga0495627_000002 | Ga0495627_000002_238439_239440 | 333 |
| 686 | 3300046453 | Ga0495627_022153 | Ga0495627_022153_391_1392 | 333 |
| 687 | 3300046460 | Ga0495638_0046148 | Ga0495638_0046148_141_1142 | 333 |
| 688 | 3300046500 | Ga0495596_0003434 | Ga0495596_0003434_647_1648 | 333 |
| 689 | 3300046507 | Ga0495606_0020040 | Ga0495606_0020040_2127_3128 | 333 |
| 690 | 3300046512 | Ga0495610_0000009 | Ga0495610_0000009_122688_123719 | 333 |
| 691 | 3300046519 | Ga0495632_0001668 | Ga0495632_0001668_16626_17627 | 333 |
| 692 | 3300046519 | Ga0495632_0005176 | Ga0495632_0005176_2521_3522 | 333 |
| 693 | 3300046524 | Ga0495648_0009686 | Ga0495648_0009686_3161_4162 | 333 |
| 694 | 3300046525 | Ga0495663_0000315 | Ga0495663_0000315_537_1538 | 333 |
| 695 | 3300046530 | Ga0495654_0000001 | Ga0495654_0000001_1273431_1274432 | 333 |
| 696 | 3300046558 | Ga0495633_0000002 | Ga0495633_0000002_221186_222187 | 333 |
| 697 | 3300046558 | Ga0495633_0000894 | Ga0495633_0000894_7314_8315 | 333 |
| 698 | 3300046558 | Ga0495633_0091543 | Ga0495633_0091543_273_1274 | 333 |
| 699 | 3300046660 | Ga0495625_0000899 | Ga0495625_0000899_6680_7681 | 333 |
| 700 | 3300046660 | Ga0495625_0072031 | Ga0495625_0072031_805_1890 | 333 |
| 701 | 3300047443 | Ga0495687_000009 | Ga0495687_000009_138597_139703 | 333 |
| 702 | 3300047472 | Ga0495686_0000095 | Ga0495686_0000095_125921_126922 | 333 |
| 703 | 3300047472 | Ga0495686_0009867 | Ga0495686_0009867_1420_2421 | 333 |
| 704 | 3300048905 | Ga0496102_0083518 | Ga0496102_0083518_1260_2261 | 333 |
| 705 | 3300048906 | Ga0496103_0021329 | Ga0496103_0021329_712_1713 | 333 |
| 706 | 3300048919 | Ga0496116_0000022 | Ga0496116_0000022_48998_49999 | 333 |
| 707 | 3300048919 | Ga0496116_0009389 | Ga0496116_0009389_4135_5169 | 333 |
| 708 | 3300048920 | Ga0496117_0000074 | Ga0496117_0000074_52329_53330 | 333 |
| 709 | 3300048920 | Ga0496117_0001473 | Ga0496117_0001473_13608_14642 | 333 |
| 710 | 3300048921 | Ga0496118_0001613 | Ga0496118_0001613_2027_3028 | 333 |
| 711 | 3300048921 | Ga0496118_0046262 | Ga0496118_0046262_1236_2270 | 333 |
| 712 | 3300048922 | Ga0496119_0000017 | Ga0496119_0000017_179320_180321 | 333 |
| 713 | 3300048924 | Ga0496121_0063112 | Ga0496121_0063112_253_1254 | 333 |
| 714 | 3300048925 | Ga0496122_0000159 | Ga0496122_0000159_18019_19020 | 333 |
| 715 | 3300048925 | Ga0496122_0000354 | Ga0496122_0000354_66395_67396 | 333 |
| 716 | 3300048925 | Ga0496122_0000357 | Ga0496122_0000357_54382_55383 | 333 |
| 717 | 3300048925 | Ga0496122_0000591 | Ga0496122_0000591_30111_31112 | 333 |
| 718 | 3300048925 | Ga0496122_0002282 | Ga0496122_0002282_21552_22553 | 333 |
| 719 | 3300048925 | Ga0496122_0002637 | Ga0496122_0002637_2527_3561 | 333 |
| 720 | 3300048925 | Ga0496122_0005231 | Ga0496122_0005231_10608_11609 | 333 |
| 721 | 3300048926 | Ga0496123_0001157 | Ga0496123_0001157_5250_6251 | 333 |
| 722 | 3300048926 | Ga0496123_0002468 | Ga0496123_0002468_17335_18369 | 333 |
| 723 | 3300048926 | Ga0496123_0003951 | Ga0496123_0003951_14359_15360 | 333 |
| 724 | 3300048926 | Ga0496123_0010609 | Ga0496123_0010609_154_1155 | 333 |
| 725 | 3300048926 | Ga0496123_0047728 | Ga0496123_0047728_730_1731 | 333 |
| 726 | 3300048927 | Ga0496124_0015613 | Ga0496124_0015613_2266_3267 | 333 |
| 727 | 3300048928 | Ga0496125_0001036 | Ga0496125_0001036_8094_9095 | 333 |
| 728 | 3300048928 | Ga0496125_0001152 | Ga0496125_0001152_2244_3245 | 333 |
| 729 | 3300048928 | Ga0496125_0003480 | Ga0496125_0003480_15875_16876 | 333 |
| 730 | 3300048928 | Ga0496125_0011088 | Ga0496125_0011088_5556_6557 | 333 |
| 731 | 3300048928 | Ga0496125_0011573 | Ga0496125_0011573_4183_5184 | 333 |
| 732 | 3300048928 | Ga0496125_0067715 | Ga0496125_0067715_76_1110 | 333 |
| 733 | 3300048928 | Ga0496125_0160243 | Ga0496125_0160243_442_1443 | 333 |
| 734 | 3300048929 | Ga0496126_0001468 | Ga0496126_0001468_32403_33404 | 333 |
| 735 | 3300049571 | Ga0501034_0082568 | Ga0501034_0082568_1303_2307 | 333 |
| 736 | 3300049571 | Ga0501034_0188035 | Ga0501034_0188035_895_1899 | 333 |
| 737 | 3300049581 | Ga0501047_0228685 | Ga0501047_0228685_549_1559 | 333 |
| 738 | 3300049679 | Ga0501249_000001 | Ga0501249_000001_179592_180593 | 333 |
| 739 | 3300049679 | Ga0501249_001838 | Ga0501249_001838_1465_2466 | 333 |
| 740 | 3300049758 | Ga0501241_000254 | Ga0501241_000254_4313_5314 | 333 |
| 741 | 3300049763 | Ga0501266_000010 | Ga0501266_000010_100410_101411 | 333 |
| 742 | 3300049766 | Ga0501269_000185 | Ga0501269_000185_13153_14154 | 333 |
| 743 | 3300050493 | nmdc:mga0k408_25502_c1 | nmdc:mga0k408_25502_c1_780_1787 | 333 |
| 744 | 3300050507 | nmdc:mga05p37_11042_c1 | nmdc:mga05p37_11042_c1_2665_3672 | 333 |
| 745 | 3300053086 | Ga0500578_0000386 | Ga0500578_0000386_22072_23082 | 333 |
| 746 | 3300053092 | Ga0500583_0000035 | Ga0500583_0000035_6804_7811 | 333 |
| 747 | 3300053092 | Ga0500583_0016285 | Ga0500583_0016285_1546_2547 | 333 |
| 748 | 3300053096 | Ga0500641_0017392 | Ga0500641_0017392_379_1380 | 333 |
| 749 | 3300053104 | Ga0500556_0055830 | Ga0500556_0055830_419_1420 | 333 |
| 750 | 3300053131 | Ga0500652_042276 | Ga0500652_042276_513_1520 | 333 |
| 751 | 3300053134 | Ga0500658_0000019 | Ga0500658_0000019_130728_131729 | 333 |
| 752 | 3300053156 | Ga0500622_0002688 | Ga0500622_0002688_7014_8015 | 333 |
| 753 | 3300053156 | Ga0500622_0038362 | Ga0500622_0038362_18_1025 | 333 |
| 754 | 3300053727 | Ga0500611_011417 | Ga0500611_011417_304_1311 | 333 |
| 755 | iso_pu_bacteria | 2842903701 | 2842907099 | 333 |
| 756 | iso_pu_bacteria | 2939664404 | 2939667114 | 333 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3v0u-assembly1.cif.gz_A | crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding | 0.9338 | 1 | 312 |
| 8hnq-assembly1.cif.gz_A | the structure of a alcohol dehydrogenase akr13b2 with nadp | 0.9047 | 3 | 309 |
| 1pz0-assembly1.cif.gz_A | structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) | 0.9028 | 2 | 312 |
| 3v0u-assembly1.cif.gz_A | crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding | 0.9018 | 1 | 312 |
| 3v0t-assembly1.cif.gz_A | crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding | 0.8987 | 1 | 321 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F4HPY8_8_325_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9439 | 1 | 325 | 3.20.20.100 |
| 3v0uA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9338 | 1 | 312 | 3.20.20.100 |
| af_A0A1D6KUU8_358_629_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9282 | 73 | 331 | 3.20.20.100 |
| af_P49249_9_269_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9162 | 3 | 254 | 3.20.20.100 |
| af_Q09923_6_337_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9146 | 4 | 333 | 3.20.20.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A317LPZ2-F1-model_v4 | Aryl-alcohol dehydrogenase-like predicted oxidoreductase | 0.9754 | 1 | 333 |
GO:0004033
GO:0005737 |
| AF-A0A1J5PSL3-F1-model_v4 | General stress protein 69 (EC 1.1.1.-) | 0.9704 | 142 | 333 |
GO:0004033
GO:0005737 |
| AF-A0A317LPZ2-F1-model_v4 | Aryl-alcohol dehydrogenase-like predicted oxidoreductase | 0.9695 | 1 | 333 |
GO:0004033
GO:0005737 |
| AF-Q0JE28-F1-model_v4 | Os04g0338100 protein | 0.968 | 110 | 194 |
|
| AF-A0A429MRA5-F1-model_v4 | Aldo/keto reductase | 0.9653 | 74 | 333 |
GO:0004033
GO:0005737 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar