F479347

General Info

Members Datasets Scaffolds Average Seq Length
756 386 675 330

Family's Representative Sequence

Representative Sequence 3300030732|Ga0316176_1221375|Ga0316176_12213752
Length 376
Sequence LIIIDKQKDFYRNFDKKSGRWTQHDYCNHQRLHLALEKQNIKQMKYRNLSNATEQLSAIGLGCMGMSFAYGPTDDVESIATLNKALDLGINFWDTADMYGNGLNEELISKVLVPNRDKVFIATKFGFRFKDGIAGPSNASGTYFDGSPAWIKVAVENSLRRLKIDTIDLYYAHRVDPNIPIEETVGAMAELVKEGKVRYLGLSEASANSLKRAHAVHPIAALQSEYSLLTRDIEAEILGTARSLNVTLVPYSPLARGLVTNALDVTSLAETDFRRTLPRYSGENLANNQSLAMEFAAIAAEKNATPAQLALAWVLAQGEDIIPIPGTKKRKYLEENAKAVDLNLSKSDLEAIQKLTEKYPNTGERYSEGALKLVNN

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
4 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
5 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
6 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
7 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
8 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
9 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
10 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
11 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
12 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
13 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
14 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
15 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
16 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
17 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
18 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
19 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
20 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
21 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
22 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
23 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
24 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
25 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
26 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
27 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
28 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
29 2738541283 Pedobacter sp. OK701 Isolate Unclassified
30 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
31 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
32 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
33 2738543023 Pedobacter sp. OK628 Isolate Unclassified
34 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
35 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
36 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
37 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
38 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
39 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
40 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
41 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
42 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
43 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
44 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
45 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
46 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
47 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
48 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
49 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
50 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
51 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
52 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
53 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
54 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
55 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
56 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
57 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
58 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
59 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
60 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
61 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
62 2914759650 Rhizosphaericola mali Isolate Rhizosphere
63 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
64 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
65 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
66 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
67 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
68 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
69 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
70 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
71 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
72 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
73 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
74 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
75 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
76 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
77 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
78 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
79 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
80 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
81 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
82 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
83 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
84 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
85 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
86 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
87 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
88 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
90 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
91 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
92 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
93 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
94 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
95 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
96 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
97 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
98 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
99 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
100 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
101 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
102 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
103 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
104 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
105 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
106 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
107 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
108 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
109 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
110 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
111 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
112 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
113 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
114 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
115 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
116 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
117 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
118 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
119 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
120 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
121 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
122 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
123 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
124 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
125 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
126 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
127 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
128 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
129 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
130 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
131 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
132 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
133 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
134 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
135 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
136 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
137 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
138 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
139 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
140 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
141 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
142 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
143 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
144 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
145 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
146 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
147 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
148 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
149 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
150 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
151 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
152 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
153 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
154 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
155 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
156 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
157 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
158 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
159 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
160 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
161 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
162 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
163 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
164 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
165 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
166 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
167 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
168 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
169 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
170 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
171 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
172 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
173 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
174 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
175 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
176 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
177 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
178 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
179 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
180 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
181 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
182 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
183 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
184 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
185 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
186 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
187 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
188 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
189 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
190 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
191 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
192 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
193 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
194 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
195 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
196 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
197 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
199 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
200 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
202 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
205 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
259 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
260 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
261 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
262 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
263 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
264 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
265 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
266 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
267 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
268 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
269 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
270 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
271 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
272 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
273 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
274 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
275 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
276 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
277 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
278 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
279 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
280 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
281 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
282 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
283 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
284 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
285 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
286 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
287 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
288 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
289 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
290 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
291 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
292 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
293 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
294 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
295 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
296 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
297 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
298 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
299 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
300 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
301 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
302 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
303 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
304 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
305 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
306 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
307 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
308 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
309 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
310 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
311 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
312 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
313 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
314 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
315 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
316 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
317 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
318 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
319 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
320 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
321 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
322 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
323 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
324 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
325 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
326 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
327 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
328 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
329 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
330 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
331 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
332 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
333 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
334 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
335 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
336 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
337 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
338 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
339 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
340 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
341 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
342 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
343 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
344 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
345 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
349 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
350 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
351 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
352 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
353 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
354 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
355 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
356 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
357 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
358 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
359 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
361 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
362 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
363 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
364 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
365 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
366 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
367 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
368 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
369 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
370 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
371 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
372 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
373 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
374 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
375 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
376 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
377 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
378 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
379 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
380 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
381 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
382 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
383 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
384 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
385 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
386 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.29
Metatranscriptomes 0
Isolates 10.71

Biome Distribution

Category Percentage (%)
Aerial Root 0.4
Bulb 0
Endosphere 7.8
Nodule 0.13
Rhizoplane 0.93
Rhizosphere 76.72
Stem 0
Stem Tuber 0
Unclassified 14.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_301064 2162886007 Bacteria 32696
2 MRS1b_contig_8779386 2162886011 Bacteria 1332
3 JGI24740J21852_10003561 3300001979 Bacteria 6814
4 JGI24740J21852_10026941 3300001979 Bacteria 1918
5 JGI24740J21852_10038301 3300001979 Bacteria 1472
6 JGI24737J22298_10012381 3300001990 Bacteria 2782
7 JGI24737J22298_10020942 3300001990 Bacteria 2085
8 JGI24735J21928_10000002 3300002067 Bacteria 624895
9 JGI24735J21928_10006150 3300002067 Bacteria 3963
10 JGI25154J39366_1000025 3300002738 Bacteria 211189
11 JGI25157J39369_1006040 3300002741 Bacteria 1893
12 JGI25159J45721_1017468 3300002987 Bacteria 1482
13 JGI25406J46586_10040573 3300003203 Bacteria 1649
14 JGI25153J46596_10003683 3300003215 Bacteria 8483
15 rootH1_10003905 3300003316 Bacteria 4614
16 rootH1_10028754 3300003316 Bacteria 4651
17 rootH1_10071229 3300003316 Bacteria 10970
18 rootH1_10084445 3300003316 Bacteria 2033
19 rootH2_10001801 3300003320 Bacteria 92828
20 rootH2_10011484 3300003320 Bacteria 18209
21 rootH2_10020406 3300003320 Bacteria 5976
22 rootH2_10050819 3300003320 Bacteria 3694
23 rootH2_10054169 3300003320 Bacteria 16718
24 rootH2_10062956 3300003320 Bacteria 2229
25 rootH2_10245769 3300003320 Bacteria 1397
26 rootL2_10009807 3300003322 Bacteria 4554
27 rootL2_10066242 3300003322 Bacteria 2074
28 rootL2_10132642 3300003322 Bacteria 6071
29 rootL2_10165344 3300003322 Bacteria 3030
30 rootL2_10189861 3300003322 Bacteria 2698
31 rootH1_10006845 3300003323 Bacteria 5177
32 rootH1_10017652 3300003316 Bacteria 4049
33 rootH1_10017652 3300003323 Bacteria 1745
34 rootH1_10017957 3300003323 Bacteria 14637
35 rootH1_10048169 3300003323 Bacteria 8811
36 rootH1_10081119 3300003323 Bacteria 3298
37 rootH1_10092177 3300003323 Bacteria 4808
38 rootH1_10157014 3300003323 Bacteria 1494
39 rootH1_10260771 3300003323 Bacteria 1696
40 JGI25160J50197_1004797 3300003354 Bacteria 5768
41 Ga0055535_1001728 3300003761 Bacteria 9813
42 Ga0055536_1009986 3300003781 Bacteria 3838
43 Ga0055531_10000071 3300003794 Bacteria 110534
44 Ga0058692_1000007 3300003856 Bacteria 366313
45 Ga0065165_1000057 3300005262 Bacteria 185971
46 Ga0065703_1000113 3300005272 Bacteria 60359
47 Ga0065714_10002864 3300005288 Bacteria 54801
48 Ga0065714_10002993 3300005288 Bacteria 18963
49 Ga0065714_10078522 3300005288 Bacteria 2592
50 Ga0065714_10083886 3300005288 Bacteria 2226
51 Ga0065714_10084831 3300005288 Bacteria 2178
52 Ga0065714_10136971 3300005288 Bacteria 1201
53 Ga0065704_10000229 3300005289 Bacteria 80338
54 Ga0065704_10004724 3300005289 Bacteria 3390
55 Ga0065704_10015826 3300005289 Bacteria 1331
56 Ga0065704_10087427 3300005289 Bacteria 3026
57 Ga0065704_10169842 3300005289 Bacteria 1298
58 Ga0065712_10141975 3300005290 Bacteria 1442
59 Ga0070658_10000025 3300005327 Bacteria 174551
60 Ga0070658_10225671 3300005327 Bacteria 1585
61 Ga0070658_10228455 3300005327 Unclassified 1575
62 Ga0070676_10000058 3300005328 Bacteria 36261
63 Ga0070676_10013674 3300005328 Bacteria 4448
64 Ga0070683_100020914 3300005329 Bacteria 5834
65 Ga0070683_100022739 3300005329 Bacteria 5607
66 Ga0070683_100093455 3300005329 Bacteria 2826
67 Ga0070690_100014466 3300005330 Bacteria 4682
68 Ga0070690_100127628 3300005330 Unclassified 1714
69 Ga0070670_100097515 3300005331 Bacteria 2529
70 Ga0068869_100010539 3300005334 Bacteria 6031
71 Ga0068869_100049154 3300005334 Bacteria 3052
72 Ga0068869_100062633 3300005334 Bacteria 2730
73 Ga0068869_100115391 3300005334 Bacteria 2048
74 Ga0070666_10000174 3300005335 Bacteria 43931
75 Ga0070666_10050561 3300005335 Bacteria 2796
76 Ga0070666_10051528 3300005335 Bacteria 2772
77 Ga0070680_100022362 3300005336 Bacteria 5037
78 Ga0070680_100082320 3300005336 Bacteria 2656
79 Ga0070682_100000605 3300005337 Bacteria 21844
80 Ga0068868_100008858 3300005338 Bacteria 7210
81 Ga0070660_100098392 3300005339 Bacteria 2315
82 Ga0070689_100297457 3300005340 Bacteria 1343
83 Ga0070661_100000394 3300005344 Bacteria 33858
84 Ga0070661_100002053 3300005344 Bacteria 13879
85 Ga0070668_100113403 3300005347 Unclassified 2159
86 Ga0070669_100006597 3300005353 Bacteria 8353
87 Ga0070675_100014913 3300005354 Bacteria 6137
88 Ga0070671_100171890 3300005355 Bacteria 1833
89 Ga0070673_100005738 3300005364 Bacteria 7984
90 Ga0070673_100139440 3300005364 Bacteria 2044
91 Ga0070688_100002798 3300005365 Bacteria 8863
92 Ga0070688_100003235 3300005365 Bacteria 8344
93 Ga0070659_100000333 3300005366 Bacteria 36448
94 Ga0070659_100004546 3300005366 Bacteria 9911
95 Ga0070667_100036633 3300005367 Bacteria 4113
96 Ga0070667_100039197 3300005367 Bacteria 3971
97 Ga0070667_100142098 3300005367 Unclassified 2103
98 Ga0070663_100092934 3300005455 Bacteria 2238
99 Ga0070678_100012232 3300005456 Bacteria 5325
100 Ga0070678_100087892 3300005456 Bacteria 2375
101 Ga0070662_100000055 3300005457 Bacteria 60567
102 Ga0070662_100005182 3300005457 Bacteria 8315
103 Ga0070662_100024544 3300005457 Bacteria 4155
104 Ga0070662_100026860 3300005457 Bacteria 3990
105 Ga0070662_100165477 3300005457 Bacteria 1733
106 Ga0070681_10015115 3300005458 Bacteria 7678
107 Ga0070681_10273117 3300005458 Bacteria 1602
108 Ga0068867_100001957 3300005459 Bacteria 14352
109 Ga0070685_10010745 3300005466 Bacteria 4767
110 Ga0070698_100065707 3300005471 Bacteria 3652
111 Ga0070679_100064512 3300005530 Bacteria 3650
112 Ga0070684_100000214 3300005535 Bacteria 40555
113 Ga0070684_100040721 3300005535 Bacteria 4002
114 Ga0070684_100106567 3300005535 Bacteria 2509
115 Ga0070684_100222471 3300005535 Bacteria 1722
116 Ga0068853_100001864 3300005539 Bacteria 15492
117 Ga0068853_100011469 3300005539 Bacteria 7204
118 Ga0068853_100068624 3300005539 Bacteria 3082
119 Ga0068853_100126393 3300005539 Bacteria 2284
120 Ga0068853_100183632 3300005539 Bacteria 1898
121 Ga0068853_100256855 3300005539 Bacteria 1605
122 Ga0070686_100055842 3300005544 Bacteria 2531
123 Ga0070665_100000006 3300005548 Bacteria 718034
124 Ga0070665_100000034 3300005548 Bacteria 324289
125 Ga0070665_100001787 3300005548 Bacteria 24481
126 Ga0070665_100105863 3300005548 Bacteria 2815
127 Ga0068855_100041771 3300005563 Bacteria 5434
128 Ga0068855_100100099 3300005563 Bacteria 3338
129 Ga0068855_100130904 3300005563 Bacteria 2865
130 Ga0068855_100594950 3300005563 Bacteria 1193
131 Ga0068855_100607187 3300005563 Bacteria 1179
132 Ga0070664_100003687 3300005564 Bacteria 12351
133 Ga0068857_100005631 3300005577 Bacteria 10706
134 Ga0068857_100006534 3300005577 Bacteria 10006
135 Ga0068857_100009540 3300005577 Bacteria 8428
136 Ga0068857_100009916 3300005577 Bacteria 8267
137 Ga0068857_100096038 3300005577 Bacteria 2656
138 Ga0068854_100014991 3300005578 Bacteria 5123
139 Ga0068856_100001729 3300005614 Bacteria 22841
140 Ga0068856_100016408 3300005614 Bacteria 7165
141 Ga0068856_100126311 3300005614 Bacteria 2561
142 Ga0068856_100133388 3300005614 Bacteria 2489
143 Ga0070702_100023869 3300005615 Bacteria 3256
144 Ga0068852_100015157 3300005616 Bacteria 5966
145 Ga0068852_100020101 3300005616 Bacteria 5304
146 Ga0068852_100113673 3300005616 Bacteria 2466
147 Ga0068852_100172245 3300005616 Bacteria 2030
148 Ga0068852_100325910 3300005616 Bacteria 1493
149 Ga0068852_100423063 3300005616 Bacteria 1314
150 Ga0068859_100001134 3300005617 Bacteria 27162
151 Ga0068859_100024970 3300005617 Bacteria 5998
152 Ga0068859_100105082 3300005617 Bacteria 2883
153 Ga0068859_100184228 3300005617 Bacteria 2171
154 Ga0068864_100011569 3300005618 Bacteria 7285
155 Ga0068864_100055735 3300005618 Bacteria 3413
156 Ga0068866_10045142 3300005718 Bacteria 2208
157 Ga0068861_100319800 3300005719 Bacteria 1351
158 Ga0068851_10060615 3300005834 Bacteria 1937
159 Ga0068851_10127309 3300005834 Bacteria 1374
160 Ga0068863_100025030 3300005841 Bacteria 5692
161 Ga0068863_100312112 3300005841 Bacteria 1526
162 Ga0068858_100006604 3300005842 Bacteria 11285
163 Ga0068858_100162571 3300005842 Bacteria 2102
164 Ga0068860_100000005 3300005843 Bacteria 472349
165 Ga0068860_100016689 3300005843 Bacteria 7162
166 Ga0068860_100024943 3300005843 Bacteria 5772
167 Ga0068860_100040364 3300005843 Bacteria 4461
168 Ga0068860_100120760 3300005843 Bacteria 2509
169 Ga0068862_100076911 3300005844 Bacteria 2889
170 Ga0081539_10000147 3300005985 Bacteria 164274
171 Ga0075366_10001295 3300006195 Bacteria 12474
172 Ga0075366_10022084 3300006195 Bacteria 3700
173 Ga0075366_10081002 3300006195 Bacteria 1939
174 Ga0075366_10090686 3300006195 Bacteria 1831
175 Ga0097621_100001787 3300006237 Bacteria 14759
176 Ga0068871_100000099 3300006358 Bacteria 51278
177 Ga0068871_100119257 3300006358 Bacteria 2227
178 Ga0068865_100000055 3300006881 Bacteria 62584
179 Ga0068865_100050491 3300006881 Bacteria 2874
180 Ga0068865_100066543 3300006881 Bacteria 2542
181 Ga0097620_100001134 3300006931 Bacteria 27162
182 Ga0097620_100024970 3300006931 Bacteria 5998
183 Ga0097620_100105080 3300006931 Bacteria 2883
184 Ga0097620_100411609 3300006931 Bacteria 1448
185 Ga0105251_10058269 3300009011 Bacteria 1824
186 Ga0105244_10000007 3300009036 Bacteria 352275
187 Ga0105244_10000050 3300009036 Bacteria 138868
188 Ga0105244_10001222 3300009036 Bacteria 21064
189 Ga0105244_10104398 3300009036 Bacteria 1383
190 Ga0105250_10012506 3300009092 Bacteria 3502
191 Ga0105250_10013417 3300009092 Bacteria 3375
192 Ga0105240_10000147 3300009093 Bacteria 142340
193 Ga0105240_10000168 3300009093 Bacteria 133212
194 Ga0105240_10001071 3300009093 Bacteria 48359
195 Ga0105240_10003601 3300009093 Bacteria 23998
196 Ga0105240_10006315 3300009093 Bacteria 17443
197 Ga0105240_10036262 3300009093 Bacteria 6346
198 Ga0105240_10399573 3300009093 Bacteria 1548
199 Ga0105245_10041124 3300009098 Bacteria 4120
200 Ga0105245_10133751 3300009098 Bacteria 2328
201 Ga0105247_10000560 3300009101 Bacteria 30230
202 Ga0105247_10018189 3300009101 Bacteria 4215
203 Ga0105247_10040956 3300009101 Bacteria 2833
204 Ga0114129_10016698 3300009147 Bacteria 10455
205 Ga0105243_10000012 3300009148 Bacteria 300885
206 Ga0105243_10000052 3300009148 Bacteria 138341
207 Ga0105243_10003425 3300009148 Bacteria 12847
208 Ga0105243_10033408 3300009148 Bacteria 3978
209 Ga0105243_10149190 3300009148 Bacteria 2004
210 Ga0105241_10000646 3300009174 Bacteria 26122
211 Ga0105241_10000727 3300009174 Bacteria 24962
212 Ga0105241_10002072 3300009174 Bacteria 15154
213 Ga0105241_10004327 3300009174 Bacteria 10505
214 Ga0105241_10011531 3300009174 Bacteria 6480
215 Ga0105241_10099616 3300009174 Bacteria 2308
216 Ga0105241_10461176 3300009174 Bacteria 1126
217 Ga0105242_10050853 3300009176 Bacteria 3376
218 Ga0105242_10101430 3300009176 Bacteria 2439
219 Ga0105248_10163029 3300009177 Bacteria 2514
220 Ga0105237_10000052 3300009545 Bacteria 160459
221 Ga0105237_10000465 3300009545 Bacteria 57393
222 Ga0105237_10004647 3300009545 Bacteria 15820
223 Ga0105237_10006979 3300009545 Bacteria 12452
224 Ga0105237_10007788 3300009545 Bacteria 11682
225 Ga0105237_10008058 3300009545 Bacteria 11457
226 Ga0105237_10019455 3300009545 Bacteria 7011
227 Ga0105237_10136018 3300009545 Bacteria 2452
228 Ga0105238_10276334 3300009551 Bacteria 1660
229 Ga0105249_10007645 3300009553 Bacteria 9421
230 Ga0105249_10045035 3300009553 Bacteria 4012
231 Ga0105249_10146373 3300009553 Bacteria 2270
232 Ga0105239_10000277 3300010375 Bacteria 75496
233 Ga0105239_10000896 3300010375 Bacteria 42315
234 Ga0105239_10003342 3300010375 Bacteria 19721
235 Ga0105239_10006368 3300010375 Bacteria 13715
236 Ga0105239_10031149 3300010375 Bacteria 5868
237 Ga0105239_10031395 3300010375 Bacteria 5843
238 Ga0105239_10070587 3300010375 Bacteria 3837
239 Ga0105246_10006728 3300011119 Bacteria 7029
240 Ga0105246_10052685 3300011119 Bacteria 2798
241 Ga0105246_10327969 3300011119 Bacteria 1246
242 Ga0157373_10000089 3300013100 Bacteria 78449
243 Ga0157373_10000261 3300013100 Bacteria 42879
244 Ga0157373_10005929 3300013100 Bacteria 9144
245 Ga0157373_10008339 3300013100 Bacteria 7698
246 Ga0157373_10039389 3300013100 Bacteria 3384
247 Ga0157373_10069209 3300013100 Bacteria 2495
248 Ga0157371_10000009 3300013102 Bacteria 392895
249 Ga0157371_10001830 3300013102 Bacteria 21442
250 Ga0157371_10010803 3300013102 Bacteria 7087
251 Ga0157371_10016929 3300013102 Bacteria 5429
252 Ga0157371_10023778 3300013102 Bacteria 4479
253 Ga0157371_10056955 3300013102 Bacteria 2772
254 Ga0157370_10007408 3300013104 Bacteria 11952
255 Ga0157370_10023356 3300013104 Bacteria 6140
256 Ga0157370_10052976 3300013104 Bacteria 3871
257 Ga0157370_10343322 3300013104 Bacteria 1376
258 Ga0157369_10000033 3300013105 Bacteria 201124
259 Ga0157369_10018848 3300013105 Bacteria 7733
260 Ga0157369_10079919 3300013105 Bacteria 3502
261 Ga0157374_10000002 3300013296 Bacteria 1054226
262 Ga0157374_10000051 3300013296 Bacteria 126876
263 Ga0157374_10000660 3300013296 Bacteria 30313
264 Ga0157374_10006360 3300013296 Bacteria 10022
265 Ga0157374_10009338 3300013296 Bacteria 8414
266 Ga0157374_10234627 3300013296 Bacteria 1803
267 Ga0157378_10070743 3300013297 Bacteria 3133
268 Ga0163162_10000018 3300013306 Bacteria 226257
269 Ga0163162_10000854 3300013306 Bacteria 28384
270 Ga0163162_10002414 3300013306 Bacteria 17587
271 Ga0163162_10004463 3300013306 Bacteria 13484
272 Ga0163162_10025890 3300013306 Bacteria 5798
273 Ga0157372_10000621 3300013307 Bacteria 38766
274 Ga0157372_10006504 3300013307 Bacteria 12440
275 Ga0157372_10018242 3300013307 Bacteria 7543
276 Ga0157372_10018251 3300013307 Bacteria 7542
277 Ga0157372_10066801 3300013307 Bacteria 4041
278 Ga0157372_10083990 3300013307 Bacteria 3608
279 Ga0157372_10151463 3300013307 Unclassified 2677
280 Ga0157375_10000222 3300013308 Bacteria 53493
281 Ga0157375_10002786 3300013308 Bacteria 15120
282 Ga0157375_10106326 3300013308 Bacteria 2898
283 Ga0157375_10426170 3300013308 Bacteria 1493
284 Ga0163163_10002002 3300014325 Bacteria 17218
285 Ga0163163_10126423 3300014325 Bacteria 2594
286 Ga0157380_10000947 3300014326 Bacteria 18382
287 Ga0157380_10003364 3300014326 Bacteria 10973
288 Ga0157380_10494883 3300014326 Bacteria 1186
289 Ga0182008_10000237 3300014497 Bacteria 42829
290 Ga0157377_10043007 3300014745 Bacteria 2512
291 Ga0157377_10044107 3300014745 Bacteria 2485
292 Ga0157379_10032319 3300014968 Bacteria 4666
293 Ga0157379_10080993 3300014968 Bacteria 2909
294 Ga0157376_10010852 3300014969 Bacteria 6688
295 Ga0157376_10063455 3300014969 Bacteria 3112
296 Ga0157376_10084223 3300014969 Unclassified 2737
297 Ga0182006_1000012 3300015261 Bacteria 394239
298 Ga0182006_1001110 3300015261 Bacteria 17169
299 Ga0182007_10000015 3300015262 Bacteria 207893
300 Ga0182005_1000023 3300015265 Bacteria 246328
301 Ga0183373_1013 3300015682 Bacteria 112340
302 Ga0163161_10000012 3300017792 Bacteria 264639
303 Ga0163161_10000178 3300017792 Bacteria 58130
304 Ga0163161_10001618 3300017792 Bacteria 16584
305 Ga0163161_10001922 3300017792 Bacteria 15167
306 Ga0163161_10022450 3300017792 Bacteria 4445
307 Ga0213872_10013765 3300021361 Bacteria 3786
308 Ga0209436_101671 3300025208 Bacteria 7370
309 Ga0209258_100161 3300025242 Bacteria 151992
310 Ga0209646_1000037 3300025246 Bacteria 355116
311 Ga0209026_1000819 3300025250 Bacteria 16669
312 Ga0209026_1000903 3300025250 Bacteria 15274
313 Ga0209026_1004184 3300025250 Bacteria 4405
314 Ga0209148_1000161 3300025254 Bacteria 138759
315 Ga0209130_1001704 3300025284 Bacteria 13290
316 Ga0209676_1000558 3300025292 Bacteria 56412
317 Ga0209050_1003096 3300025298 Bacteria 12763
318 Ga0207426_1000034 3300025302 Bacteria 454016
319 Ga0207426_1000052 3300025302 Bacteria 389825
320 Ga0207426_1000959 3300025302 Bacteria 28423
321 Ga0207426_1007449 3300025302 Bacteria 4581
322 Ga0209257_1000001 3300025304 Bacteria 2274655
323 Ga0207696_1001450 3300025711 Bacteria 12868
324 Ga0207696_1001460 3300025711 Bacteria 12812
325 Ga0207696_1003489 3300025711 Bacteria 7126
326 Ga0207655_1000066 3300025728 Bacteria 246358
327 Ga0207655_1000423 3300025728 Bacteria 57574
328 Ga0207655_1000480 3300025728 Bacteria 51524
329 Ga0207655_1000941 3300025728 Bacteria 30166
330 Ga0207713_1002097 3300025735 Bacteria 14883
331 Ga0207713_1002622 3300025735 Bacteria 12934
332 Ga0207713_1004893 3300025735 Bacteria 8569
333 Ga0207710_10000018 3300025900 Bacteria 346727
334 Ga0207680_10001491 3300025903 Bacteria 11058
335 Ga0207680_10060199 3300025903 Bacteria 2310
336 Ga0207647_10000067 3300025904 Bacteria 81496
337 Ga0207647_10009112 3300025904 Bacteria 7066
338 Ga0207647_10024458 3300025904 Bacteria 3982
339 Ga0207647_10135957 3300025904 Unclassified 1443
340 Ga0207645_10000046 3300025907 Bacteria 85043
341 Ga0207645_10002079 3300025907 Bacteria 16016
342 Ga0207705_10000088 3300025909 Bacteria 113694
343 Ga0207654_10002278 3300025911 Bacteria 9832
344 Ga0207654_10011225 3300025911 Bacteria 4566
345 Ga0207707_10068888 3300025912 Bacteria 3083
346 Ga0207707_10229243 3300025912 Bacteria 1616
347 Ga0207695_10000023 3300025913 Bacteria 657903
348 Ga0207695_10000031 3300025913 Bacteria 526801
349 Ga0207695_10005530 3300025913 Bacteria 16713
350 Ga0207695_10013245 3300025913 Bacteria 9840
351 Ga0207695_10015486 3300025913 Bacteria 8973
352 Ga0207671_10000103 3300025914 Bacteria 129408
353 Ga0207671_10005853 3300025914 Bacteria 11171
354 Ga0207671_10007952 3300025914 Bacteria 9088
355 Ga0207671_10009391 3300025914 Bacteria 8177
356 Ga0207671_10011734 3300025914 Bacteria 7099
357 Ga0207671_10046626 3300025914 Bacteria 3207
358 Ga0207671_10070556 3300025914 Bacteria 2605
359 Ga0207657_10054302 3300025919 Bacteria 3465
360 Ga0207657_10096489 3300025919 Bacteria 2459
361 Ga0207657_10107054 3300025919 Bacteria 2313
362 Ga0207649_10007482 3300025920 Bacteria 5939
363 Ga0207652_10004883 3300025921 Bacteria 10849
364 Ga0207652_10157306 3300025921 Bacteria 2036
365 Ga0207681_10023476 3300025923 Bacteria 3945
366 Ga0207681_10171034 3300025923 Bacteria 1647
367 Ga0207694_10007148 3300025924 Bacteria 8486
368 Ga0207694_10221379 3300025924 Bacteria 1544
369 Ga0207650_10112789 3300025925 Bacteria 2107
370 Ga0207659_10013415 3300025926 Bacteria 5247
371 Ga0207644_10022476 3300025931 Bacteria 4310
372 Ga0207644_10038320 3300025931 Unclassified 3376
373 Ga0207644_10369555 3300025931 Bacteria 1168
374 Ga0207690_10000304 3300025932 Bacteria 34321
375 Ga0207690_10004369 3300025932 Bacteria 8346
376 Ga0207706_10000123 3300025933 Bacteria 83810
377 Ga0207706_10002340 3300025933 Bacteria 18514
378 Ga0207706_10005267 3300025933 Bacteria 12062
379 Ga0207706_10012285 3300025933 Bacteria 7804
380 Ga0207706_10019359 3300025933 Bacteria 6123
381 Ga0207706_10057267 3300025933 Bacteria 3434
382 Ga0207686_10025826 3300025934 Bacteria 3422
383 Ga0207709_10000006 3300025935 Bacteria 800946
384 Ga0207709_10000016 3300025935 Bacteria 478406
385 Ga0207709_10002381 3300025935 Bacteria 11855
386 Ga0207709_10024406 3300025935 Bacteria 3452
387 Ga0207670_10301655 3300025936 Unclassified 1254
388 Ga0207704_10000058 3300025938 Bacteria 77010
389 Ga0207704_10015198 3300025938 Bacteria 3915
390 Ga0207704_10083725 3300025938 Bacteria 2071
391 Ga0207691_10326762 3300025940 Bacteria 1314
392 Ga0207711_10235340 3300025941 Bacteria 1678
393 Ga0207689_10001814 3300025942 Bacteria 20165
394 Ga0207689_10001835 3300025942 Bacteria 20086
395 Ga0207689_10008457 3300025942 Bacteria 8964
396 Ga0207689_10037062 3300025942 Bacteria 4047
397 Ga0207689_10050425 3300025942 Bacteria 3432
398 Ga0207661_10004101 3300025944 Bacteria 10182
399 Ga0207661_10119273 3300025944 Bacteria 2244
400 Ga0207679_10001053 3300025945 Bacteria 17570
401 Ga0207667_10040535 3300025949 Bacteria 4959
402 Ga0207667_10059918 3300025949 Bacteria 3985
403 Ga0207667_10534462 3300025949 Bacteria 1187
404 Ga0207667_10535569 3300025949 Bacteria 1185
405 Ga0207651_10014198 3300025960 Bacteria 4591
406 Ga0207712_10018768 3300025961 Bacteria 4509
407 Ga0207712_10088846 3300025961 Bacteria 2270
408 Ga0207668_10260329 3300025972 Bacteria 1413
409 Ga0207640_10080731 3300025981 Bacteria 2221
410 Ga0207658_10016984 3300025986 Bacteria 5009
411 Ga0207658_10063447 3300025986 Bacteria 2769
412 Ga0207658_10132702 3300025986 Bacteria 2003
413 Ga0207703_10083665 3300026035 Unclassified 2667
414 Ga0207639_10007717 3300026041 Bacteria 7347
415 Ga0207639_10017822 3300026041 Bacteria 5036
416 Ga0207639_10118270 3300026041 Bacteria 2173
417 Ga0207639_10266404 3300026041 Bacteria 1501
418 Ga0207678_10030091 3300026067 Bacteria 4741
419 Ga0207678_10250732 3300026067 Bacteria 1516
420 Ga0207702_10067209 3300026078 Bacteria 3076
421 Ga0207702_10088269 3300026078 Bacteria 2708
422 Ga0207702_10095754 3300026078 Bacteria 2609
423 Ga0207641_10001176 3300026088 Bacteria 26293
424 Ga0207641_10357856 3300026088 Bacteria 1393
425 Ga0207648_10003611 3300026089 Bacteria 16173
426 Ga0207648_10028421 3300026089 Bacteria 4958
427 Ga0207648_10133267 3300026089 Bacteria 2187
428 Ga0207676_10002233 3300026095 Bacteria 13913
429 Ga0207674_10004608 3300026116 Bacteria 16555
430 Ga0207674_10007362 3300026116 Bacteria 12820
431 Ga0207674_10058405 3300026116 Bacteria 3908
432 Ga0207674_10069769 3300026116 Bacteria 3534
433 Ga0207674_10110220 3300026116 Bacteria 2728
434 Ga0207675_100432483 3300026118 Bacteria 1301
435 Ga0207683_10031011 3300026121 Bacteria 4638
436 Ga0207683_10269286 3300026121 Bacteria 1556
437 Ga0207698_10024002 3300026142 Bacteria 4271
438 Ga0207698_10039738 3300026142 Bacteria 3488
439 Ga0207698_10151798 3300026142 Bacteria 2012
440 Ga0207698_10217600 3300026142 Bacteria 1724
441 Ga0207698_10322447 3300026142 Bacteria 1447
442 Ga0209371_1000024 3300027312 Bacteria 477286
443 Ga0268266_10000010 3300028379 Bacteria 1030233
444 Ga0268266_10000111 3300028379 Bacteria 169743
445 Ga0268266_10001914 3300028379 Bacteria 23412
446 Ga0268266_10111680 3300028379 Unclassified 2422
447 Ga0268265_10016052 3300028380 Bacteria 5138
448 Ga0268265_10406664 3300028380 Bacteria 1260
449 Ga0268264_10000012 3300028381 Bacteria 521740
450 Ga0268264_10005699 3300028381 Bacteria 10558
451 Ga0268264_10011858 3300028381 Bacteria 7180
452 Ga0268264_10045884 3300028381 Bacteria 3630
453 Ga0268264_10049332 3300028381 Bacteria 3502
454 Ga0265323_10015106 3300028653 Bacteria 3042
455 Ga0307517_10013867 3300028786 Bacteria 10894
456 Ga0307517_10029907 3300028786 Bacteria 6408
457 Ga0268256_1000026 3300030500 Bacteria 477260
458 Ga0307511_10000264 3300030521 Bacteria 54303
459 Ga0316176_1221375 3300030732 Bacteria 6020
460 Ga0316183_1025751 3300030742 Bacteria 35611
461 Ga0316181_1238304 3300030744 Bacteria 22220
462 Ga0307509_10060456 3300031507 Bacteria 4005
463 Ga0307509_10096439 3300031507 Bacteria 3009
464 Ga0307509_10208674 3300031507 Unclassified 1781
465 Ga0307408_100008446 3300031548 Bacteria 6798
466 Ga0307408_100034619 3300031548 Bacteria 3538
467 Ga0307508_10000926 3300031616 Bacteria 34077
468 Ga0307516_10000959 3300031730 Bacteria 39813
469 Ga0307516_10191775 3300031730 Bacteria 1769
470 Ga0307405_10000038 3300031731 Bacteria 86305
471 Ga0307405_10029137 3300031731 Bacteria 3223
472 Ga0307405_10227588 3300031731 Bacteria 1372
473 Ga0307413_10000190 3300031824 Bacteria 17657
474 Ga0307406_10004300 3300031901 Bacteria 7745
475 Ga0307407_10000005 3300031903 Bacteria 233125
476 Ga0307412_10000007 3300031911 Bacteria 486267
477 Ga0307412_10000045 3300031911 Bacteria 165021
478 Ga0307412_10000175 3300031911 Bacteria 45704
479 Ga0307409_100014401 3300031995 Bacteria 5144
480 Ga0307416_100000001 3300032002 Bacteria 515017
481 Ga0307416_100000003 3300032002 Bacteria 509060
482 Ga0307414_10000722 3300032004 Bacteria 16914
483 Ga0307414_10001496 3300032004 Bacteria 12126
484 Ga0307414_10003547 3300032004 Bacteria 8354
485 Ga0307414_10011808 3300032004 Bacteria 5140
486 Ga0307414_10057710 3300032004 Bacteria 2730
487 Ga0307414_10081914 3300032004 Bacteria 2364
488 Ga0307414_10208661 3300032004 Bacteria 1595
489 Ga0307411_10000007 3300032005 Bacteria 332057
490 Ga0307510_10002234 3300033180 Bacteria 21891
491 Ga0307510_10002335 3300033180 Bacteria 21445
492 Ga0373957_0116055 3300035120 Bacteria 1081
493 Ga0373933_0026277 3300035724 Bacteria 3343
494 Ga0395899_0002435 3300037312 Bacteria 15139
495 Ga0395900_0000141 3300037418 Bacteria 121159
496 Ga0395900_0004558 3300037418 Bacteria 14641
497 Ga0395900_0611609 3300037418 Bacteria 1029
498 Ga0395898_0016196 3300037466 Bacteria 7635
499 Ga0395898_0139976 3300037466 Bacteria 2316
500 Ga0395905_0000124 3300037471 Bacteria 126707
501 Ga0395905_0001156 3300037471 Bacteria 33041
502 Ga0395901_0000138 3300038443 Bacteria 94944
503 Ga0395901_0001199 3300038443 Bacteria 27585
504 Ga0436361_0166876 3300039447 Bacteria 8411
505 Ga0439436_0002217 3300041404 Bacteria 5820
506 Ga0439436_0016924 3300041404 Bacteria 2185
507 Ga0439466_0002102 3300041411 Bacteria 7800
508 Ga0439465_0001390 3300041413 Bacteria 7812
509 Ga0451800_0887562 3300041459 Bacteria 1472
510 Ga0439442_008724 3300042002 Bacteria 2047
511 Ga0439445_0001732 3300042004 Bacteria 4803
512 Ga0450894_004765 3300042131 Unclassified 1758
513 Ga0466969_0000207 3300044656 Bacteria 32129
514 Ga0466972_0000009 3300044658 Bacteria 256374
515 Ga0466972_0000010 3300044658 Bacteria 256339
516 Ga0466972_0000027 3300044658 Bacteria 174082
517 Ga0466972_0010416 3300044658 Bacteria 4668
518 Ga0466972_0010519 3300044658 Bacteria 4644
519 Ga0466972_0122304 3300044658 Bacteria 1227
520 Ga0466966_0132959 3300044684 Bacteria 1522
521 Ga0466964_0057289 3300044706 Bacteria 1613
522 Ga0466968_0015936 3300044735 Bacteria 2986
523 Ga0466968_0062379 3300044735 Bacteria 1609
524 Ga0466970_0000405 3300044765 Bacteria 20994
525 Ga0466970_0170214 3300044765 Bacteria 1207
526 Ga0466959_0000236 3300045049 Bacteria 34631
527 Ga0466959_0049484 3300045049 Bacteria 3088
528 Ga0495627_000002 3300046453 Bacteria 903861
529 Ga0495627_022153 3300046453 Bacteria 2094
530 Ga0495638_0046148 3300046460 Bacteria 2738
531 Ga0495638_0081583 3300046460 Bacteria 1963
532 Ga0495650_0000003 3300046471 Bacteria 900730
533 Ga0495585_0000771 3300046492 Bacteria 28305
534 Ga0495596_0003434 3300046500 Bacteria 8018
535 Ga0495607_0140002 3300046501 Bacteria 1249
536 Ga0495583_0030894 3300046506 Bacteria 2603
537 Ga0495606_0000116 3300046507 Bacteria 134901
538 Ga0495606_0020040 3300046507 Bacteria 4947
539 Ga0495610_0000009 3300046512 Bacteria 554843
540 Ga0495610_0000064 3300046512 Bacteria 125922
541 Ga0495610_0011164 3300046512 Bacteria 5510
542 Ga0495610_0054794 3300046512 Bacteria 1925
543 Ga0495616_0010178 3300046513 Bacteria 5457
544 Ga0495618_0205499 3300046514 Bacteria 1246
545 Ga0495628_0073998 3300046516 Bacteria 2654
546 Ga0495630_0011490 3300046517 Bacteria 6412
547 Ga0495631_0037602 3300046518 Bacteria 2156
548 Ga0495632_0001668 3300046519 Bacteria 18183
549 Ga0495632_0005176 3300046519 Bacteria 8703
550 Ga0495637_0063632 3300046520 Bacteria 1507
551 Ga0495637_0071355 3300046520 Bacteria 1401
552 Ga0495648_0009686 3300046524 Bacteria 7426
553 Ga0495663_0000315 3300046525 Bacteria 18182
554 Ga0495654_0000001 3300046530 Bacteria 1513197
555 Ga0495609_0017858 3300046538 Bacteria 3293
556 Ga0495609_0117341 3300046538 Bacteria 1146
557 Ga0495633_0000002 3300046558 Bacteria 488754
558 Ga0495633_0000894 3300046558 Bacteria 25504
559 Ga0495633_0010869 3300046558 Bacteria 4948
560 Ga0495633_0091543 3300046558 Bacteria 1414
561 Ga0495668_0000616 3300046616 Bacteria 43040
562 Ga0495668_0003175 3300046616 Bacteria 12632
563 Ga0495611_0001388 3300046648 Bacteria 12117
564 Ga0495625_0000219 3300046660 Bacteria 90690
565 Ga0495625_0000899 3300046660 Bacteria 40086
566 Ga0495625_0052379 3300046660 Bacteria 2923
567 Ga0495625_0072031 3300046660 Bacteria 2424
568 Ga0495661_0001366 3300046665 Bacteria 20602
569 Ga0495661_0023473 3300046665 Bacteria 4004
570 Ga0495661_0025387 3300046665 Bacteria 3827
571 Ga0495649_0000037 3300046694 Bacteria 133848
572 Ga0495683_0011413 3300047323 Bacteria 4675
573 Ga0495687_000009 3300047443 Bacteria 419317
574 Ga0495687_001565 3300047443 Bacteria 20768
575 Ga0495687_001658 3300047443 Bacteria 19993
576 Ga0495686_0000004 3300047472 Bacteria 869019
577 Ga0495686_0000095 3300047472 Bacteria 184643
578 Ga0495686_0000298 3300047472 Bacteria 85528
579 Ga0495686_0009867 3300047472 Bacteria 6843
580 Ga0495686_0061103 3300047472 Bacteria 2341
581 Ga0496102_0083518 3300048905 Bacteria 2947
582 Ga0496103_0021329 3300048906 Bacteria 3897
583 Ga0496104_0175747 3300048907 Bacteria 2052
584 Ga0496105_0198964 3300048908 Bacteria 1636
585 Ga0496106_0135021 3300048909 Bacteria 1937
586 Ga0496116_0000022 3300048919 Bacteria 482506
587 Ga0496116_0009389 3300048919 Bacteria 8343
588 Ga0496117_0000074 3300048920 Bacteria 232732
589 Ga0496117_0001473 3300048920 Bacteria 33842
590 Ga0496118_0001613 3300048921 Bacteria 33370
591 Ga0496118_0046262 3300048921 Bacteria 3388
592 Ga0496119_0000017 3300048922 Bacteria 309779
593 Ga0496121_0000010 3300048924 Bacteria 793488
594 Ga0496121_0063112 3300048924 Bacteria 3030
595 Ga0496122_0000159 3300048925 Bacteria 159297
596 Ga0496122_0000354 3300048925 Bacteria 98798
597 Ga0496122_0000357 3300048925 Bacteria 98456
598 Ga0496122_0000591 3300048925 Bacteria 74549
599 Ga0496122_0002282 3300048925 Bacteria 27757
600 Ga0496122_0002637 3300048925 Bacteria 25070
601 Ga0496122_0005231 3300048925 Bacteria 15573
602 Ga0496123_0001157 3300048926 Bacteria 39190
603 Ga0496123_0002468 3300048926 Bacteria 22867
604 Ga0496123_0003951 3300048926 Bacteria 16069
605 Ga0496123_0010609 3300048926 Bacteria 8109
606 Ga0496123_0047728 3300048926 Bacteria 2889
607 Ga0496124_0015613 3300048927 Bacteria 7269
608 Ga0496125_0001036 3300048928 Bacteria 43109
609 Ga0496125_0001152 3300048928 Bacteria 40077
610 Ga0496125_0003480 3300048928 Bacteria 19037
611 Ga0496125_0011088 3300048928 Bacteria 9042
612 Ga0496125_0011573 3300048928 Bacteria 8814
613 Ga0496125_0067715 3300048928 Bacteria 2812
614 Ga0496125_0160243 3300048928 Bacteria 1529
615 Ga0496126_0001468 3300048929 Bacteria 36714
616 Ga0496126_0172745 3300048929 Bacteria 1840
617 Ga0501034_0082568 3300049571 Bacteria 3215
618 Ga0501034_0188035 3300049571 Bacteria 2028
619 Ga0501038_0032093 3300049574 Bacteria 4637
620 Ga0501047_0228685 3300049581 Bacteria 1714
621 Ga0501217_000800 3300049661 Bacteria 5490
622 Ga0501236_004922 3300049670 Bacteria 1602
623 Ga0501247_003325 3300049677 Unclassified 1719
624 Ga0501249_000001 3300049679 Bacteria 268580
625 Ga0501249_001838 3300049679 Bacteria 4322
626 Ga0501250_004298 3300049680 Bacteria 1410
627 Ga0501219_001632 3300049703 Bacteria 2009
628 Ga0501225_0040220 3300049705 Unclassified 1288
629 Ga0501241_000254 3300049758 Bacteria 11801
630 Ga0501241_013384 3300049758 Bacteria 1490
631 Ga0501264_000029 3300049761 Bacteria 22049
632 Ga0501266_000010 3300049763 Bacteria 214932
633 Ga0501269_000185 3300049766 Bacteria 19129
634 Ga0501035_0266402 3300049822 Bacteria 1451
635 Ga0501044_0080712 3300049823 Bacteria 3294
636 Ga0501044_0324314 3300049823 Bacteria 1464
637 Ga0501284_00027 3300050005 Bacteria 76239
638 nmdc:mga0k408_25502_c1 3300050493 Bacteria 3348
639 nmdc:mga0k408_784_c1 3300050493 Bacteria 17473
640 nmdc:mga05p37_11042_c1 3300050507 Bacteria 10730
641 Ga0500578_0000386 3300053086 Bacteria 54049
642 Ga0500644_0000070 3300053088 Bacteria 61261
643 Ga0500583_0000035 3300053092 Bacteria 96248
644 Ga0500583_0016285 3300053092 Bacteria 2964
645 Ga0500651_0194340 3300053093 Bacteria 1200
646 Ga0500641_0017392 3300053096 Bacteria 2688
647 Ga0500556_0009571 3300053104 Bacteria 2820
648 Ga0500556_0055830 3300053104 Bacteria 1441
649 Ga0500618_009191 3300053125 Bacteria 2711
650 Ga0500642_0058694 3300053130 Bacteria 1721
651 Ga0500652_012210 3300053131 Bacteria 3007
652 Ga0500652_042276 3300053131 Unclassified 1838
653 Ga0500658_0000019 3300053134 Bacteria 141013
654 Ga0500658_0023115 3300053134 Bacteria 2371
655 Ga0500561_0035796 3300053137 Bacteria 1283
656 Ga0500568_0011971 3300053139 Bacteria 4003
657 Ga0500568_0015938 3300053139 Bacteria 3353
658 Ga0500577_0001728 3300053142 Bacteria 5597
659 Ga0500588_0002998 3300053146 Bacteria 3519
660 Ga0500588_0010301 3300053146 Bacteria 2253
661 Ga0500604_0001088 3300053151 Bacteria 7567
662 Ga0500616_0005269 3300053153 Bacteria 8838
663 Ga0500616_0006531 3300053153 Bacteria 7620
664 Ga0500622_0000010 3300053156 Bacteria 398804
665 Ga0500622_0000035 3300053156 Bacteria 182924
666 Ga0500622_0000222 3300053156 Bacteria 59404
667 Ga0500622_0000869 3300053156 Bacteria 25724
668 Ga0500622_0000915 3300053156 Bacteria 25127
669 Ga0500622_0002688 3300053156 Bacteria 12598
670 Ga0500622_0038362 3300053156 Bacteria 2499
671 Ga0500627_0002684 3300053158 Bacteria 5329
672 Ga0500634_0126772 3300053161 Bacteria 1233
673 Ga0500636_0023141 3300053177 Bacteria 3672
674 Ga0500611_011417 3300053727 Bacteria 1469
675 Ga0500656_011869 3300053732 Bacteria 976

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053732 Ga0500656_011869 Ga0500656_011869_23_913 295
2 3300037418 Ga0395900_0611609 Ga0395900_0611609_111_1013 299
3 3300035120 Ga0373957_0116055 Ga0373957_0116055_116_1036 304
4 3300013100 Ga0157373_10005929 Ga0157373_100059293 305
5 3300053156 Ga0500622_0000035 Ga0500622_0000035_164312_165232 305
6 3300053156 Ga0500622_0000222 Ga0500622_0000222_39697_40617 305
7 3300009174 Ga0105241_10461176 Ga0105241_104611762 306
8 3300009093 Ga0105240_10000168 Ga0105240_100001682 307
9 3300025913 Ga0207695_10000023 Ga0207695_10000023305 307
10 3300025913 Ga0207695_10000031 Ga0207695_10000031269 307
11 3300046512 Ga0495610_0054794 Ga0495610_0054794_943_1869 307
12 3300046538 Ga0495609_0117341 Ga0495609_0117341_163_1089 307
13 3300046648 Ga0495611_0001388 Ga0495611_0001388_3637_4563 307
14 3300053088 Ga0500644_0000070 Ga0500644_0000070_40396_41322 307
15 3300053134 Ga0500658_0023115 Ga0500658_0023115_479_1405 307
16 3300053137 Ga0500561_0035796 Ga0500561_0035796_32_958 307
17 3300053142 Ga0500577_0001728 Ga0500577_0001728_2088_3014 307
18 3300053146 Ga0500588_0010301 Ga0500588_0010301_984_1910 307
19 3300053153 Ga0500616_0005269 Ga0500616_0005269_7005_7931 307
20 3300005563 Ga0068855_100041771 Ga0068855_1000417712 311
21 3300009174 Ga0105241_10099616 Ga0105241_100996162 311
22 3300009545 Ga0105237_10136018 Ga0105237_101360182 311
23 3300025949 Ga0207667_10040535 Ga0207667_100405352 311
24 2162886011 MRS1b_contig_8779386 MRS1b_0045.00003160 312
25 3300005617 Ga0068859_100184228 Ga0068859_1001842282 312
26 3300048924 Ga0496121_0000010 Ga0496121_0000010_667579_668517 312
27 3300003781 Ga0055536_1009986 Ga0055536_10099863 313
28 3300005262 Ga0065165_1000057 Ga0065165_1000057116 313
29 3300005614 Ga0068856_100126311 Ga0068856_1001263112 313
30 3300013104 Ga0157370_10343322 Ga0157370_103433222 313
31 3300025911 Ga0207654_10011225 Ga0207654_100112253 313
32 3300025914 Ga0207671_10007952 Ga0207671_100079523 313
33 3300025924 Ga0207694_10007148 Ga0207694_100071483 313
34 3300026078 Ga0207702_10088269 Ga0207702_100882692 313
35 3300026142 Ga0207698_10151798 Ga0207698_101517981 313
36 3300031731 Ga0307405_10227588 Ga0307405_102275882 313
37 3300032004 Ga0307414_10057710 Ga0307414_100577102 313
38 3300053093 Ga0500651_0194340 Ga0500651_0194340_13_954 313
39 3300053131 Ga0500652_012210 Ga0500652_012210_1636_2577 313
40 3300053139 Ga0500568_0011971 Ga0500568_0011971_2410_3351 313
41 3300053139 Ga0500568_0015938 Ga0500568_0015938_1292_2233 313
42 3300053161 Ga0500634_0126772 Ga0500634_0126772_263_1204 313
43 3300025904 Ga0207647_10009112 Ga0207647_100091123 315
44 3300025298 Ga0209050_1003096 Ga0209050_100309610 320
45 iso_pu_bacteria 2910245624 2910246631 321
46 iso_pu_bacteria 2896109856 2896111023 322
47 iso_pu_bacteria 2599185184 2599478560 323
48 iso_pu_bacteria 2818991460 2819681295 323
49 iso_pu_bacteria 2852623160 2852624970 323
50 iso_pu_bacteria 2884933994 2884936005 323
51 iso_pu_bacteria 2928078545 2928080386 323
52 iso_pu_bacteria 2928147474 2928149441 323
53 iso_pu_bacteria 2929239360 2929242649 323
54 iso_pu_bacteria 2932082852 2932083270 323
55 3300009545 Ga0105237_10004647 Ga0105237_100046472 324
56 3300025914 Ga0207671_10000103 Ga0207671_1000010314 324
57 3300026118 Ga0207675_100432483 Ga0207675_1004324831 324
58 3300001979 JGI24740J21852_10026941 JGI24740J21852_100269412 325
59 3300001979 JGI24740J21852_10038301 JGI24740J21852_100383012 325
60 3300001990 JGI24737J22298_10012381 JGI24737J22298_100123812 325
61 3300002067 JGI24735J21928_10006150 JGI24735J21928_100061503 325
62 3300003316 rootH1_10003905 rootH1_100039053 325
63 3300003320 rootH2_10011484 rootH2_1001148410 325
64 3300003322 rootL2_10066242 rootL2_100662422 325
65 3300005334 Ga0068869_100115391 Ga0068869_1001153913 325
66 3300005339 Ga0070660_100098392 Ga0070660_1000983922 325
67 3300005366 Ga0070659_100000333 Ga0070659_10000033322 325
68 3300005367 Ga0070667_100039197 Ga0070667_1000391976 325
69 3300005457 Ga0070662_100005182 Ga0070662_1000051823 325
70 3300005577 Ga0068857_100009916 Ga0068857_1000099169 325
71 3300005616 Ga0068852_100172245 Ga0068852_1001722452 325
72 3300005843 Ga0068860_100040364 Ga0068860_1000403646 325
73 3300005844 Ga0068862_100076911 Ga0068862_1000769114 325
74 3300006195 Ga0075366_10090686 Ga0075366_100906862 325
75 3300009545 Ga0105237_10007788 Ga0105237_100077883 325
76 3300010375 Ga0105239_10006368 Ga0105239_1000636810 325
77 3300013307 Ga0157372_10083990 Ga0157372_100839903 325
78 3300025904 Ga0207647_10135957 Ga0207647_101359571 325
79 3300025914 Ga0207671_10046626 Ga0207671_100466263 325
80 3300025919 Ga0207657_10107054 Ga0207657_101070542 325
81 3300025932 Ga0207690_10000304 Ga0207690_1000030412 325
82 3300025933 Ga0207706_10002340 Ga0207706_1000234023 325
83 3300025942 Ga0207689_10050425 Ga0207689_100504253 325
84 3300026116 Ga0207674_10007362 Ga0207674_100073622 325
85 3300026142 Ga0207698_10217600 Ga0207698_102176002 325
86 3300028380 Ga0268265_10016052 Ga0268265_100160523 325
87 3300028381 Ga0268264_10049332 Ga0268264_100493321 325
88 3300031548 Ga0307408_100008446 Ga0307408_1000084464 325
89 3300031548 Ga0307408_100034619 Ga0307408_1000346193 325
90 3300031731 Ga0307405_10029137 Ga0307405_100291372 325
91 3300031901 Ga0307406_10004300 Ga0307406_100043007 325
92 3300046616 Ga0495668_0003175 Ga0495668_0003175_10410_11393 325
93 3300049661 Ga0501217_000800 Ga0501217_000800_3010_3990 325
94 3300049670 Ga0501236_004922 Ga0501236_004922_323_1303 325
95 3300049677 Ga0501247_003325 Ga0501247_003325_701_1681 325
96 3300049703 Ga0501219_001632 Ga0501219_001632_483_1469 325
97 3300049705 Ga0501225_0040220 Ga0501225_0040220_211_1197 325
98 3300049758 Ga0501241_013384 Ga0501241_013384_294_1280 325
99 3300049761 Ga0501264_000029 Ga0501264_000029_1034_2014 325
100 3300050005 Ga0501284_00027 Ga0501284_00027_74865_75851 325
101 3300053151 Ga0500604_0001088 Ga0500604_0001088_3657_4637 325
102 3300053156 Ga0500622_0000010 Ga0500622_0000010_20961_21941 325
103 iso_pu_bacteria 2914759650 2914760489 325
104 3300001990 JGI24737J22298_10020942 JGI24737J22298_100209422 326
105 3300003316 rootH1_10028754 rootH1_100287542 326
106 3300003320 rootH2_10001801 rootH2_1000180185 326
107 3300003322 rootL2_10189861 rootL2_101898612 326
108 3300003323 rootH1_10157014 rootH1_101570142 326
109 3300003794 Ga0055531_10000071 Ga0055531_1000007154 326
110 3300005290 Ga0065712_10141975 Ga0065712_101419752 326
111 3300005327 Ga0070658_10000025 Ga0070658_10000025177 326
112 3300005328 Ga0070676_10000058 Ga0070676_1000005811 326
113 3300005328 Ga0070676_10013674 Ga0070676_100136742 326
114 3300005329 Ga0070683_100022739 Ga0070683_1000227397 326
115 3300005329 Ga0070683_100093455 Ga0070683_1000934553 326
116 3300005330 Ga0070690_100014466 Ga0070690_1000144666 326
117 3300005331 Ga0070670_100097515 Ga0070670_1000975152 326
118 3300005334 Ga0068869_100010539 Ga0068869_1000105397 326
119 3300005334 Ga0068869_100062633 Ga0068869_1000626333 326
120 3300005335 Ga0070666_10050561 Ga0070666_100505612 326
121 3300005335 Ga0070666_10051528 Ga0070666_100515282 326
122 3300005338 Ga0068868_100008858 Ga0068868_1000088587 326
123 3300005340 Ga0070689_100297457 Ga0070689_1002974572 326
124 3300005344 Ga0070661_100000394 Ga0070661_10000039424 326
125 3300005344 Ga0070661_100002053 Ga0070661_1000020531 326
126 3300005354 Ga0070675_100014913 Ga0070675_1000149136 326
127 3300005355 Ga0070671_100171890 Ga0070671_1001718902 326
128 3300005364 Ga0070673_100005738 Ga0070673_1000057388 326
129 3300005364 Ga0070673_100139440 Ga0070673_1001394402 326
130 3300005365 Ga0070688_100002798 Ga0070688_1000027982 326
131 3300005365 Ga0070688_100003235 Ga0070688_10000323510 326
132 3300005366 Ga0070659_100004546 Ga0070659_1000045469 326
133 3300005367 Ga0070667_100036633 Ga0070667_1000366334 326
134 3300005456 Ga0070678_100012232 Ga0070678_1000122323 326
135 3300005456 Ga0070678_100087892 Ga0070678_1000878922 326
136 3300005457 Ga0070662_100000055 Ga0070662_10000005559 326
137 3300005457 Ga0070662_100024544 Ga0070662_1000245445 326
138 3300005457 Ga0070662_100026860 Ga0070662_1000268602 326
139 3300005457 Ga0070662_100165477 Ga0070662_1001654771 326
140 3300005459 Ga0068867_100001957 Ga0068867_10000195712 326
141 3300005466 Ga0070685_10010745 Ga0070685_100107453 326
142 3300005535 Ga0070684_100000214 Ga0070684_10000021423 326
143 3300005535 Ga0070684_100106567 Ga0070684_1001065674 326
144 3300005535 Ga0070684_100222471 Ga0070684_1002224711 326
145 3300005539 Ga0068853_100011469 Ga0068853_1000114694 326
146 3300005539 Ga0068853_100068624 Ga0068853_1000686242 326
147 3300005544 Ga0070686_100055842 Ga0070686_1000558423 326
148 3300005548 Ga0070665_100000034 Ga0070665_100000034216 326
149 3300005548 Ga0070665_100105863 Ga0070665_1001058632 326
150 3300005563 Ga0068855_100100099 Ga0068855_1001000992 326
151 3300005563 Ga0068855_100607187 Ga0068855_1006071871 326
152 3300005564 Ga0070664_100003687 Ga0070664_1000036872 326
153 3300005577 Ga0068857_100005631 Ga0068857_1000056318 326
154 3300005577 Ga0068857_100006534 Ga0068857_1000065349 326
155 3300005578 Ga0068854_100014991 Ga0068854_1000149915 326
156 3300005614 Ga0068856_100001729 Ga0068856_1000017292 326
157 3300005615 Ga0070702_100023869 Ga0070702_1000238695 326
158 3300005616 Ga0068852_100020101 Ga0068852_1000201013 326
159 3300005616 Ga0068852_100423063 Ga0068852_1004230632 326
160 3300005617 Ga0068859_100024970 Ga0068859_1000249707 326
161 3300005617 Ga0068859_100105082 Ga0068859_1001050823 326
162 3300005618 Ga0068864_100011569 Ga0068864_1000115696 326
163 3300005618 Ga0068864_100055735 Ga0068864_1000557353 326
164 3300005718 Ga0068866_10045142 Ga0068866_100451422 326
165 3300005834 Ga0068851_10127309 Ga0068851_101273092 326
166 3300005841 Ga0068863_100312112 Ga0068863_1003121122 326
167 3300005842 Ga0068858_100162571 Ga0068858_1001625713 326
168 3300006237 Ga0097621_100001787 Ga0097621_1000017875 326
169 3300006358 Ga0068871_100000099 Ga0068871_10000009936 326
170 3300006358 Ga0068871_100119257 Ga0068871_1001192572 326
171 3300006881 Ga0068865_100000055 Ga0068865_10000005516 326
172 3300006881 Ga0068865_100050491 Ga0068865_1000504913 326
173 3300006881 Ga0068865_100066543 Ga0068865_1000665433 326
174 3300006931 Ga0097620_100024970 Ga0097620_1000249707 326
175 3300006931 Ga0097620_100105080 Ga0097620_1001050803 326
176 3300009011 Ga0105251_10058269 Ga0105251_100582691 326
177 3300009093 Ga0105240_10006315 Ga0105240_100063154 326
178 3300009093 Ga0105240_10036262 Ga0105240_100362622 326
179 3300009093 Ga0105240_10399573 Ga0105240_103995732 326
180 3300009098 Ga0105245_10133751 Ga0105245_101337512 326
181 3300009148 Ga0105243_10033408 Ga0105243_100334082 326
182 3300009174 Ga0105241_10000727 Ga0105241_100007275 326
183 3300009174 Ga0105241_10011531 Ga0105241_100115313 326
184 3300009176 Ga0105242_10050853 Ga0105242_100508532 326
185 3300009177 Ga0105248_10163029 Ga0105248_101630292 326
186 3300009545 Ga0105237_10000465 Ga0105237_1000046535 326
187 3300009545 Ga0105237_10006979 Ga0105237_100069792 326
188 3300009553 Ga0105249_10045035 Ga0105249_100450354 326
189 3300010375 Ga0105239_10031395 Ga0105239_100313952 326
190 3300010375 Ga0105239_10070587 Ga0105239_100705875 326
191 3300011119 Ga0105246_10052685 Ga0105246_100526853 326
192 3300011119 Ga0105246_10327969 Ga0105246_103279692 326
193 3300013100 Ga0157373_10000089 Ga0157373_1000008958 326
194 3300013100 Ga0157373_10039389 Ga0157373_100393891 326
195 3300013100 Ga0157373_10069209 Ga0157373_100692092 326
196 3300013102 Ga0157371_10010803 Ga0157371_100108033 326
197 3300013102 Ga0157371_10056955 Ga0157371_100569552 326
198 3300013104 Ga0157370_10023356 Ga0157370_100233564 326
199 3300013296 Ga0157374_10000051 Ga0157374_10000051119 326
200 3300013296 Ga0157374_10000660 Ga0157374_1000066015 326
201 3300013296 Ga0157374_10006360 Ga0157374_100063602 326
202 3300013296 Ga0157374_10009338 Ga0157374_100093385 326
203 3300013297 Ga0157378_10070743 Ga0157378_100707432 326
204 3300013306 Ga0163162_10000018 Ga0163162_10000018180 326
205 3300013306 Ga0163162_10002414 Ga0163162_100024144 326
206 3300013306 Ga0163162_10025890 Ga0163162_100258903 326
207 3300013307 Ga0157372_10000621 Ga0157372_1000062123 326
208 3300013307 Ga0157372_10018242 Ga0157372_100182425 326
209 3300013307 Ga0157372_10018251 Ga0157372_100182515 326
210 3300013307 Ga0157372_10151463 Ga0157372_101514634 326
211 3300013308 Ga0157375_10002786 Ga0157375_1000278610 326
212 3300013308 Ga0157375_10106326 Ga0157375_101063264 326
213 3300013308 Ga0157375_10426170 Ga0157375_104261702 326
214 3300014325 Ga0163163_10002002 Ga0163163_100020024 326
215 3300014325 Ga0163163_10126423 Ga0163163_101264232 326
216 3300014745 Ga0157377_10043007 Ga0157377_100430072 326
217 3300014745 Ga0157377_10044107 Ga0157377_100441073 326
218 3300014968 Ga0157379_10032319 Ga0157379_100323194 326
219 3300014969 Ga0157376_10063455 Ga0157376_100634552 326
220 3300017792 Ga0163161_10001922 Ga0163161_100019223 326
221 3300017792 Ga0163161_10022450 Ga0163161_100224504 326
222 3300021361 Ga0213872_10013765 Ga0213872_100137652 326
223 3300025250 Ga0209026_1000903 Ga0209026_10009036 326
224 3300025304 Ga0209257_1000001 Ga0209257_1000001584 326
225 3300025903 Ga0207680_10060199 Ga0207680_100601994 326
226 3300025904 Ga0207647_10000067 Ga0207647_1000006772 326
227 3300025904 Ga0207647_10024458 Ga0207647_100244583 326
228 3300025907 Ga0207645_10000046 Ga0207645_1000004654 326
229 3300025907 Ga0207645_10002079 Ga0207645_1000207913 326
230 3300025909 Ga0207705_10000088 Ga0207705_100000886 326
231 3300025911 Ga0207654_10002278 Ga0207654_100022787 326
232 3300025913 Ga0207695_10005530 Ga0207695_1000553010 326
233 3300025913 Ga0207695_10015486 Ga0207695_100154868 326
234 3300025914 Ga0207671_10005853 Ga0207671_100058532 326
235 3300025919 Ga0207657_10054302 Ga0207657_100543022 326
236 3300025920 Ga0207649_10007482 Ga0207649_100074828 326
237 3300025923 Ga0207681_10171034 Ga0207681_101710342 326
238 3300025925 Ga0207650_10112789 Ga0207650_101127892 326
239 3300025926 Ga0207659_10013415 Ga0207659_100134154 326
240 3300025931 Ga0207644_10038320 Ga0207644_100383204 326
241 3300025931 Ga0207644_10369555 Ga0207644_103695551 326
242 3300025932 Ga0207690_10004369 Ga0207690_100043698 326
243 3300025933 Ga0207706_10000123 Ga0207706_100001239 326
244 3300025933 Ga0207706_10005267 Ga0207706_1000526713 326
245 3300025933 Ga0207706_10012285 Ga0207706_100122855 326
246 3300025933 Ga0207706_10019359 Ga0207706_100193597 326
247 3300025933 Ga0207706_10057267 Ga0207706_100572674 326
248 3300025934 Ga0207686_10025826 Ga0207686_100258264 326
249 3300025935 Ga0207709_10024406 Ga0207709_100244061 326
250 3300025936 Ga0207670_10301655 Ga0207670_103016551 326
251 3300025938 Ga0207704_10000058 Ga0207704_1000005837 326
252 3300025938 Ga0207704_10015198 Ga0207704_100151983 326
253 3300025938 Ga0207704_10083725 Ga0207704_100837252 326
254 3300025940 Ga0207691_10326762 Ga0207691_103267621 326
255 3300025941 Ga0207711_10235340 Ga0207711_102353402 326
256 3300025942 Ga0207689_10001814 Ga0207689_1000181412 326
257 3300025942 Ga0207689_10001835 Ga0207689_1000183518 326
258 3300025942 Ga0207689_10008457 Ga0207689_1000845711 326
259 3300025944 Ga0207661_10119273 Ga0207661_101192734 326
260 3300025945 Ga0207679_10001053 Ga0207679_100010538 326
261 3300025949 Ga0207667_10059918 Ga0207667_100599182 326
262 3300025949 Ga0207667_10535569 Ga0207667_105355691 326
263 3300025960 Ga0207651_10014198 Ga0207651_100141982 326
264 3300025981 Ga0207640_10080731 Ga0207640_100807313 326
265 3300025986 Ga0207658_10063447 Ga0207658_100634473 326
266 3300025986 Ga0207658_10132702 Ga0207658_101327022 326
267 3300026035 Ga0207703_10083665 Ga0207703_100836652 326
268 3300026041 Ga0207639_10017822 Ga0207639_100178223 326
269 3300026041 Ga0207639_10266404 Ga0207639_102664041 326
270 3300026067 Ga0207678_10030091 Ga0207678_100300915 326
271 3300026088 Ga0207641_10357856 Ga0207641_103578562 326
272 3300026089 Ga0207648_10003611 Ga0207648_100036113 326
273 3300026089 Ga0207648_10133267 Ga0207648_101332672 326
274 3300026095 Ga0207676_10002233 Ga0207676_1000223312 326
275 3300026116 Ga0207674_10004608 Ga0207674_100046087 326
276 3300026121 Ga0207683_10031011 Ga0207683_100310113 326
277 3300026142 Ga0207698_10024002 Ga0207698_100240023 326
278 3300026142 Ga0207698_10322447 Ga0207698_103224471 326
279 3300028379 Ga0268266_10000111 Ga0268266_1000011141 326
280 3300028379 Ga0268266_10111680 Ga0268266_101116804 326
281 3300028786 Ga0307517_10013867 Ga0307517_100138677 326
282 3300033180 Ga0307510_10002335 Ga0307510_100023351 326
283 3300035724 Ga0373933_0026277 Ga0373933_0026277_380_1366 326
284 3300037312 Ga0395899_0002435 Ga0395899_0002435_13903_14886 326
285 3300037418 Ga0395900_0000141 Ga0395900_0000141_64440_65423 326
286 3300037418 Ga0395900_0004558 Ga0395900_0004558_11353_12336 326
287 3300037466 Ga0395898_0016196 Ga0395898_0016196_305_1288 326
288 3300037466 Ga0395898_0139976 Ga0395898_0139976_1167_2150 326
289 3300037471 Ga0395905_0000124 Ga0395905_0000124_70232_71215 326
290 3300037471 Ga0395905_0001156 Ga0395905_0001156_20690_21673 326
291 3300038443 Ga0395901_0000138 Ga0395901_0000138_68005_68988 326
292 3300038443 Ga0395901_0001199 Ga0395901_0001199_6982_7965 326
293 3300039447 Ga0436361_0166876 Ga0436361_0166876_2644_3627 326
294 3300046512 Ga0495610_0000064 Ga0495610_0000064_78811_79791 326
295 3300046514 Ga0495618_0205499 Ga0495618_0205499_181_1167 326
296 3300046516 Ga0495628_0073998 Ga0495628_0073998_157_1143 326
297 3300046517 Ga0495630_0011490 Ga0495630_0011490_2836_3822 326
298 3300046518 Ga0495631_0037602 Ga0495631_0037602_431_1414 326
299 3300046520 Ga0495637_0071355 Ga0495637_0071355_129_1109 326
300 3300047323 Ga0495683_0011413 Ga0495683_0011413_1743_2726 326
301 3300047443 Ga0495687_001658 Ga0495687_001658_17155_18138 326
302 3300047472 Ga0495686_0000298 Ga0495686_0000298_63353_64333 326
303 3300048907 Ga0496104_0175747 Ga0496104_0175747_552_1538 326
304 3300048908 Ga0496105_0198964 Ga0496105_0198964_251_1237 326
305 3300048909 Ga0496106_0135021 Ga0496106_0135021_847_1833 326
306 3300048929 Ga0496126_0172745 Ga0496126_0172745_283_1266 326
307 3300053130 Ga0500642_0058694 Ga0500642_0058694_381_1364 326
308 3300053156 Ga0500622_0000869 Ga0500622_0000869_13064_14044 326
309 3300002067 JGI24735J21928_10000002 JGI24735J21928_10000002393 327
310 3300002741 JGI25157J39369_1006040 JGI25157J39369_10060401 327
311 3300002987 JGI25159J45721_1017468 JGI25159J45721_10174682 327
312 3300003316 rootH1_10071229 rootH1_100712293 327
313 3300003320 rootH2_10020406 rootH2_100204061 327
314 3300003320 rootH2_10062956 rootH2_100629564 327
315 3300003322 rootL2_10165344 rootL2_101653442 327
316 3300003323 rootH1_10017652 rootH1_100176523 327
317 3300003323 rootH1_10092177 rootH1_100921774 327
318 3300003323 rootH1_10260771 rootH1_102607711 327
319 3300005539 Ga0068853_100001864 Ga0068853_1000018642 327
320 3300005539 Ga0068853_100126393 Ga0068853_1001263933 327
321 3300005577 Ga0068857_100096038 Ga0068857_1000960381 327
322 3300005616 Ga0068852_100113673 Ga0068852_1001136732 327
323 3300006195 Ga0075366_10001295 Ga0075366_100012952 327
324 3300009093 Ga0105240_10000147 Ga0105240_100001472 327
325 3300009545 Ga0105237_10000052 Ga0105237_1000005233 327
326 3300009551 Ga0105238_10276334 Ga0105238_102763342 327
327 3300010375 Ga0105239_10000277 Ga0105239_1000027715 327
328 3300010375 Ga0105239_10000896 Ga0105239_1000089615 327
329 3300013296 Ga0157374_10000002 Ga0157374_1000000229 327
330 3300013307 Ga0157372_10006504 Ga0157372_100065045 327
331 3300014969 Ga0157376_10010852 Ga0157376_100108523 327
332 3300025208 Ga0209436_101671 Ga0209436_1016716 327
333 3300025250 Ga0209026_1004184 Ga0209026_10041843 327
334 3300025284 Ga0209130_1001704 Ga0209130_10017042 327
335 3300025302 Ga0207426_1000034 Ga0207426_100003412 327
336 3300025914 Ga0207671_10070556 Ga0207671_100705562 327
337 3300025924 Ga0207694_10221379 Ga0207694_102213792 327
338 3300026041 Ga0207639_10007717 Ga0207639_100077172 327
339 3300030521 Ga0307511_10000264 Ga0307511_1000026421 327
340 3300031507 Ga0307509_10060456 Ga0307509_100604563 327
341 3300031507 Ga0307509_10096439 Ga0307509_100964393 327
342 3300031616 Ga0307508_10000926 Ga0307508_1000092628 327
343 3300031730 Ga0307516_10191775 Ga0307516_101917752 327
344 3300033180 Ga0307510_10002234 Ga0307510_100022342 327
345 3300044658 Ga0466972_0000010 Ga0466972_0000010_126432_127418 327
346 3300044658 Ga0466972_0122304 Ga0466972_0122304_55_1041 327
347 3300044706 Ga0466964_0057289 Ga0466964_0057289_377_1363 327
348 3300044765 Ga0466970_0170214 Ga0466970_0170214_94_1080 327
349 3300045049 Ga0466959_0049484 Ga0466959_0049484_2043_3029 327
350 3300046460 Ga0495638_0081583 Ga0495638_0081583_573_1559 327
351 3300046471 Ga0495650_0000003 Ga0495650_0000003_835190_836176 327
352 3300046492 Ga0495585_0000771 Ga0495585_0000771_25089_26075 327
353 3300046501 Ga0495607_0140002 Ga0495607_0140002_137_1123 327
354 3300046506 Ga0495583_0030894 Ga0495583_0030894_1319_2305 327
355 3300046507 Ga0495606_0000116 Ga0495606_0000116_15015_16001 327
356 3300046512 Ga0495610_0011164 Ga0495610_0011164_1216_2202 327
357 3300046513 Ga0495616_0010178 Ga0495616_0010178_176_1162 327
358 3300046520 Ga0495637_0063632 Ga0495637_0063632_421_1407 327
359 3300046538 Ga0495609_0017858 Ga0495609_0017858_2168_3154 327
360 3300046558 Ga0495633_0010869 Ga0495633_0010869_1865_2851 327
361 3300046660 Ga0495625_0000219 Ga0495625_0000219_70815_71801 327
362 3300046660 Ga0495625_0052379 Ga0495625_0052379_1238_2227 327
363 3300046665 Ga0495661_0001366 Ga0495661_0001366_11493_12479 327
364 3300046665 Ga0495661_0023473 Ga0495661_0023473_115_1101 327
365 3300046665 Ga0495661_0025387 Ga0495661_0025387_1753_2739 327
366 3300046694 Ga0495649_0000037 Ga0495649_0000037_70614_71600 327
367 3300047443 Ga0495687_001565 Ga0495687_001565_3719_4705 327
368 3300047472 Ga0495686_0000004 Ga0495686_0000004_712061_713047 327
369 3300047472 Ga0495686_0061103 Ga0495686_0061103_284_1270 327
370 3300050493 nmdc:mga0k408_784_c1 nmdc:mga0k408_784_c1_4931_5920 327
371 3300053125 Ga0500618_009191 Ga0500618_009191_887_1873 327
372 3300053146 Ga0500588_0002998 Ga0500588_0002998_1065_2051 327
373 3300053153 Ga0500616_0006531 Ga0500616_0006531_2864_3850 327
374 3300053156 Ga0500622_0000915 Ga0500622_0000915_14634_15623 327
375 3300053177 Ga0500636_0023141 Ga0500636_0023141_1556_2542 327
376 3300003322 rootL2_10132642 rootL2_101326423 328
377 3300003323 rootH1_10048169 rootH1_100481694 328
378 3300028653 Ga0265323_10015106 Ga0265323_100151062 328
379 3300028786 Ga0307517_10029907 Ga0307517_100299075 328
380 3300031730 Ga0307516_10000959 Ga0307516_1000095914 328
381 3300046616 Ga0495668_0000616 Ga0495668_0000616_24834_25931 328
382 3300049680 Ga0501250_004298 Ga0501250_004298_285_1274 328
383 3300053104 Ga0500556_0009571 Ga0500556_0009571_1597_2694 328
384 3300053158 Ga0500627_0002684 Ga0500627_0002684_3564_4553 328
385 iso_pu_bacteria 2821136567 2821140266 328
386 iso_pu_bacteria 2904467357 2904472391 328
387 iso_pu_bacteria 2511231000 2511231440 329
388 iso_pu_bacteria 2513020052 2513236445 329
389 iso_pu_bacteria 2522125168 2522547824 329
390 iso_pu_bacteria 2551306352 2552748453 329
391 iso_pu_bacteria 2582581278 2585145480 329
392 iso_pu_bacteria 2582581281 2585158856 329
393 iso_pu_bacteria 2582581282 2585163144 329
394 iso_pu_bacteria 2585428045 2587677670 329
395 iso_pu_bacteria 2585428060 2587746820 329
396 iso_pu_bacteria 2585428115 2587943335 329
397 iso_pu_bacteria 2585428182 2588209587 329
398 iso_pu_bacteria 2585428183 2588213880 329
399 iso_pu_bacteria 2585428184 2588218503 329
400 iso_pu_bacteria 2585428185 2588225812 329
401 iso_pu_bacteria 2585428187 2588233837 329
402 iso_pu_bacteria 2588253712 2588444948 329
403 iso_pu_bacteria 2588254255 2590604478 329
404 iso_pu_bacteria 2588254257 2590612468 329
405 iso_pu_bacteria 2639762793 2640736041 329
406 iso_pu_bacteria 2643221667 2644370726 329
407 iso_pu_bacteria 2675903507 2678229281 329
408 iso_pu_bacteria 2721755487 2722729233 329
409 iso_pu_bacteria 2728369107 2729199195 329
410 iso_pu_bacteria 2738541273 2738701588 329
411 iso_pu_bacteria 2738541279 2738732259 329
412 iso_pu_bacteria 2738541283 2738757263 329
413 iso_pu_bacteria 2738541285 2738764824 329
414 iso_pu_bacteria 2738543007 2739213839 329
415 iso_pu_bacteria 2738543014 2739255886 329
416 iso_pu_bacteria 2738543023 2739300226 329
417 iso_pu_bacteria 2739367857 2740001474 329
418 iso_pu_bacteria 2739367858 2740006290 329
419 iso_pu_bacteria 2739367874 2740058389 329
420 iso_pu_bacteria 2751185877 2753671184 329
421 iso_pu_bacteria 2765235839 2765573295 329
422 iso_pu_bacteria 2772190705 2772605367 329
423 iso_pu_bacteria 2773857761 2774390192 329
424 iso_pu_bacteria 2773857770 2774437960 329
425 iso_pu_bacteria 2775506739 2775672518 329
426 iso_pu_bacteria 2816332188 2816873694 329
427 iso_pu_bacteria 2842083920 2842085089 329
428 iso_pu_bacteria 2842722452 2842722731 329
429 iso_pu_bacteria 2842909656 2842913433 329
430 iso_pu_bacteria 2849281842 2849285710 329
431 iso_pu_bacteria 2857618242 2857618417 329
432 iso_pu_bacteria 2857627736 2857628815 329
433 iso_pu_bacteria 2871720351 2871720746 329
434 iso_pu_bacteria 2889290771 2889291032 329
435 iso_pu_bacteria 2905999023 2905999636 329
436 iso_pu_bacteria 2919097161 2919100664 329
437 iso_pu_bacteria 2919182534 2919184547 329
438 iso_pu_bacteria 2919186247 2919188731 329
439 iso_pu_bacteria 2919399522 2919400480 329
440 iso_pu_bacteria 2919692658 2919697059 329
441 iso_pu_bacteria 2929921140 2929925775 329
442 iso_pu_bacteria 2945924605 2945927939 329
443 iso_pu_bacteria 2946019816 2946021943 329
444 iso_pu_bacteria 2954016120 2954016384 329
445 iso_pu_bacteria 2977243572 2977245713 329
446 iso_pu_bacteria 2984572630 2984575360 329
447 iso_pu_bacteria 2984572630 2984575361 329
448 iso_pu_bacteria 2984606641 2984608812 329
449 iso_pu_bacteria 2993372514 2993374135 329
450 iso_pu_bacteria 2993480792 2993481035 329
451 iso_pu_bacteria 8003151029 8003153248 329
452 3300005330 Ga0070690_100127628 Ga0070690_1001276281 330
453 3300005334 Ga0068869_100049154 Ga0068869_1000491543 330
454 3300005335 Ga0070666_10000174 Ga0070666_1000017415 330
455 3300005347 Ga0070668_100113403 Ga0070668_1001134032 330
456 3300005367 Ga0070667_100142098 Ga0070667_1001420982 330
457 3300005616 Ga0068852_100015157 Ga0068852_1000151572 330
458 3300005617 Ga0068859_100001134 Ga0068859_10000113413 330
459 3300005834 Ga0068851_10060615 Ga0068851_100606152 330
460 3300005841 Ga0068863_100025030 Ga0068863_1000250303 330
461 3300005842 Ga0068858_100006604 Ga0068858_1000066044 330
462 3300005843 Ga0068860_100024943 Ga0068860_1000249433 330
463 3300006931 Ga0097620_100001134 Ga0097620_10000113416 330
464 3300009098 Ga0105245_10041124 Ga0105245_100411243 330
465 3300009101 Ga0105247_10040956 Ga0105247_100409563 330
466 3300009174 Ga0105241_10002072 Ga0105241_100020729 330
467 3300009545 Ga0105237_10008058 Ga0105237_100080588 330
468 3300009553 Ga0105249_10007645 Ga0105249_100076453 330
469 3300011119 Ga0105246_10006728 Ga0105246_100067283 330
470 3300013296 Ga0157374_10234627 Ga0157374_102346272 330
471 3300013306 Ga0163162_10004463 Ga0163162_100044638 330
472 3300014968 Ga0157379_10080993 Ga0157379_100809932 330
473 3300014969 Ga0157376_10084223 Ga0157376_100842232 330
474 3300025903 Ga0207680_10001491 Ga0207680_100014918 330
475 3300025914 Ga0207671_10009391 Ga0207671_100093913 330
476 3300025931 Ga0207644_10022476 Ga0207644_100224762 330
477 3300025942 Ga0207689_10037062 Ga0207689_100370622 330
478 3300025961 Ga0207712_10018768 Ga0207712_100187683 330
479 3300025972 Ga0207668_10260329 Ga0207668_102603292 330
480 3300025986 Ga0207658_10016984 Ga0207658_100169843 330
481 3300026088 Ga0207641_10001176 Ga0207641_1000117613 330
482 3300028381 Ga0268264_10005699 Ga0268264_100056992 330
483 3300044658 Ga0466972_0000027 Ga0466972_0000027_132298_133293 331
484 3300044765 Ga0466970_0000405 Ga0466970_0000405_866_1861 331
485 3300003203 JGI25406J46586_10040573 JGI25406J46586_100405731 332
486 3300003316 rootH1_10084445 rootH1_100844452 332
487 3300003323 rootH1_10081119 rootH1_100811192 332
488 3300005327 Ga0070658_10225671 Ga0070658_102256712 332
489 3300005336 Ga0070680_100022362 Ga0070680_1000223623 332
490 3300005458 Ga0070681_10015115 Ga0070681_100151152 332
491 3300005458 Ga0070681_10273117 Ga0070681_102731172 332
492 3300005530 Ga0070679_100064512 Ga0070679_1000645122 332
493 3300005539 Ga0068853_100183632 Ga0068853_1001836321 332
494 3300005548 Ga0070665_100000006 Ga0070665_100000006287 332
495 3300005563 Ga0068855_100130904 Ga0068855_1001309043 332
496 3300005563 Ga0068855_100594950 Ga0068855_1005949501 332
497 3300005614 Ga0068856_100133388 Ga0068856_1001333881 332
498 3300005616 Ga0068852_100325910 Ga0068852_1003259102 332
499 3300005719 Ga0068861_100319800 Ga0068861_1003198001 332
500 3300005843 Ga0068860_100016689 Ga0068860_1000166893 332
501 3300005985 Ga0081539_10000147 Ga0081539_1000014735 332
502 3300009174 Ga0105241_10004327 Ga0105241_100043274 332
503 3300009176 Ga0105242_10101430 Ga0105242_101014302 332
504 3300010375 Ga0105239_10031149 Ga0105239_100311495 332
505 3300013100 Ga0157373_10008339 Ga0157373_100083396 332
506 3300013102 Ga0157371_10023778 Ga0157371_100237782 332
507 3300013105 Ga0157369_10000033 Ga0157369_100000331 332
508 3300013105 Ga0157369_10079919 Ga0157369_100799193 332
509 3300014326 Ga0157380_10000947 Ga0157380_1000094716 332
510 3300015265 Ga0182005_1000023 Ga0182005_1000023211 332
511 3300025302 Ga0207426_1000052 Ga0207426_100005285 332
512 3300025302 Ga0207426_1007449 Ga0207426_10074493 332
513 3300025912 Ga0207707_10068888 Ga0207707_100688882 332
514 3300025912 Ga0207707_10229243 Ga0207707_102292431 332
515 3300025921 Ga0207652_10004883 Ga0207652_100048835 332
516 3300025949 Ga0207667_10534462 Ga0207667_105344621 332
517 3300026142 Ga0207698_10039738 Ga0207698_100397384 332
518 3300028379 Ga0268266_10000010 Ga0268266_10000010368 332
519 3300028381 Ga0268264_10011858 Ga0268264_100118588 332
520 3300049574 Ga0501038_0032093 Ga0501038_0032093_870_1874 332
521 3300049822 Ga0501035_0266402 Ga0501035_0266402_89_1093 332
522 3300049823 Ga0501044_0080712 Ga0501044_0080712_81_1085 332
523 3300049823 Ga0501044_0324314 Ga0501044_0324314_435_1433 332
524 iso_pu_bacteria 2818991442 2819572366 332
525 2162886007 SwRhRL2b_contig_301064 SwRhRL2b_0634.00006890 333
526 3300001979 JGI24740J21852_10003561 JGI24740J21852_100035612 333
527 3300002738 JGI25154J39366_1000025 JGI25154J39366_100002567 333
528 3300003215 JGI25153J46596_10003683 JGI25153J46596_1000368312 333
529 3300003320 rootH2_10050819 rootH2_100508192 333
530 3300003320 rootH2_10054169 rootH2_1005416915 333
531 3300003320 rootH2_10245769 rootH2_102457692 333
532 3300003322 rootL2_10009807 rootL2_100098074 333
533 3300003323 rootH1_10006845 rootH1_100068454 333
534 3300003323 rootH1_10017957 rootH1_100179576 333
535 3300003354 JGI25160J50197_1004797 JGI25160J50197_10047973 333
536 3300003761 Ga0055535_1001728 Ga0055535_10017286 333
537 3300003856 Ga0058692_1000007 Ga0058692_1000007145 333
538 3300005272 Ga0065703_1000113 Ga0065703_100011367 333
539 3300005288 Ga0065714_10002864 Ga0065714_1000286425 333
540 3300005288 Ga0065714_10002993 Ga0065714_100029932 333
541 3300005288 Ga0065714_10078522 Ga0065714_100785223 333
542 3300005288 Ga0065714_10083886 Ga0065714_100838861 333
543 3300005288 Ga0065714_10084831 Ga0065714_100848312 333
544 3300005288 Ga0065714_10136971 Ga0065714_101369711 333
545 3300005289 Ga0065704_10000229 Ga0065704_1000022926 333
546 3300005289 Ga0065704_10004724 Ga0065704_100047242 333
547 3300005289 Ga0065704_10015826 Ga0065704_100158262 333
548 3300005289 Ga0065704_10087427 Ga0065704_100874272 333
549 3300005289 Ga0065704_10169842 Ga0065704_101698421 333
550 3300005327 Ga0070658_10228455 Ga0070658_102284552 333
551 3300005329 Ga0070683_100020914 Ga0070683_1000209144 333
552 3300005336 Ga0070680_100082320 Ga0070680_1000823202 333
553 3300005337 Ga0070682_100000605 Ga0070682_10000060514 333
554 3300005353 Ga0070669_100006597 Ga0070669_1000065977 333
555 3300005455 Ga0070663_100092934 Ga0070663_1000929343 333
556 3300005471 Ga0070698_100065707 Ga0070698_1000657073 333
557 3300005535 Ga0070684_100040721 Ga0070684_1000407212 333
558 3300005539 Ga0068853_100256855 Ga0068853_1002568552 333
559 3300005548 Ga0070665_100001787 Ga0070665_10000178725 333
560 3300005577 Ga0068857_100009540 Ga0068857_10000954010 333
561 3300005614 Ga0068856_100016408 Ga0068856_1000164087 333
562 3300005843 Ga0068860_100000005 Ga0068860_100000005227 333
563 3300005843 Ga0068860_100120760 Ga0068860_1001207603 333
564 3300006195 Ga0075366_10022084 Ga0075366_100220841 333
565 3300006195 Ga0075366_10081002 Ga0075366_100810022 333
566 3300006931 Ga0097620_100411609 Ga0097620_1004116092 333
567 3300009036 Ga0105244_10000007 Ga0105244_10000007205 333
568 3300009036 Ga0105244_10000050 Ga0105244_1000005057 333
569 3300009036 Ga0105244_10001222 Ga0105244_100012221 333
570 3300009036 Ga0105244_10104398 Ga0105244_101043982 333
571 3300009092 Ga0105250_10012506 Ga0105250_100125062 333
572 3300009092 Ga0105250_10013417 Ga0105250_100134173 333
573 3300009093 Ga0105240_10001071 Ga0105240_1000107114 333
574 3300009093 Ga0105240_10003601 Ga0105240_1000360115 333
575 3300009101 Ga0105247_10000560 Ga0105247_1000056017 333
576 3300009101 Ga0105247_10018189 Ga0105247_100181893 333
577 3300009147 Ga0114129_10016698 Ga0114129_100166985 333
578 3300009148 Ga0105243_10000012 Ga0105243_10000012110 333
579 3300009148 Ga0105243_10000052 Ga0105243_1000005233 333
580 3300009148 Ga0105243_10003425 Ga0105243_100034253 333
581 3300009148 Ga0105243_10149190 Ga0105243_101491901 333
582 3300009174 Ga0105241_10000646 Ga0105241_100006468 333
583 3300009545 Ga0105237_10019455 Ga0105237_100194556 333
584 3300009553 Ga0105249_10146373 Ga0105249_101463732 333
585 3300010375 Ga0105239_10003342 Ga0105239_100033427 333
586 3300013100 Ga0157373_10000261 Ga0157373_1000026124 333
587 3300013102 Ga0157371_10000009 Ga0157371_1000000992 333
588 3300013102 Ga0157371_10001830 Ga0157371_1000183016 333
589 3300013102 Ga0157371_10016929 Ga0157371_100169292 333
590 3300013104 Ga0157370_10007408 Ga0157370_100074087 333
591 3300013104 Ga0157370_10052976 Ga0157370_100529764 333
592 3300013105 Ga0157369_10018848 Ga0157369_100188484 333
593 3300013306 Ga0163162_10000854 Ga0163162_1000085417 333
594 3300013307 Ga0157372_10066801 Ga0157372_100668013 333
595 3300013308 Ga0157375_10000222 Ga0157375_1000022219 333
596 3300014326 Ga0157380_10003364 Ga0157380_1000336410 333
597 3300014326 Ga0157380_10494883 Ga0157380_104948831 333
598 3300014497 Ga0182008_10000237 Ga0182008_100002377 333
599 3300015261 Ga0182006_1000012 Ga0182006_100001295 333
600 3300015261 Ga0182006_1001110 Ga0182006_100111014 333
601 3300015262 Ga0182007_10000015 Ga0182007_10000015148 333
602 3300015682 Ga0183373_1013 Ga0183373_101317 333
603 3300017792 Ga0163161_10000012 Ga0163161_10000012249 333
604 3300017792 Ga0163161_10000178 Ga0163161_1000017813 333
605 3300017792 Ga0163161_10001618 Ga0163161_100016182 333
606 3300025242 Ga0209258_100161 Ga0209258_100161123 333
607 3300025246 Ga0209646_1000037 Ga0209646_100003768 333
608 3300025250 Ga0209026_1000819 Ga0209026_10008193 333
609 3300025254 Ga0209148_1000161 Ga0209148_100016192 333
610 3300025292 Ga0209676_1000558 Ga0209676_100055839 333
611 3300025302 Ga0207426_1000959 Ga0207426_100095923 333
612 3300025711 Ga0207696_1001450 Ga0207696_100145014 333
613 3300025711 Ga0207696_1001460 Ga0207696_100146012 333
614 3300025711 Ga0207696_1003489 Ga0207696_10034893 333
615 3300025728 Ga0207655_1000066 Ga0207655_100006661 333
616 3300025728 Ga0207655_1000423 Ga0207655_100042331 333
617 3300025728 Ga0207655_1000480 Ga0207655_100048037 333
618 3300025728 Ga0207655_1000941 Ga0207655_100094132 333
619 3300025735 Ga0207713_1002097 Ga0207713_10020976 333
620 3300025735 Ga0207713_1002622 Ga0207713_100262216 333
621 3300025735 Ga0207713_1004893 Ga0207713_100489311 333
622 3300025900 Ga0207710_10000018 Ga0207710_10000018122 333
623 3300025913 Ga0207695_10013245 Ga0207695_100132457 333
624 3300025914 Ga0207671_10011734 Ga0207671_100117346 333
625 3300025919 Ga0207657_10096489 Ga0207657_100964892 333
626 3300025921 Ga0207652_10157306 Ga0207652_101573062 333
627 3300025923 Ga0207681_10023476 Ga0207681_100234763 333
628 3300025935 Ga0207709_10000006 Ga0207709_10000006633 333
629 3300025935 Ga0207709_10000016 Ga0207709_10000016268 333
630 3300025935 Ga0207709_10002381 Ga0207709_100023813 333
631 3300025944 Ga0207661_10004101 Ga0207661_100041016 333
632 3300025944 Ga0207661_10004101 Ga0207661_100041017 333
633 3300025961 Ga0207712_10088846 Ga0207712_100888461 333
634 3300026041 Ga0207639_10118270 Ga0207639_101182702 333
635 3300026067 Ga0207678_10250732 Ga0207678_102507321 333
636 3300026078 Ga0207702_10067209 Ga0207702_100672092 333
637 3300026078 Ga0207702_10095754 Ga0207702_100957544 333
638 3300026089 Ga0207648_10028421 Ga0207648_100284212 333
639 3300026116 Ga0207674_10058405 Ga0207674_100584055 333
640 3300026116 Ga0207674_10069769 Ga0207674_100697693 333
641 3300026116 Ga0207674_10110220 Ga0207674_101102202 333
642 3300026121 Ga0207683_10269286 Ga0207683_102692861 333
643 3300027312 Ga0209371_1000024 Ga0209371_1000024210 333
644 3300028379 Ga0268266_10001914 Ga0268266_100019148 333
645 3300028380 Ga0268265_10406664 Ga0268265_104066641 333
646 3300028381 Ga0268264_10000012 Ga0268264_10000012209 333
647 3300028381 Ga0268264_10045884 Ga0268264_100458841 333
648 3300030500 Ga0268256_1000026 Ga0268256_1000026210 333
649 3300030732 Ga0316176_1221375 Ga0316176_12213752 333
650 3300030742 Ga0316183_1025751 Ga0316183_102575116 333
651 3300030744 Ga0316181_1238304 Ga0316181_12383042 333
652 3300031507 Ga0307509_10208674 Ga0307509_102086742 333
653 3300031731 Ga0307405_10000038 Ga0307405_1000003821 333
654 3300031824 Ga0307413_10000190 Ga0307413_100001908 333
655 3300031903 Ga0307407_10000005 Ga0307407_10000005121 333
656 3300031911 Ga0307412_10000007 Ga0307412_10000007324 333
657 3300031911 Ga0307412_10000045 Ga0307412_10000045127 333
658 3300031911 Ga0307412_10000175 Ga0307412_1000017536 333
659 3300031995 Ga0307409_100014401 Ga0307409_1000144012 333
660 3300032002 Ga0307416_100000001 Ga0307416_10000000162 333
661 3300032002 Ga0307416_100000003 Ga0307416_100000003229 333
662 3300032004 Ga0307414_10000722 Ga0307414_100007225 333
663 3300032004 Ga0307414_10001496 Ga0307414_1000149610 333
664 3300032004 Ga0307414_10003547 Ga0307414_100035478 333
665 3300032004 Ga0307414_10011808 Ga0307414_100118082 333
666 3300032004 Ga0307414_10081914 Ga0307414_100819143 333
667 3300032004 Ga0307414_10208661 Ga0307414_102086612 333
668 3300032005 Ga0307411_10000007 Ga0307411_10000007141 333
669 3300041404 Ga0439436_0002217 Ga0439436_0002217_534_1580 333
670 3300041404 Ga0439436_0016924 Ga0439436_0016924_735_1736 333
671 3300041411 Ga0439466_0002102 Ga0439466_0002102_2397_3398 333
672 3300041413 Ga0439465_0001390 Ga0439465_0001390_2742_3743 333
673 3300041459 Ga0451800_0887562 Ga0451800_0887562_449_1456 333
674 3300042002 Ga0439442_008724 Ga0439442_008724_767_1774 333
675 3300042004 Ga0439445_0001732 Ga0439445_0001732_1831_2832 333
676 3300042131 Ga0450894_004765 Ga0450894_004765_697_1704 333
677 3300044656 Ga0466969_0000207 Ga0466969_0000207_6538_7545 333
678 3300044658 Ga0466972_0000009 Ga0466972_0000009_95001_96011 333
679 3300044658 Ga0466972_0010416 Ga0466972_0010416_1354_2355 333
680 3300044658 Ga0466972_0010519 Ga0466972_0010519_2896_3903 333
681 3300044684 Ga0466966_0132959 Ga0466966_0132959_167_1174 333
682 3300044735 Ga0466968_0015936 Ga0466968_0015936_445_1452 333
683 3300044735 Ga0466968_0062379 Ga0466968_0062379_345_1346 333
684 3300045049 Ga0466959_0000236 Ga0466959_0000236_17609_18616 333
685 3300046453 Ga0495627_000002 Ga0495627_000002_238439_239440 333
686 3300046453 Ga0495627_022153 Ga0495627_022153_391_1392 333
687 3300046460 Ga0495638_0046148 Ga0495638_0046148_141_1142 333
688 3300046500 Ga0495596_0003434 Ga0495596_0003434_647_1648 333
689 3300046507 Ga0495606_0020040 Ga0495606_0020040_2127_3128 333
690 3300046512 Ga0495610_0000009 Ga0495610_0000009_122688_123719 333
691 3300046519 Ga0495632_0001668 Ga0495632_0001668_16626_17627 333
692 3300046519 Ga0495632_0005176 Ga0495632_0005176_2521_3522 333
693 3300046524 Ga0495648_0009686 Ga0495648_0009686_3161_4162 333
694 3300046525 Ga0495663_0000315 Ga0495663_0000315_537_1538 333
695 3300046530 Ga0495654_0000001 Ga0495654_0000001_1273431_1274432 333
696 3300046558 Ga0495633_0000002 Ga0495633_0000002_221186_222187 333
697 3300046558 Ga0495633_0000894 Ga0495633_0000894_7314_8315 333
698 3300046558 Ga0495633_0091543 Ga0495633_0091543_273_1274 333
699 3300046660 Ga0495625_0000899 Ga0495625_0000899_6680_7681 333
700 3300046660 Ga0495625_0072031 Ga0495625_0072031_805_1890 333
701 3300047443 Ga0495687_000009 Ga0495687_000009_138597_139703 333
702 3300047472 Ga0495686_0000095 Ga0495686_0000095_125921_126922 333
703 3300047472 Ga0495686_0009867 Ga0495686_0009867_1420_2421 333
704 3300048905 Ga0496102_0083518 Ga0496102_0083518_1260_2261 333
705 3300048906 Ga0496103_0021329 Ga0496103_0021329_712_1713 333
706 3300048919 Ga0496116_0000022 Ga0496116_0000022_48998_49999 333
707 3300048919 Ga0496116_0009389 Ga0496116_0009389_4135_5169 333
708 3300048920 Ga0496117_0000074 Ga0496117_0000074_52329_53330 333
709 3300048920 Ga0496117_0001473 Ga0496117_0001473_13608_14642 333
710 3300048921 Ga0496118_0001613 Ga0496118_0001613_2027_3028 333
711 3300048921 Ga0496118_0046262 Ga0496118_0046262_1236_2270 333
712 3300048922 Ga0496119_0000017 Ga0496119_0000017_179320_180321 333
713 3300048924 Ga0496121_0063112 Ga0496121_0063112_253_1254 333
714 3300048925 Ga0496122_0000159 Ga0496122_0000159_18019_19020 333
715 3300048925 Ga0496122_0000354 Ga0496122_0000354_66395_67396 333
716 3300048925 Ga0496122_0000357 Ga0496122_0000357_54382_55383 333
717 3300048925 Ga0496122_0000591 Ga0496122_0000591_30111_31112 333
718 3300048925 Ga0496122_0002282 Ga0496122_0002282_21552_22553 333
719 3300048925 Ga0496122_0002637 Ga0496122_0002637_2527_3561 333
720 3300048925 Ga0496122_0005231 Ga0496122_0005231_10608_11609 333
721 3300048926 Ga0496123_0001157 Ga0496123_0001157_5250_6251 333
722 3300048926 Ga0496123_0002468 Ga0496123_0002468_17335_18369 333
723 3300048926 Ga0496123_0003951 Ga0496123_0003951_14359_15360 333
724 3300048926 Ga0496123_0010609 Ga0496123_0010609_154_1155 333
725 3300048926 Ga0496123_0047728 Ga0496123_0047728_730_1731 333
726 3300048927 Ga0496124_0015613 Ga0496124_0015613_2266_3267 333
727 3300048928 Ga0496125_0001036 Ga0496125_0001036_8094_9095 333
728 3300048928 Ga0496125_0001152 Ga0496125_0001152_2244_3245 333
729 3300048928 Ga0496125_0003480 Ga0496125_0003480_15875_16876 333
730 3300048928 Ga0496125_0011088 Ga0496125_0011088_5556_6557 333
731 3300048928 Ga0496125_0011573 Ga0496125_0011573_4183_5184 333
732 3300048928 Ga0496125_0067715 Ga0496125_0067715_76_1110 333
733 3300048928 Ga0496125_0160243 Ga0496125_0160243_442_1443 333
734 3300048929 Ga0496126_0001468 Ga0496126_0001468_32403_33404 333
735 3300049571 Ga0501034_0082568 Ga0501034_0082568_1303_2307 333
736 3300049571 Ga0501034_0188035 Ga0501034_0188035_895_1899 333
737 3300049581 Ga0501047_0228685 Ga0501047_0228685_549_1559 333
738 3300049679 Ga0501249_000001 Ga0501249_000001_179592_180593 333
739 3300049679 Ga0501249_001838 Ga0501249_001838_1465_2466 333
740 3300049758 Ga0501241_000254 Ga0501241_000254_4313_5314 333
741 3300049763 Ga0501266_000010 Ga0501266_000010_100410_101411 333
742 3300049766 Ga0501269_000185 Ga0501269_000185_13153_14154 333
743 3300050493 nmdc:mga0k408_25502_c1 nmdc:mga0k408_25502_c1_780_1787 333
744 3300050507 nmdc:mga05p37_11042_c1 nmdc:mga05p37_11042_c1_2665_3672 333
745 3300053086 Ga0500578_0000386 Ga0500578_0000386_22072_23082 333
746 3300053092 Ga0500583_0000035 Ga0500583_0000035_6804_7811 333
747 3300053092 Ga0500583_0016285 Ga0500583_0016285_1546_2547 333
748 3300053096 Ga0500641_0017392 Ga0500641_0017392_379_1380 333
749 3300053104 Ga0500556_0055830 Ga0500556_0055830_419_1420 333
750 3300053131 Ga0500652_042276 Ga0500652_042276_513_1520 333
751 3300053134 Ga0500658_0000019 Ga0500658_0000019_130728_131729 333
752 3300053156 Ga0500622_0002688 Ga0500622_0002688_7014_8015 333
753 3300053156 Ga0500622_0038362 Ga0500622_0038362_18_1025 333
754 3300053727 Ga0500611_011417 Ga0500611_011417_304_1311 333
755 iso_pu_bacteria 2842903701 2842907099 333
756 iso_pu_bacteria 2939664404 2939667114 333

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

58

357

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9338 1 312
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.9047 3 309
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.9028 2 312
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9018 1 312
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.8987 1 321
ID Description Score Start End Superfamily
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9439 1 325 3.20.20.100
3v0uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9338 1 312 3.20.20.100
af_A0A1D6KUU8_358_629_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9282 73 331 3.20.20.100
af_P49249_9_269_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9162 3 254 3.20.20.100
af_Q09923_6_337_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9146 4 333 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A317LPZ2-F1-model_v4 Aryl-alcohol dehydrogenase-like predicted oxidoreductase 0.9754 1 333 GO:0004033
GO:0005737
AF-A0A1J5PSL3-F1-model_v4 General stress protein 69 (EC 1.1.1.-) 0.9704 142 333 GO:0004033
GO:0005737
AF-A0A317LPZ2-F1-model_v4 Aryl-alcohol dehydrogenase-like predicted oxidoreductase 0.9695 1 333 GO:0004033
GO:0005737
AF-Q0JE28-F1-model_v4 Os04g0338100 protein 0.968 110 194
AF-A0A429MRA5-F1-model_v4 Aldo/keto reductase 0.9653 74 333 GO:0004033
GO:0005737

Feature Viewer

pLDDT pTM Quality
93.13 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map