F479366

General Info

Members Datasets Scaffolds Average Seq Length
756 562 481 436

Family's Representative Sequence

Representative Sequence 3300060353|Ga0501082_0001805|Ga0501082_0001805_17244_18740
Length 498
Sequence MSSCSVRPRFAPRSPRPRAASRRRIARADTDARSVVESAASFHARGVPNVDNAISELLSIAAVFLLVFANGFFVAAEFSLVAVRRSRVTELVGEGRRNARALQHAVDRLDASLAATQLGITISSLALGWIGEPALAHLVEPLLAPLGAWAESASHGISVAIAFIVITALHIVLGELAPKSLALQRSEGTALVIVRPLALFLFVFRPAISLLNGLGNGVLRLFGLQPGSGEESLHSPDELKLLVAESRRAGLLQRAQQEVVERTFNLGARRVRDIMTTRPDVEWIDADDDRATMLAAIRRCGHEQMLVGRGSIDDVLGVLSKRDLLDRLLDGGDADPLALVAEPLILHEATPILKVLEQFRTRPVSMALVTDDYGTLGGILTRTDLLEAIAGELRDADDEDAEIVARDDGSFLIDGLTAVAGVFDRLGIRRWPDVRDFNTIAGFALQQFGRIPEVGEHVDWEGWRFEIVDRDGNRIDKMLVAKLPESRDESEDDADTSG

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
7 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
8 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
9 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
10 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
11 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
12 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
13 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
14 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
15 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
16 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
17 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
18 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
19 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
20 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
21 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
22 2516143018 Ensifer sp. BR816 Isolate Nodule
23 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
24 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
25 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
26 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
27 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
28 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
29 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
30 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
31 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
32 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
33 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
34 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
35 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
36 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
37 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
38 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
39 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
40 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
41 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
42 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
43 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
44 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
45 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
46 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
47 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
48 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
49 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
50 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
51 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
52 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
53 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
54 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
55 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
56 2643221655 Ensifer sp. Root1252 Isolate Unclassified
57 2643221659 Ensifer sp. Root127 Isolate Unclassified
58 2643221698 Ensifer sp. Root142 Isolate Unclassified
59 2643221712 Ensifer sp. Root258 Isolate Unclassified
60 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
61 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
62 2718217882 Rhizobium sp. N741 Isolate Nodule
63 2718217927 Rhizobium sp. N324 Isolate Nodule
64 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
65 2718218009 Rhizobium sp. N561 Isolate Nodule
66 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
67 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
68 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
69 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
70 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
71 2718218363 Rhizobium sp. N113 Isolate Nodule
72 2718218365 Rhizobium sp. N731 Isolate Nodule
73 2718218366 Rhizobium sp. N621 Isolate Nodule
74 2718218423 Rhizobium sp. N941 Isolate Nodule
75 2721755514 Rhizobium sp. N6212 Isolate Nodule
76 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
77 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
78 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
79 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
80 2721755809 Rhizobium sp. N541 Isolate Nodule
81 2721755810 Rhizobium sp. N871 Isolate Nodule
82 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
83 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
84 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
85 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
86 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
87 2728369365 Rhizobium sp. N1341 Isolate Nodule
88 2728369397 Rhizobium sp. N1314 Isolate Nodule
89 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
90 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
91 2738543024 Aminobacter sp. AP02 Isolate Unclassified
92 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
93 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
94 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
95 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
96 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
97 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
98 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
99 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
100 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
101 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
102 2791355256 Rhizobium sp. M10 Isolate Nodule
103 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
104 2791355260 Rhizobium sp. L9 Isolate Nodule
105 2791355261 Rhizobium sp. J15 Isolate Nodule
106 2791355262 Rhizobium sp. M1 Isolate Nodule
107 2791355263 Rhizobium chutanense C5 Isolate Nodule
108 2791355264 Rhizobium sp. S9 Isolate Nodule
109 2791355265 Rhizobium sp. H4 Isolate Nodule
110 2791355266 Rhizobium sp. L43 Isolate Nodule
111 2791355267 Rhizobium sp. L18 Isolate Nodule
112 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
113 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
114 2802429633 Rhizobium anhuiense J3 Isolate Nodule
115 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
116 2802429637 Rhizobium anhuiense C15 Isolate Nodule
117 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
118 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
119 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
120 2818991467 Bosea vestrisii 3192 Isolate Unclassified
121 2831426010 Nostoc sp. 106C Isolate Unclassified
122 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
123 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
124 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
125 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
126 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
127 2838048938 Rhizobium pisi 27/80 Isolate Nodule
128 2838061910 Rhizobium phaseoli L15 Isolate Nodule
129 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
130 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
131 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
132 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
133 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
134 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
135 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
136 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
137 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
138 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
139 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
140 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
141 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
142 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
143 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
144 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
145 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
146 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
147 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
148 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
149 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
150 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
151 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
152 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
153 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
154 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
155 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
156 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
157 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
158 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
159 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
160 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
161 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
162 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
163 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
164 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
165 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
166 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
167 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
168 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
169 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
170 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
171 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
172 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
173 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
174 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
175 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
176 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
177 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
178 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
179 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
180 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
181 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
182 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
183 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
184 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
185 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
186 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
187 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
188 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
189 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
190 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
191 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
192 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
193 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
194 2849660919 Nostoc sp. T09 Isolate Unclassified
195 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
196 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
197 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
198 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
199 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
200 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
201 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
202 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
203 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
204 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
205 2909042592 Labrys sp. LIt4 Isolate Nodule
206 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
207 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
208 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
209 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
210 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
211 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
212 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
213 2933599457 Rhizobium phaseoli M3 Isolate Nodule
214 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
215 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
216 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
217 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
218 2936381700 Rhizobium chutanense C16 Isolate Unclassified
219 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
220 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
221 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
222 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
223 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
224 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
225 2996893221 Rhizobium sp. R635 Isolate Nodule
226 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
227 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
228 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
229 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
230 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
231 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
232 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
233 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
234 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
235 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
236 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
237 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
238 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
239 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
240 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
241 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
242 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
243 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
244 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
245 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
246 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
247 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
248 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
249 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
250 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
251 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
252 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
253 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
254 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
255 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
256 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
257 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
258 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
259 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
260 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
261 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
262 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
263 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
264 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
265 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
266 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
267 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
268 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
269 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
270 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
271 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
272 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
273 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
274 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
275 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
276 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
277 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
278 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
279 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
280 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
281 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
282 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
283 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
284 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
285 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
286 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
287 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
288 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
289 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
290 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
291 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
292 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
293 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
294 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
295 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
296 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
297 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
298 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
299 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
300 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
301 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
302 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
303 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
304 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
305 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
306 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
307 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
308 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
309 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
310 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
311 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
312 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
313 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
314 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
315 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
316 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
317 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
318 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
319 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
320 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
321 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
322 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
323 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
324 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
325 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
326 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
327 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
328 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
329 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
330 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
331 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
332 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
333 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
334 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
335 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
336 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
337 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
362 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
363 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
366 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
367 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
368 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
369 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
370 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
371 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
372 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
373 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
374 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
375 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
376 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
377 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
378 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
379 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
380 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
381 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
382 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
383 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
384 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
385 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
386 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
387 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
388 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
389 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
390 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
391 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
392 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
393 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
394 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
395 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
396 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
397 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
398 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
399 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
400 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
401 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
402 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
403 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
404 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
405 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
406 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
407 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
408 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
409 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
410 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
411 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
412 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
413 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
414 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
415 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
416 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
417 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
418 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
419 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
420 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
421 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
422 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
423 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
424 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
425 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
426 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
427 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
428 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
429 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
430 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
431 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
432 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
433 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
434 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
435 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
436 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
437 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
438 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
439 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
440 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
441 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
442 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
443 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
444 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
446 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
447 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
448 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
449 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
450 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
451 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
452 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
453 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
454 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
456 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
457 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
458 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
459 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
460 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
462 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
463 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
464 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
465 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
466 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
467 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
468 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
469 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
470 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
471 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
472 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
473 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
474 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
475 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
476 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
477 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
478 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
479 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
480 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
481 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
482 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
483 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
484 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
485 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
486 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
487 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
488 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
489 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
490 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
491 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
492 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
493 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
494 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
495 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
496 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
497 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
498 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
499 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
500 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
501 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
502 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
503 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
504 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
505 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
506 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
507 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
508 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
509 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
510 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
511 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
512 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
513 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
514 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
515 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
516 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
517 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
518 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
519 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
520 641522639 Methylobacterium sp. 4-46 Isolate Nodule
521 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
522 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
523 8005275841 Rhizobium sp. N4311 Isolate Nodule
524 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
525 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
526 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
527 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
528 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
529 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
530 8005382845 Rhizobium sp. R634 Isolate Nodule
531 8005395548 Rhizobium sp. R339 Isolate Nodule
532 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
533 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
534 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
535 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
536 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
537 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
538 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
539 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
540 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
541 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
542 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
543 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
544 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
545 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
546 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
547 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
548 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
549 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
550 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
551 8018176218 Rhizobium sp. N122 Isolate Nodule
552 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
553 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
554 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
555 8024501048 Rhizobium sp. H4 Isolate Nodule
556 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
557 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
558 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
559 8056382006 Rhizobium croatiense 13T Isolate Nodule
560 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
561 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule
562 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 63.36
Metatranscriptomes 0.26
Isolates 36.38

Biome Distribution

Category Percentage (%)
Aerial Root 0.26
Bulb 0
Endosphere 9.92
Nodule 26.06
Rhizoplane 1.19
Rhizosphere 50.66
Stem 0
Stem Tuber 0
Unclassified 11.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNBas_1000573 3300000531 Bacteria 1664
2 JGI24740J21852_10001797 3300001979 Bacteria 9835
3 JGI25155J39150_1000006 3300002704 Bacteria 244109
4 JGI25156J39149_1000105 3300002705 Bacteria 61721
5 JGI25162J39368_1000266 3300002737 Bacteria 50234
6 JGI25162J39368_1000694 3300002737 Bacteria 23425
7 JGI25154J39366_1000055 3300002738 Bacteria 115597
8 JGI25154J39366_1000085 3300002738 Bacteria 87994
9 JGI25157J39369_1000782 3300002741 Bacteria 16312
10 JGI25157J39369_1001299 3300002741 Bacteria 10005
11 JGI25159J45721_1003157 3300002987 Bacteria 5930
12 JGI25151J46595_10000723 3300003187 Bacteria 27441
13 JGI25165J46597_1000028 3300003214 Bacteria 325146
14 JGI25165J46597_1000579 3300003214 Bacteria 32228
15 JGI25165J46597_1000786 3300003214 Bacteria 24098
16 JGI25165J46597_1005162 3300003214 Bacteria 2582
17 rootL2_10112396 3300003322 Bacteria 2429
18 rootH1_10013182 3300003323 Bacteria 4247
19 JGI25160J50197_1000053 3300003354 Bacteria 127632
20 JGI25160J50197_1000782 3300003354 Bacteria 17066
21 JGI25161J50226_1000039 3300003374 Bacteria 127632
22 JGI25161J50226_1004458 3300003374 Bacteria 2926
23 Ga0055535_1002072 3300003761 Bacteria 8013
24 Ga0055542_1000637 3300003762 Bacteria 29408
25 Ga0055526_1007484 3300003771 Bacteria 5660
26 Ga0055528_1000331 3300003790 Bacteria 39811
27 Ga0055540_1000508 3300003792 Bacteria 29469
28 Ga0055543_1000015 3300004625 Bacteria 177197
29 Ga0055543_1002085 3300004625 Bacteria 6961
30 Ga0065165_1000568 3300005262 Bacteria 54881
31 Ga0065712_10005803 3300005290 Bacteria 3873
32 Ga0065715_10144541 3300005293 Bacteria 1806
33 Ga0070670_100012940 3300005331 Bacteria 7144
34 Ga0070670_100088723 3300005331 Bacteria 2658
35 Ga0068869_100164561 3300005334 Bacteria 1729
36 Ga0070660_100088287 3300005339 Unclassified 2442
37 Ga0070668_100068317 3300005347 Bacteria 2762
38 Ga0070673_100004801 3300005364 Bacteria 8593
39 Ga0070688_100041762 3300005365 Bacteria 2817
40 Ga0070714_100071416 3300005435 Bacteria 3001
41 Ga0070700_100066774 3300005441 Bacteria 2284
42 Ga0070694_100168259 3300005444 Bacteria 1613
43 Ga0070708_100264862 3300005445 Bacteria 1616
44 Ga0070678_100018012 3300005456 Bacteria 4566
45 Ga0070707_100000311 3300005468 Bacteria 47815
46 Ga0070698_100141780 3300005471 Bacteria 2354
47 Ga0070699_100117102 3300005518 Bacteria 2342
48 Ga0068853_100025963 3300005539 Bacteria 4916
49 Ga0070696_100032609 3300005546 Bacteria 3574
50 Ga0070696_100162136 3300005546 Bacteria 1648
51 Ga0070665_100000062 3300005548 Bacteria 220304
52 Ga0070665_100031499 3300005548 Bacteria 5338
53 Ga0070665_100058339 3300005548 Bacteria 3870
54 Ga0068856_100035355 3300005614 Bacteria 4896
55 Ga0068859_100047771 3300005617 Bacteria 4300
56 Ga0068864_100018691 3300005618 Bacteria 5792
57 Ga0068858_100035682 3300005842 Bacteria 4611
58 Ga0068860_100091604 3300005843 Bacteria 2896
59 Ga0068862_100130067 3300005844 Bacteria 2226
60 Ga0081455_10002201 3300005937 Bacteria 23206
61 Ga0081538_10000940 3300005981 Bacteria 31406
62 Ga0081538_10007360 3300005981 Bacteria 9533
63 Ga0081538_10027369 3300005981 Unclassified 3955
64 Ga0081540_1006757 3300005983 Bacteria 8294
65 Ga0081540_1012046 3300005983 Bacteria 5723
66 Ga0081539_10001282 3300005985 Bacteria 44233
67 Ga0081539_10014005 3300005985 Bacteria 5977
68 Ga0075365_10000388 3300006038 Bacteria 16068
69 Ga0070712_100113269 3300006175 Bacteria 2028
70 Ga0075367_10001308 3300006178 Bacteria 10547
71 Ga0075369_10000195 3300006186 Bacteria 17558
72 Ga0075369_10018748 3300006186 Bacteria 2820
73 Ga0075366_10026651 3300006195 Bacteria 3387
74 Ga0097621_100000830 3300006237 Bacteria 21817
75 Ga0075370_10005893 3300006353 Bacteria 6128
76 Ga0075370_10039003 3300006353 Bacteria 2675
77 Ga0068871_100013903 3300006358 Bacteria 5985
78 Ga0075428_100005413 3300006844 Bacteria 14191
79 Ga0075434_100053103 3300006871 Bacteria 4027
80 Ga0075434_100189570 3300006871 Bacteria 2076
81 Ga0075429_100020373 3300006880 Bacteria 5753
82 Ga0097620_100047772 3300006931 Bacteria 4300
83 Ga0075435_100247909 3300007076 Bacteria 1516
84 Ga0105251_10092498 3300009011 Bacteria 1388
85 Ga0105244_10001313 3300009036 Bacteria 20331
86 Ga0105244_10050599 3300009036 Bacteria 2119
87 Ga0105240_10000027 3300009093 Bacteria 348486
88 Ga0105240_10083097 3300009093 Bacteria 3931
89 Ga0111539_10018085 3300009094 Bacteria 8732
90 Ga0111539_10052837 3300009094 Unclassified 4836
91 Ga0111539_10125168 3300009094 Bacteria 3012
92 Ga0111539_10137172 3300009094 Bacteria 2865
93 Ga0105247_10037197 3300009101 Bacteria 2970
94 Ga0105241_10030333 3300009174 Bacteria 4040
95 Ga0105248_10234943 3300009177 Bacteria 2064
96 Ga0105237_10003395 3300009545 Bacteria 18937
97 Ga0105238_10028931 3300009551 Bacteria 5644
98 Ga0105249_10084241 3300009553 Bacteria 2960
99 Ga0105249_10144657 3300009553 Bacteria 2283
100 Ga0123341_1000576 3300009765 Bacteria 23339
101 Ga0105239_10006404 3300010375 Bacteria 13670
102 Ga0105239_10010405 3300010375 Bacteria 10406
103 Ga0105239_10066579 3300010375 Bacteria 3957
104 Ga0105239_10177236 3300010375 Unclassified 2384
105 Ga0105239_10334535 3300010375 Bacteria 1708
106 Ga0157370_10036186 3300013104 Bacteria 4792
107 Ga0157374_10219244 3300013296 Unclassified 1866
108 Ga0157378_10054267 3300013297 Bacteria 3568
109 Ga0163162_10076836 3300013306 Bacteria 3402
110 Ga0157372_10381673 3300013307 Bacteria 1642
111 Ga0157375_10162492 3300013308 Bacteria 2376
112 Ga0163163_10151820 3300014325 Bacteria 2360
113 Ga0157380_10367686 3300014326 Bacteria 1352
114 Ga0157379_10048711 3300014968 Bacteria 3782
115 Ga0182007_10003280 3300015262 Bacteria 7687
116 Ga0182005_1004517 3300015265 Bacteria 4484
117 Ga0182005_1006088 3300015265 Bacteria 3719
118 Ga0214542_1023097 3300021321 Bacteria 3815
119 Ga0214543_1000005 3300021327 Bacteria 454523
120 Ga0209435_100011 3300025206 Bacteria 413027
121 Ga0209672_102283 3300025228 Bacteria 4911
122 Ga0209672_104514 3300025228 Bacteria 2572
123 Ga0209437_100033 3300025233 Bacteria 512520
124 Ga0209437_100036 3300025233 Bacteria 469153
125 Ga0209258_100265 3300025242 Bacteria 90172
126 Ga0209646_1000024 3300025246 Bacteria 413027
127 Ga0209026_1000009 3300025250 Bacteria 531812
128 Ga0209026_1000081 3300025250 Bacteria 196861
129 Ga0209677_100188 3300025253 Bacteria 50341
130 Ga0209148_1000065 3300025254 Bacteria 344489
131 Ga0209759_1000011 3300025256 Bacteria 413027
132 Ga0209759_1000117 3300025256 Bacteria 141785
133 Ga0209233_1000056 3300025261 Bacteria 438104
134 Ga0209233_1000087 3300025261 Bacteria 325225
135 Ga0209233_1000152 3300025261 Bacteria 175910
136 Ga0209233_1000271 3300025261 Bacteria 73658
137 Ga0209455_1001167 3300025272 Bacteria 12638
138 Ga0209673_1000384 3300025273 Bacteria 79540
139 Ga0209673_1005485 3300025273 Bacteria 6359
140 Ga0209673_1005540 3300025273 Bacteria 6318
141 Ga0209130_1000038 3300025284 Bacteria 264226
142 Ga0209025_1000058 3300025294 Bacteria 311398
143 Ga0209564_1000388 3300025295 Bacteria 79331
144 Ga0209564_1000458 3300025295 Bacteria 68749
145 Ga0209758_1001805 3300025297 Bacteria 23641
146 Ga0209758_1007127 3300025297 Bacteria 7727
147 Ga0209256_1001984 3300025299 Bacteria 18424
148 Ga0209256_1016697 3300025299 Bacteria 2484
149 Ga0207426_1000081 3300025302 Bacteria 304502
150 Ga0207426_1001412 3300025302 Bacteria 20129
151 Ga0209051_1002798 3300025303 Bacteria 12036
152 Ga0209257_1001598 3300025304 Bacteria 25935
153 Ga0207697_10045151 3300025315 Bacteria 1813
154 Ga0207655_1000184 3300025728 Bacteria 111832
155 Ga0207647_10006297 3300025904 Bacteria 8640
156 Ga0207643_10019727 3300025908 Bacteria 3696
157 Ga0207695_10000024 3300025913 Bacteria 632311
158 Ga0207695_10154117 3300025913 Bacteria 2234
159 Ga0207671_10001033 3300025914 Bacteria 33897
160 Ga0207693_10126913 3300025915 Bacteria 2005
161 Ga0207660_10125726 3300025917 Bacteria 1947
162 Ga0207662_10080040 3300025918 Bacteria 1992
163 Ga0207646_10000581 3300025922 Bacteria 47822
164 Ga0207646_10015623 3300025922 Bacteria 7162
165 Ga0207650_10001778 3300025925 Bacteria 15244
166 Ga0207706_10191256 3300025933 Bacteria 1796
167 Ga0207704_10059725 3300025938 Bacteria 2355
168 Ga0207691_10052459 3300025940 Bacteria 3724
169 Ga0207689_10246350 3300025942 Bacteria 1478
170 Ga0207651_10046768 3300025960 Bacteria 2913
171 Ga0207651_10054172 3300025960 Bacteria 2747
172 Ga0207677_10162928 3300026023 Bacteria 1735
173 Ga0207639_10196110 3300026041 Bacteria 1728
174 Ga0207708_10053629 3300026075 Bacteria 3073
175 Ga0207702_10060372 3300026078 Bacteria 3232
176 Ga0207648_10044647 3300026089 Bacteria 3889
177 Ga0207676_10068903 3300026095 Bacteria 2831
178 Ga0207683_10024976 3300026121 Bacteria 5151
179 Ga0207698_10149033 3300026142 Bacteria 2028
180 Ga0209371_1002612 3300027312 Bacteria 9883
181 Ga0207428_10023006 3300027907 Bacteria 5248
182 Ga0268266_10000001 3300028379 Bacteria 4040580
183 Ga0268266_10099091 3300028379 Bacteria 2565
184 Ga0268266_10227133 3300028379 Bacteria 1718
185 Ga0268264_10078150 3300028381 Bacteria 2820
186 Ga0265318_10034433 3300028577 Unclassified 1953
187 Ga0307515_10005688 3300028794 Bacteria 25165
188 Ga0307515_10083019 3300028794 Bacteria 4135
189 Ga0268256_1002306 3300030500 Bacteria 9883
190 Ga0307513_10046157 3300031456 Bacteria 4755
191 Ga0307408_100002979 3300031548 Bacteria 11725
192 Ga0307408_100066548 3300031548 Bacteria 2647
193 Ga0307508_10031735 3300031616 Bacteria 4774
194 Ga0307405_10005397 3300031731 Bacteria 6163
195 Ga0307406_10001179 3300031901 Bacteria 14621
196 Ga0307406_10181632 3300031901 Bacteria 1532
197 Ga0307412_10006822 3300031911 Bacteria 6479
198 Ga0307412_10117185 3300031911 Bacteria 1912
199 Ga0307416_100167753 3300032002 Bacteria 2039
200 Ga0307414_10002528 3300032004 Bacteria 9600
201 Ga0307414_10143445 3300032004 Bacteria 1873
202 Ga0307415_100000420 3300032126 Bacteria 18169
203 Ga0307415_100181588 3300032126 Bacteria 1651
204 Ga0373937_0017691 3300036401 Bacteria 6358
205 Ga0373925_0142571 3300037068 Bacteria 1876
206 Ga0395899_0000047 3300037312 Bacteria 233482
207 Ga0395900_0000011 3300037418 Bacteria 421926
208 Ga0395898_0000058 3300037466 Bacteria 277701
209 Ga0439436_0009316 3300041404 Bacteria 3010
210 Ga0439465_0010016 3300041413 Bacteria 2982
211 Ga0451787_044841 3300041441 Bacteria 2281
212 Ga0451835_0278968 3300041492 Bacteria 3904
213 Ga0451847_0193794 3300041503 Bacteria 1763
214 Ga0451851_0998667 3300041507 Bacteria 1468
215 Ga0451853_1774076 3300041512 Bacteria 1753
216 Ga0439432_017708 3300042006 Bacteria 2389
217 Ga0439449_0000817 3300042007 Bacteria 12008
218 Ga0439449_0002007 3300042007 Bacteria 8002
219 Ga0451577_0000001 3300042876 Bacteria 2461803
220 Ga0453683_0147470 3300044673 Bacteria 1486
221 Ga0466966_0002414 3300044684 Bacteria 12207
222 Ga0466966_0006828 3300044684 Bacteria 7561
223 Ga0466966_0114037 3300044684 Bacteria 1664
224 Ga0466961_0001713 3300044693 Bacteria 13646
225 Ga0466963_0013795 3300044694 Bacteria 4973
226 Ga0453684_0090396 3300044712 Bacteria 3783
227 Ga0453684_0106391 3300044712 Unclassified 3419
228 Ga0453684_0126109 3300044712 Bacteria 3081
229 Ga0466970_0002744 3300044765 Bacteria 8502
230 Ga0466970_0005938 3300044765 Bacteria 6087
231 Ga0466959_0001599 3300045049 Bacteria 13976
232 Ga0451576_0003396 3300045051 Bacteria 21953
233 Ga0451576_0029706 3300045051 Bacteria 5847
234 Ga0451576_0121220 3300045051 Bacteria 2723
235 Ga0466967_0273145 3300045976 Bacteria 1620
236 Ga0495617_007029 3300046452 Bacteria 3924
237 Ga0495617_024020 3300046452 Bacteria 2058
238 Ga0495638_0000032 3300046460 Bacteria 293796
239 Ga0495638_0000037 3300046460 Bacteria 261778
240 Ga0495638_0000163 3300046460 Bacteria 103363
241 Ga0495651_0018760 3300046462 Bacteria 5359
242 Ga0495605_0001143 3300046474 Bacteria 17609
243 Ga0495605_0041683 3300046474 Bacteria 2286
244 Ga0495585_0006766 3300046492 Bacteria 7076
245 Ga0495585_0058989 3300046492 Bacteria 2116
246 Ga0495607_0052311 3300046501 Bacteria 2366
247 Ga0495607_0064827 3300046501 Bacteria 2062
248 Ga0495583_0003636 3300046506 Bacteria 11518
249 Ga0495583_0011102 3300046506 Bacteria 5191
250 Ga0495620_0032172 3300046515 Bacteria 2393
251 Ga0495631_0005088 3300046518 Bacteria 6925
252 Ga0495631_0035123 3300046518 Bacteria 2244
253 Ga0495631_0067618 3300046518 Bacteria 1546
254 Ga0495632_0005665 3300046519 Bacteria 8213
255 Ga0495632_0041211 3300046519 Bacteria 2321
256 Ga0495643_0001423 3300046522 Bacteria 22153
257 Ga0495643_0037042 3300046522 Bacteria 2677
258 Ga0495643_0048962 3300046522 Bacteria 2281
259 Ga0495643_0104562 3300046522 Bacteria 1447
260 Ga0495654_0025092 3300046530 Bacteria 3073
261 Ga0495609_0002759 3300046538 Bacteria 10572
262 Ga0495633_0000232 3300046558 Bacteria 67995
263 Ga0495633_0010450 3300046558 Bacteria 5062
264 Ga0495656_0031338 3300046615 Bacteria 2156
265 Ga0495668_0004661 3300046616 Bacteria 9625
266 Ga0495625_0000118 3300046660 Bacteria 121755
267 Ga0495625_0000326 3300046660 Bacteria 72590
268 Ga0495625_0011026 3300046660 Bacteria 7412
269 Ga0495625_0028356 3300046660 Bacteria 4200
270 Ga0495625_0047676 3300046660 Bacteria 3088
271 Ga0495661_0077909 3300046665 Bacteria 1919
272 Ga0495670_0029727 3300046691 Bacteria 2713
273 Ga0495589_0029632 3300046794 Bacteria 2760
274 Ga0495660_0000001 3300046810 Bacteria 1431121
275 Ga0495660_0018736 3300046810 Bacteria 3975
276 Ga0495660_0019203 3300046810 Bacteria 3925
277 Ga0495660_0046569 3300046810 Bacteria 2378
278 Ga0495636_0045053 3300047318 Bacteria 1838
279 Ga0495674_0132445 3300047319 Bacteria 2100
280 Ga0495672_0019828 3300047320 Bacteria 4424
281 Ga0495687_059714 3300047443 Bacteria 1576
282 Ga0495681_0000091 3300047470 Bacteria 79305
283 Ga0495681_0033089 3300047470 Bacteria 2594
284 Ga0495686_0002874 3300047472 Bacteria 15476
285 Ga0495626_0012791 3300048091 Bacteria 4384
286 Ga0496100_0044484 3300048903 Bacteria 2844
287 Ga0496102_0141689 3300048905 Bacteria 2254
288 Ga0496103_0021165 3300048906 Bacteria 3913
289 Ga0496106_0054828 3300048909 Bacteria 3012
290 Ga0496107_0057780 3300048910 Bacteria 2804
291 Ga0496112_0304270 3300048915 Bacteria 1540
292 Ga0496117_0033596 3300048920 Bacteria 3876
293 Ga0496117_0109064 3300048920 Bacteria 1729
294 Ga0496118_0001729 3300048921 Bacteria 31774
295 Ga0496118_0008530 3300048921 Bacteria 10578
296 Ga0496119_0014796 3300048922 Bacteria 6071
297 Ga0496121_0003867 3300048924 Bacteria 20816
298 Ga0496121_0004297 3300048924 Bacteria 19312
299 Ga0496121_0014859 3300048924 Bacteria 8214
300 Ga0496122_0008923 3300048925 Bacteria 10668
301 Ga0496122_0034273 3300048925 Bacteria 4157
302 Ga0496122_0091061 3300048925 Bacteria 2078
303 Ga0496123_0048314 3300048926 Bacteria 2863
304 Ga0496124_0003113 3300048927 Bacteria 20580
305 Ga0496124_0134119 3300048927 Bacteria 1963
306 Ga0496125_0087396 3300048928 Bacteria 2355
307 Ga0496126_0066081 3300048929 Bacteria 3234
308 Ga0496126_0135211 3300048929 Bacteria 2127
309 Ga0496126_0158160 3300048929 Bacteria 1938
310 Ga0501306_006815 3300049127 Bacteria 1352
311 Ga0495682_0000105 3300049460 Bacteria 74328
312 Ga0501292_005106 3300049515 Bacteria 1819
313 Ga0501299_002807 3300049522 Bacteria 2455
314 Ga0501031_0000254 3300049568 Bacteria 29927
315 Ga0501031_0011187 3300049568 Bacteria 5848
316 Ga0501031_0031830 3300049568 Bacteria 3440
317 Ga0501031_0035156 3300049568 Bacteria 3268
318 Ga0501032_0006240 3300049569 Bacteria 8773
319 Ga0501032_0007946 3300049569 Bacteria 7728
320 Ga0501032_0085951 3300049569 Bacteria 2090
321 Ga0501032_0097438 3300049569 Bacteria 1949
322 Ga0501033_0000147 3300049570 Bacteria 68141
323 Ga0501033_0005918 3300049570 Bacteria 9603
324 Ga0501033_0017068 3300049570 Bacteria 5487
325 Ga0501033_0018899 3300049570 Bacteria 5208
326 Ga0501034_0004515 3300049571 Bacteria 15475
327 Ga0501034_0012819 3300049571 Bacteria 8645
328 Ga0501034_0086042 3300049571 Bacteria 3145
329 Ga0501034_0141850 3300049571 Bacteria 2381
330 Ga0501036_0011061 3300049572 Bacteria 7462
331 Ga0501036_0049139 3300049572 Bacteria 3571
332 Ga0501036_0126188 3300049572 Bacteria 2161
333 Ga0501036_0188906 3300049572 Bacteria 1733
334 Ga0501036_0204982 3300049572 Bacteria 1658
335 Ga0501037_0004182 3300049573 Bacteria 10464
336 Ga0501037_0008122 3300049573 Bacteria 7691
337 Ga0501037_0031967 3300049573 Bacteria 3885
338 Ga0501037_0063585 3300049573 Bacteria 2689
339 Ga0501037_0081216 3300049573 Bacteria 2351
340 Ga0501037_0121761 3300049573 Bacteria 1875
341 Ga0501038_0002884 3300049574 Bacteria 16039
342 Ga0501038_0013415 3300049574 Bacteria 7469
343 Ga0501038_0014198 3300049574 Bacteria 7256
344 Ga0501038_0028110 3300049574 Bacteria 4996
345 Ga0501038_0032375 3300049574 Bacteria 4613
346 Ga0501038_0052654 3300049574 Bacteria 3508
347 Ga0501039_0012121 3300049575 Bacteria 6572
348 Ga0501039_0013065 3300049575 Bacteria 6349
349 Ga0501039_0015836 3300049575 Bacteria 5774
350 Ga0501039_0022849 3300049575 Bacteria 4797
351 Ga0501039_0029331 3300049575 Bacteria 4237
352 Ga0501039_0029830 3300049575 Bacteria 4202
353 Ga0501039_0121207 3300049575 Bacteria 2049
354 Ga0501039_0134542 3300049575 Bacteria 1940
355 Ga0501040_0031122 3300049576 Unclassified 3605
356 Ga0501040_0052172 3300049576 Bacteria 2799
357 Ga0501040_0064982 3300049576 Bacteria 2512
358 Ga0501040_0066294 3300049576 Bacteria 2488
359 Ga0501041_0060586 3300049577 Bacteria 2316
360 Ga0501041_0119351 3300049577 Bacteria 1638
361 Ga0501042_0026436 3300049578 Bacteria 4078
362 Ga0501042_0036468 3300049578 Bacteria 3488
363 Ga0501043_0020482 3300049579 Bacteria 5189
364 Ga0501043_0033056 3300049579 Bacteria 4068
365 Ga0501046_0003445 3300049580 Bacteria 14513
366 Ga0501046_0011544 3300049580 Bacteria 7553
367 Ga0501046_0033653 3300049580 Bacteria 4139
368 Ga0501046_0182192 3300049580 Bacteria 1570
369 Ga0501047_0009302 3300049581 Bacteria 9279
370 Ga0501047_0012894 3300049581 Bacteria 7918
371 Ga0501048_0025351 3300049582 Bacteria 4322
372 Ga0501048_0034078 3300049582 Bacteria 3676
373 Ga0501048_0068141 3300049582 Bacteria 2514
374 Ga0501048_0207296 3300049582 Unclassified 1390
375 Ga0501067_0015702 3300049583 Bacteria 4189
376 Ga0501067_0023598 3300049583 Bacteria 3409
377 Ga0501068_0012675 3300049584 Bacteria 4784
378 Ga0501068_0035096 3300049584 Bacteria 2992
379 Ga0501069_0006698 3300049585 Bacteria 6032
380 Ga0501070_0082130 3300049586 Bacteria 2667
381 Ga0501070_0144354 3300049586 Bacteria 1965
382 Ga0501071_0014376 3300049587 Bacteria 5412
383 Ga0501071_0041321 3300049587 Bacteria 3302
384 Ga0501072_0025696 3300049588 Bacteria 4587
385 Ga0501072_0030100 3300049588 Bacteria 4243
386 Ga0501073_0008086 3300049589 Bacteria 7802
387 Ga0501073_0015938 3300049589 Bacteria 5446
388 Ga0501073_0106321 3300049589 Bacteria 1947
389 Ga0501073_0132844 3300049589 Bacteria 1725
390 Ga0501074_0011152 3300049590 Bacteria 6529
391 Ga0501074_0043589 3300049590 Bacteria 3247
392 Ga0501075_0094855 3300049591 Bacteria 2264
393 Ga0501075_0119491 3300049591 Bacteria 2005
394 Ga0501076_0023036 3300049592 Bacteria 4795
395 Ga0501076_0046158 3300049592 Bacteria 3441
396 Ga0501077_0082391 3300049593 Bacteria 2038
397 Ga0501198_000362 3300049649 Bacteria 5706
398 Ga0501202_000781 3300049652 Bacteria 4773
399 Ga0501207_000403 3300049654 Bacteria 4781
400 Ga0501216_000695 3300049660 Bacteria 4143
401 Ga0501217_000196 3300049661 Bacteria 9024
402 Ga0501217_009173 3300049661 Bacteria 2147
403 Ga0501223_000642 3300049663 Bacteria 8388
404 Ga0501224_000087 3300049664 Bacteria 9872
405 Ga0501233_000366 3300049668 Bacteria 7116
406 Ga0501235_001486 3300049669 Bacteria 5020
407 Ga0501236_007996 3300049670 Unclassified 1335
408 Ga0501243_002548 3300049675 Unclassified 2678
409 Ga0501243_006920 3300049675 Bacteria 1727
410 Ga0501259_002323 3300049688 Unclassified 3112
411 Ga0501225_0005946 3300049705 Bacteria 3572
412 Ga0501229_001771 3300049706 Unclassified 2530
413 Ga0501234_000618 3300049707 Bacteria 5464
414 Ga0501079_0009768 3300049741 Bacteria 7274
415 Ga0501079_0054608 3300049741 Bacteria 3081
416 Ga0501079_0055190 3300049741 Bacteria 3066
417 Ga0501079_0099704 3300049741 Bacteria 2251
418 Ga0501079_0169585 3300049741 Bacteria 1702
419 Ga0501080_0013377 3300049742 Bacteria 7545
420 Ga0501080_0063780 3300049742 Bacteria 3428
421 Ga0501080_0072291 3300049742 Bacteria 3209
422 Ga0501081_0012433 3300049743 Bacteria 5595
423 Ga0501081_0160323 3300049743 Unclassified 1621
424 Ga0501083_0001116 3300049744 Bacteria 17988
425 Ga0501083_0021602 3300049744 Bacteria 4470
426 Ga0501083_0074377 3300049744 Bacteria 2257
427 Ga0501283_000179 3300049779 Bacteria 8305
428 Ga0501035_0011289 3300049822 Bacteria 8277
429 Ga0501035_0064900 3300049822 Bacteria 3244
430 Ga0501035_0104174 3300049822 Bacteria 2488
431 Ga0501035_0117345 3300049822 Bacteria 2329
432 Ga0501035_0148844 3300049822 Bacteria 2032
433 Ga0501044_0006247 3300049823 Bacteria 13173
434 Ga0501044_0096339 3300049823 Bacteria 2980
435 Ga0501044_0178994 3300049823 Bacteria 2088
436 Ga0501045_0004167 3300049824 Bacteria 9991
437 Ga0501045_0072116 3300049824 Bacteria 2542
438 Ga0501045_0109976 3300049824 Unclassified 2043
439 Ga0501212_000171 3300049851 Bacteria 5516
440 Ga0501226_000297 3300049853 Bacteria 7463
441 nmdc:mga0yw44_11624_c1 3300050492 Bacteria 4555
442 nmdc:mga0yw44_152151_c1 3300050492 Bacteria 1510
443 nmdc:mga06z11_42766_c1 3300050494 Bacteria 2275
444 nmdc:mga06z11_44862_c1 3300050494 Bacteria 2232
445 nmdc:mga07m45_6637_c1 3300050496 Bacteria 5866
446 nmdc:mga07m45_928_c1 3300050496 Bacteria 12810
447 nmdc:mga05p37_131287_c1 3300050507 Bacteria 3073
448 nmdc:mga05p37_54660_c1 3300050507 Unclassified 4912
449 nmdc:mga09592_126857_c1 3300050508 Bacteria 2194
450 nmdc:mga06r32_239516_c1 3300050510 Bacteria 1802
451 nmdc:mga08y16_143666_c1 3300050511 Unclassified 2480
452 nmdc:mga08y16_176790_c1 3300050511 Bacteria 2216
453 nmdc:mga08y16_28915_c1 3300050511 Bacteria 5843
454 nmdc:mga0n895_83253_c1 3300050512 Bacteria 3190
455 nmdc:mga0sz30_1704_c1 3300050516 Bacteria 7804
456 nmdc:mga0sz30_22355_c1 3300050516 Bacteria 2566
457 Ga0495655_0008577 3300053083 Bacteria 1948
458 Ga0500658_0000578 3300053134 Bacteria 15417
459 Ga0500658_0064159 3300053134 Bacteria 1536
460 Ga0500568_0000210 3300053139 Bacteria 50927
461 Ga0500568_0000366 3300053139 Bacteria 34998
462 Ga0500616_0001017 3300053153 Bacteria 29900
463 Ga0500616_0002649 3300053153 Bacteria 14567
464 Ga0500616_0005135 3300053153 Bacteria 9005
465 Ga0500616_0006752 3300053153 Bacteria 7439
466 Ga0500622_0042881 3300053156 Bacteria 2348
467 Ga0500622_0056464 3300053156 Bacteria 2010
468 Ga0500634_0024095 3300053161 Bacteria 3310
469 Ga0500634_0077016 3300053161 Bacteria 1729
470 Ga0500636_0001753 3300053177 Bacteria 11889
471 Ga0501084_0054207 3300054114 Bacteria 3354
472 Ga0501084_0087607 3300054114 Bacteria 2614
473 Ga0587111_0011353 3300060346 Bacteria 1551
474 Ga0501082_0001805 3300060353 Bacteria 18830
475 Ga0501082_0004421 3300060353 Bacteria 12275
476 Ga0501082_0019820 3300060353 Bacteria 5800
477 Ga0501082_0078860 3300060353 Bacteria 2840
478 Ga0530510_0015055 3300061734 Bacteria 5462
479 Ga0530510_0056470 3300061734 Bacteria 2836
480 Ga0530510_0091250 3300061734 Bacteria 2222
481 Ga0530510_0118205 3300061734 Unclassified 1945

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049576 Ga0501040_0066294 Ga0501040_0066294_1275_2477 332
2 3300048915 Ga0496112_0304270 Ga0496112_0304270_387_1508 335
3 3300025918 Ga0207662_10080040 Ga0207662_100800402 338
4 3300049706 Ga0501229_001771 Ga0501229_001771_1344_2501 340
5 3300049670 Ga0501236_007996 Ga0501236_007996_88_1281 352
6 3300027907 Ga0207428_10023006 Ga0207428_100230063 356
7 3300041492 Ga0451835_0278968 Ga0451835_0278968_2683_3864 361
8 3300025960 Ga0207651_10046768 Ga0207651_100467683 363
9 3300049577 Ga0501041_0119351 Ga0501041_0119351_295_1620 366
10 3300049741 Ga0501079_0055190 Ga0501079_0055190_1488_2813 366
11 3300009551 Ga0105238_10028931 Ga0105238_100289313 367
12 3300021321 Ga0214542_1023097 Ga0214542_10230973 367
13 3300021327 Ga0214543_1000005 Ga0214543_1000005219 367
14 3300037068 Ga0373925_0142571 Ga0373925_0142571_204_1547 367
15 3300044673 Ga0453683_0147470 Ga0453683_0147470_256_1467 369
16 3300049582 Ga0501048_0207296 Ga0501048_0207296_14_1249 369
17 3300049572 Ga0501036_0188906 Ga0501036_0188906_75_1409 371
18 3300049573 Ga0501037_0081216 Ga0501037_0081216_889_2223 371
19 3300049574 Ga0501038_0028110 Ga0501038_0028110_277_1611 371
20 3300049575 Ga0501039_0029331 Ga0501039_0029331_180_1514 371
21 3300049577 Ga0501041_0060586 Ga0501041_0060586_290_1624 371
22 3300049579 Ga0501043_0033056 Ga0501043_0033056_1057_2391 371
23 3300049582 Ga0501048_0034078 Ga0501048_0034078_1264_2598 371
24 3300049584 Ga0501068_0035096 Ga0501068_0035096_715_2049 371
25 3300049586 Ga0501070_0082130 Ga0501070_0082130_574_1908 371
26 3300049587 Ga0501071_0041321 Ga0501071_0041321_1191_2525 371
27 3300049589 Ga0501073_0106321 Ga0501073_0106321_267_1601 371
28 3300049591 Ga0501075_0094855 Ga0501075_0094855_299_1633 371
29 3300049742 Ga0501080_0072291 Ga0501080_0072291_899_2233 371
30 3300049744 Ga0501083_0074377 Ga0501083_0074377_42_1376 371
31 3300049822 Ga0501035_0148844 Ga0501035_0148844_188_1522 371
32 3300049823 Ga0501044_0178994 Ga0501044_0178994_454_1788 371
33 3300049824 Ga0501045_0004167 Ga0501045_0004167_7179_8513 371
34 3300060353 Ga0501082_0078860 Ga0501082_0078860_973_2307 371
35 3300061734 Ga0530510_0091250 Ga0530510_0091250_661_1995 371
36 3300006871 Ga0075434_100053103 Ga0075434_1000531032 372
37 3300048905 Ga0496102_0141689 Ga0496102_0141689_20_1333 372
38 3300048909 Ga0496106_0054828 Ga0496106_0054828_618_1952 372
39 3300048910 Ga0496107_0057780 Ga0496107_0057780_421_1755 372
40 3300050512 nmdc:mga0n895_83253_c1 nmdc:mga0n895_83253_c1_689_2065 372
41 3300053083 Ga0495655_0008577 Ga0495655_0008577_155_1489 372
42 3300009553 Ga0105249_10144657 Ga0105249_101446572 373
43 3300025942 Ga0207689_10246350 Ga0207689_102463502 373
44 3300025917 Ga0207660_10125726 Ga0207660_101257262 374
45 3300028379 Ga0268266_10227133 Ga0268266_102271332 374
46 3300005347 Ga0070668_100068317 Ga0070668_1000683172 376
47 3300005842 Ga0068858_100035682 Ga0068858_1000356823 376
48 3300006195 Ga0075366_10026651 Ga0075366_100266512 376
49 3300009101 Ga0105247_10037197 Ga0105247_100371972 376
50 3300009177 Ga0105248_10234943 Ga0105248_102349432 376
51 3300010375 Ga0105239_10066579 Ga0105239_100665794 376
52 3300013297 Ga0157378_10054267 Ga0157378_100542671 376
53 3300013307 Ga0157372_10381673 Ga0157372_103816731 376
54 3300026023 Ga0207677_10162928 Ga0207677_101629281 376
55 3300028381 Ga0268264_10078150 Ga0268264_100781502 376
56 3300050494 nmdc:mga06z11_42766_c1 nmdc:mga06z11_42766_c1_40_1353 376
57 3300025933 Ga0207706_10191256 Ga0207706_101912561 377
58 3300005331 Ga0070670_100012940 Ga0070670_1000129403 379
59 3300013104 Ga0157370_10036186 Ga0157370_100361863 379
60 3300025925 Ga0207650_10001778 Ga0207650_1000177813 379
61 3300045051 Ga0451576_0121220 Ga0451576_0121220_147_1454 379
62 3300050507 nmdc:mga05p37_131287_c1 nmdc:mga05p37_131287_c1_495_1838 379
63 3300015265 Ga0182005_1006088 Ga0182005_10060881 380
64 3300031901 Ga0307406_10181632 Ga0307406_101816321 380
65 3300005937 Ga0081455_10002201 Ga0081455_100022014 381
66 3300006186 Ga0075369_10018748 Ga0075369_100187482 381
67 3300028794 Ga0307515_10083019 Ga0307515_100830194 381
68 3300061734 Ga0530510_0015055 Ga0530510_0015055_1625_2962 381
69 3300042876 Ga0451577_0000001 Ga0451577_0000001_2428618_2429979 383
70 3300005983 Ga0081540_1006757 Ga0081540_10067576 385
71 3300010375 Ga0105239_10006404 Ga0105239_100064045 385
72 3300046522 Ga0495643_0001423 Ga0495643_0001423_2485_3792 386
73 3300046810 Ga0495660_0046569 Ga0495660_0046569_773_2080 386
74 3300047472 Ga0495686_0002874 Ga0495686_0002874_10206_11513 386
75 3300053153 Ga0500616_0005135 Ga0500616_0005135_4340_5644 386
76 iso_pu_bacteria 643348564 643601583 386
77 iso_pu_bacteria 643348564 643605169 386
78 3300049568 Ga0501031_0000254 Ga0501031_0000254_2062_3393 387
79 3300049570 Ga0501033_0005918 Ga0501033_0005918_2555_3922 387
80 3300049571 Ga0501034_0004515 Ga0501034_0004515_11752_13119 387
81 3300049572 Ga0501036_0011061 Ga0501036_0011061_5673_7040 387
82 3300049573 Ga0501037_0004182 Ga0501037_0004182_4311_5678 387
83 3300049574 Ga0501038_0002884 Ga0501038_0002884_5834_7165 387
84 3300049575 Ga0501039_0013065 Ga0501039_0013065_4333_5700 387
85 3300049580 Ga0501046_0003445 Ga0501046_0003445_4410_5741 387
86 3300049581 Ga0501047_0009302 Ga0501047_0009302_3666_4997 387
87 3300049589 Ga0501073_0008086 Ga0501073_0008086_5638_7005 387
88 3300049742 Ga0501080_0063780 Ga0501080_0063780_1410_2777 387
89 3300049822 Ga0501035_0011289 Ga0501035_0011289_3899_5266 387
90 3300049823 Ga0501044_0006247 Ga0501044_0006247_11689_13020 387
91 3300046460 Ga0495638_0000037 Ga0495638_0000037_168813_170120 388
92 3300046522 Ga0495643_0104562 Ga0495643_0104562_54_1361 388
93 3300046538 Ga0495609_0002759 Ga0495609_0002759_122_1429 388
94 3300049592 Ga0501076_0023036 Ga0501076_0023036_532_1866 389
95 3300054114 Ga0501084_0054207 Ga0501084_0054207_691_2025 389
96 3300046558 Ga0495633_0010450 Ga0495633_0010450_2392_3873 390
97 3300046660 Ga0495625_0047676 Ga0495625_0047676_475_1956 390
98 3300046691 Ga0495670_0029727 Ga0495670_0029727_1050_2531 390
99 3300005548 Ga0070665_100058339 Ga0070665_1000583394 391
100 3300005985 Ga0081539_10001282 Ga0081539_1000128228 391
101 3300009011 Ga0105251_10092498 Ga0105251_100924981 391
102 3300009036 Ga0105244_10001313 Ga0105244_1000131311 391
103 3300025728 Ga0207655_1000184 Ga0207655_100018477 391
104 3300048091 Ga0495626_0012791 Ga0495626_0012791_28_1311 391
105 3300049568 Ga0501031_0031830 Ga0501031_0031830_1966_3303 392
106 3300049572 Ga0501036_0049139 Ga0501036_0049139_305_1642 392
107 3300049572 Ga0501036_0204982 Ga0501036_0204982_61_1383 392
108 3300049574 Ga0501038_0032375 Ga0501038_0032375_396_1733 392
109 3300049575 Ga0501039_0015836 Ga0501039_0015836_531_1868 392
110 3300049576 Ga0501040_0064982 Ga0501040_0064982_909_2246 392
111 3300049579 Ga0501043_0020482 Ga0501043_0020482_2597_3934 392
112 3300049580 Ga0501046_0182192 Ga0501046_0182192_80_1402 392
113 3300049588 Ga0501072_0030100 Ga0501072_0030100_1257_2594 392
114 3300049590 Ga0501074_0011152 Ga0501074_0011152_2154_3491 392
115 3300049593 Ga0501077_0082391 Ga0501077_0082391_614_1951 392
116 3300049741 Ga0501079_0009768 Ga0501079_0009768_11_1327 392
117 3300049744 Ga0501083_0021602 Ga0501083_0021602_1966_3303 392
118 3300049822 Ga0501035_0064900 Ga0501035_0064900_458_1795 392
119 3300049824 Ga0501045_0109976 Ga0501045_0109976_261_1583 392
120 3300050511 nmdc:mga08y16_176790_c1 nmdc:mga08y16_176790_c1_38_1375 392
121 3300060353 Ga0501082_0019820 Ga0501082_0019820_1236_2573 392
122 3300061734 Ga0530510_0118205 Ga0530510_0118205_78_1400 392
123 iso_pu_bacteria 2904113452 2904115186 392
124 3300005981 Ga0081538_10000940 Ga0081538_100009407 393
125 3300005983 Ga0081540_1012046 Ga0081540_10120464 393
126 3300005985 Ga0081539_10014005 Ga0081539_100140054 393
127 3300006844 Ga0075428_100005413 Ga0075428_1000054135 393
128 3300006871 Ga0075434_100189570 Ga0075434_1001895701 393
129 3300006880 Ga0075429_100020373 Ga0075429_1000203735 393
130 3300007076 Ga0075435_100247909 Ga0075435_1002479092 393
131 3300009094 Ga0111539_10052837 Ga0111539_100528372 393
132 3300009094 Ga0111539_10125168 Ga0111539_101251681 393
133 3300009553 Ga0105249_10084241 Ga0105249_100842412 393
134 3300014968 Ga0157379_10048711 Ga0157379_100487112 393
135 3300049127 Ga0501306_006815 Ga0501306_006815_18_1328 393
136 3300049586 Ga0501070_0144354 Ga0501070_0144354_249_1583 393
137 3300049592 Ga0501076_0046158 Ga0501076_0046158_1583_2920 393
138 3300050507 nmdc:mga05p37_54660_c1 nmdc:mga05p37_54660_c1_2888_4213 393
139 3300050508 nmdc:mga09592_126857_c1 nmdc:mga09592_126857_c1_286_1611 393
140 3300050510 nmdc:mga06r32_239516_c1 nmdc:mga06r32_239516_c1_258_1583 393
141 3300050511 nmdc:mga08y16_143666_c1 nmdc:mga08y16_143666_c1_506_1831 393
142 3300050511 nmdc:mga08y16_28915_c1 nmdc:mga08y16_28915_c1_1168_2493 393
143 3300061734 Ga0530510_0056470 Ga0530510_0056470_407_1744 393
144 3300042007 Ga0439449_0000817 Ga0439449_0000817_8885_10198 394
145 3300046452 Ga0495617_007029 Ga0495617_007029_1257_2582 394
146 3300046474 Ga0495605_0001143 Ga0495605_0001143_14847_16172 394
147 3300046501 Ga0495607_0064827 Ga0495607_0064827_693_2018 394
148 3300046506 Ga0495583_0011102 Ga0495583_0011102_240_1565 394
149 3300046518 Ga0495631_0005088 Ga0495631_0005088_1449_2774 394
150 3300046519 Ga0495632_0005665 Ga0495632_0005665_6132_7457 394
151 3300046616 Ga0495668_0004661 Ga0495668_0004661_1097_2422 394
152 3300046660 Ga0495625_0011026 Ga0495625_0011026_1187_2512 394
153 3300046810 Ga0495660_0019203 Ga0495660_0019203_59_1384 394
154 3300048920 Ga0496117_0109064 Ga0496117_0109064_310_1701 394
155 iso_pu_bacteria 2582581294 2585205878 394
156 3300041503 Ga0451847_0193794 Ga0451847_0193794_29_1312 395
157 3300041507 Ga0451851_0998667 Ga0451851_0998667_173_1456 395
158 3300049675 Ga0501243_006920 Ga0501243_006920_149_1477 395
159 3300048924 Ga0496121_0004297 Ga0496121_0004297_15293_16609 396
160 3300048927 Ga0496124_0003113 Ga0496124_0003113_12198_13514 396
161 3300049575 Ga0501039_0012121 Ga0501039_0012121_3970_5295 396
162 3300049743 Ga0501081_0160323 Ga0501081_0160323_144_1493 396
163 3300041404 Ga0439436_0009316 Ga0439436_0009316_955_2286 397
164 3300046460 Ga0495638_0000163 Ga0495638_0000163_45962_47293 397
165 3300047318 Ga0495636_0045053 Ga0495636_0045053_183_1514 397
166 3300047320 Ga0495672_0019828 Ga0495672_0019828_62_1393 397
167 3300053134 Ga0500658_0064159 Ga0500658_0064159_101_1432 397
168 3300053139 Ga0500568_0000210 Ga0500568_0000210_42297_43628 397
169 3300053153 Ga0500616_0001017 Ga0500616_0001017_7175_8506 397
170 3300005981 Ga0081538_10007360 Ga0081538_100073606 398
171 3300005981 Ga0081538_10027369 Ga0081538_100273692 398
172 3300009094 Ga0111539_10137172 Ga0111539_101371723 398
173 3300013296 Ga0157374_10219244 Ga0157374_102192441 398
174 3300025315 Ga0207697_10045151 Ga0207697_100451511 398
175 3300044712 Ga0453684_0090396 Ga0453684_0090396_131_1441 398
176 iso_pu_bacteria 2738541281 2738743262 398
177 iso_pu_bacteria 2738543032 2739352879 398
178 iso_pu_bacteria 2831426010 2831433069 398
179 iso_pu_bacteria 2848694841 2848699671 398
180 iso_pu_bacteria 2849660919 2849666616 398
181 3300048929 Ga0496126_0135211 Ga0496126_0135211_518_1894 399
182 3300049576 Ga0501040_0031122 Ga0501040_0031122_1219_2538 399
183 3300049661 Ga0501217_009173 Ga0501217_009173_99_1436 399
184 3300049741 Ga0501079_0169585 Ga0501079_0169585_13_1332 399
185 3300054114 Ga0501084_0087607 Ga0501084_0087607_333_1652 399
186 iso_pu_bacteria 2980182181 2980187551 399
187 3300046810 Ga0495660_0000001 Ga0495660_0000001_1411927_1413285 400
188 3300050492 nmdc:mga0yw44_11624_c1 nmdc:mga0yw44_11624_c1_1106_2410 400
189 3300050516 nmdc:mga0sz30_22355_c1 nmdc:mga0sz30_22355_c1_270_1574 400
190 3300053153 Ga0500616_0002649 Ga0500616_0002649_13073_14377 400
191 3300053161 Ga0500634_0077016 Ga0500634_0077016_139_1461 400
192 3300053177 Ga0500636_0001753 Ga0500636_0001753_5517_6839 400
193 3300005468 Ga0070707_100000311 Ga0070707_10000031121 401
194 3300005518 Ga0070699_100117102 Ga0070699_1001171021 401
195 3300025922 Ga0207646_10000581 Ga0207646_1000058128 401
196 3300044712 Ga0453684_0106391 Ga0453684_0106391_903_2252 401
197 iso_pu_bacteria 2818991438 2819551974 401
198 iso_pu_bacteria 2865002811 2865005763 401
199 iso_pu_bacteria 2990265787 2990266115 401
200 iso_pu_bacteria 2993693658 2993696091 401
201 3300002741 JGI25157J39369_1000782 JGI25157J39369_10007829 402
202 3300005290 Ga0065712_10005803 Ga0065712_100058033 402
203 3300005435 Ga0070714_100071416 Ga0070714_1000714162 402
204 3300006175 Ga0070712_100113269 Ga0070712_1001132691 402
205 3300010375 Ga0105239_10177236 Ga0105239_101772362 402
206 3300025250 Ga0209026_1000081 Ga0209026_100008194 402
207 3300025256 Ga0209759_1000117 Ga0209759_100011795 402
208 3300025915 Ga0207693_10126913 Ga0207693_101269131 402
209 3300025960 Ga0207651_10054172 Ga0207651_100541722 402
210 3300036401 Ga0373937_0017691 Ga0373937_0017691_1348_2664 402
211 3300037312 Ga0395899_0000047 Ga0395899_0000047_137013_138305 402
212 3300037418 Ga0395900_0000011 Ga0395900_0000011_247332_248624 402
213 3300037466 Ga0395898_0000058 Ga0395898_0000058_273927_275219 402
214 3300044684 Ga0466966_0002414 Ga0466966_0002414_10537_11829 402
215 3300046462 Ga0495651_0018760 Ga0495651_0018760_1555_2871 402
216 3300047319 Ga0495674_0132445 Ga0495674_0132445_616_1932 402
217 3300049568 Ga0501031_0011187 Ga0501031_0011187_2705_4015 402
218 3300049568 Ga0501031_0035156 Ga0501031_0035156_1518_2867 402
219 3300049569 Ga0501032_0006240 Ga0501032_0006240_4838_6187 402
220 3300049569 Ga0501032_0007946 Ga0501032_0007946_4303_5613 402
221 3300049569 Ga0501032_0085951 Ga0501032_0085951_257_1606 402
222 3300049570 Ga0501033_0000147 Ga0501033_0000147_49403_50752 402
223 3300049570 Ga0501033_0017068 Ga0501033_0017068_1216_2526 402
224 3300049570 Ga0501033_0018899 Ga0501033_0018899_3458_4807 402
225 3300049571 Ga0501034_0012819 Ga0501034_0012819_2459_3808 402
226 3300049571 Ga0501034_0086042 Ga0501034_0086042_1197_2507 402
227 3300049573 Ga0501037_0008122 Ga0501037_0008122_4424_5773 402
228 3300049573 Ga0501037_0031967 Ga0501037_0031967_2334_3644 402
229 3300049573 Ga0501037_0063585 Ga0501037_0063585_485_1834 402
230 3300049573 Ga0501037_0121761 Ga0501037_0121761_467_1777 402
231 3300049574 Ga0501038_0013415 Ga0501038_0013415_2617_3966 402
232 3300049574 Ga0501038_0014198 Ga0501038_0014198_528_1838 402
233 3300049574 Ga0501038_0052654 Ga0501038_0052654_1164_2474 402
234 3300049575 Ga0501039_0022849 Ga0501039_0022849_3246_4556 402
235 3300049575 Ga0501039_0029830 Ga0501039_0029830_2349_3659 402
236 3300049575 Ga0501039_0121207 Ga0501039_0121207_160_1509 402
237 3300049575 Ga0501039_0134542 Ga0501039_0134542_335_1684 402
238 3300049578 Ga0501042_0026436 Ga0501042_0026436_912_2222 402
239 3300049578 Ga0501042_0036468 Ga0501042_0036468_266_1615 402
240 3300049580 Ga0501046_0011544 Ga0501046_0011544_4591_5940 402
241 3300049580 Ga0501046_0033653 Ga0501046_0033653_2335_3645 402
242 3300049581 Ga0501047_0012894 Ga0501047_0012894_3091_4440 402
243 3300049582 Ga0501048_0068141 Ga0501048_0068141_654_2003 402
244 3300049583 Ga0501067_0015702 Ga0501067_0015702_1338_2687 402
245 3300049583 Ga0501067_0023598 Ga0501067_0023598_141_1490 402
246 3300049584 Ga0501068_0012675 Ga0501068_0012675_2200_3549 402
247 3300049585 Ga0501069_0006698 Ga0501069_0006698_396_1745 402
248 3300049587 Ga0501071_0014376 Ga0501071_0014376_3310_4659 402
249 3300049588 Ga0501072_0025696 Ga0501072_0025696_1874_3223 402
250 3300049589 Ga0501073_0015938 Ga0501073_0015938_343_1692 402
251 3300049590 Ga0501074_0043589 Ga0501074_0043589_790_2139 402
252 3300049741 Ga0501079_0054608 Ga0501079_0054608_127_1476 402
253 3300049741 Ga0501079_0099704 Ga0501079_0099704_257_1606 402
254 3300049742 Ga0501080_0013377 Ga0501080_0013377_5145_6494 402
255 3300049743 Ga0501081_0012433 Ga0501081_0012433_2199_3548 402
256 3300049744 Ga0501083_0001116 Ga0501083_0001116_10771_12120 402
257 3300049823 Ga0501044_0096339 Ga0501044_0096339_1052_2401 402
258 3300049824 Ga0501045_0072116 Ga0501045_0072116_118_1467 402
259 3300060353 Ga0501082_0004421 Ga0501082_0004421_9986_11335 402
260 iso_pu_bacteria 2643221655 2644307374 402
261 iso_pu_bacteria 2643221659 2644331390 402
262 iso_pu_bacteria 2643221698 2644541406 402
263 iso_pu_bacteria 2643221712 2644613463 402
264 iso_pu_bacteria 2838074704 2838077731 402
265 iso_pu_bacteria 2896384573 2896391845 402
266 iso_pu_bacteria 2920760137 2920765015 402
267 iso_pu_bacteria 2941499720 2941502880 402
268 iso_pu_bacteria 8006964411 8006967273 402
269 iso_pu_bacteria 8057977335 8057980607 402
270 3300001979 JGI24740J21852_10001797 JGI24740J21852_100017972 403
271 3300002704 JGI25155J39150_1000006 JGI25155J39150_100000681 403
272 3300002705 JGI25156J39149_1000105 JGI25156J39149_100010559 403
273 3300002737 JGI25162J39368_1000266 JGI25162J39368_100026611 403
274 3300002737 JGI25162J39368_1000694 JGI25162J39368_100069420 403
275 3300002738 JGI25154J39366_1000055 JGI25154J39366_100005524 403
276 3300002738 JGI25154J39366_1000085 JGI25154J39366_100008571 403
277 3300002741 JGI25157J39369_1001299 JGI25157J39369_10012995 403
278 3300002987 JGI25159J45721_1003157 JGI25159J45721_10031573 403
279 3300003214 JGI25165J46597_1000579 JGI25165J46597_100057926 403
280 3300003214 JGI25165J46597_1000786 JGI25165J46597_10007865 403
281 3300003214 JGI25165J46597_1005162 JGI25165J46597_10051622 403
282 3300003323 rootH1_10013182 rootH1_100131821 403
283 3300003354 JGI25160J50197_1000053 JGI25160J50197_1000053125 403
284 3300003374 JGI25161J50226_1000039 JGI25161J50226_1000039125 403
285 3300003761 Ga0055535_1002072 Ga0055535_10020724 403
286 3300003762 Ga0055542_1000637 Ga0055542_100063725 403
287 3300004625 Ga0055543_1000015 Ga0055543_100001563 403
288 3300005262 Ga0065165_1000568 Ga0065165_10005686 403
289 3300005548 Ga0070665_100031499 Ga0070665_1000314992 403
290 3300005614 Ga0068856_100035355 Ga0068856_1000353552 403
291 3300006186 Ga0075369_10000195 Ga0075369_100001959 403
292 3300009036 Ga0105244_10050599 Ga0105244_100505992 403
293 3300009093 Ga0105240_10000027 Ga0105240_10000027146 403
294 3300009545 Ga0105237_10003395 Ga0105237_100033954 403
295 3300010375 Ga0105239_10010405 Ga0105239_100104052 403
296 3300010375 Ga0105239_10334535 Ga0105239_103345351 403
297 3300015262 Ga0182007_10003280 Ga0182007_100032804 403
298 3300015265 Ga0182005_1004517 Ga0182005_10045172 403
299 3300025206 Ga0209435_100011 Ga0209435_10001181 403
300 3300025228 Ga0209672_102283 Ga0209672_1022834 403
301 3300025228 Ga0209672_104514 Ga0209672_1045142 403
302 3300025233 Ga0209437_100033 Ga0209437_10003320 403
303 3300025233 Ga0209437_100036 Ga0209437_100036272 403
304 3300025242 Ga0209258_100265 Ga0209258_10026510 403
305 3300025246 Ga0209646_1000024 Ga0209646_1000024330 403
306 3300025250 Ga0209026_1000009 Ga0209026_1000009444 403
307 3300025253 Ga0209677_100188 Ga0209677_1001882 403
308 3300025254 Ga0209148_1000065 Ga0209148_1000065301 403
309 3300025256 Ga0209759_1000011 Ga0209759_100001181 403
310 3300025261 Ga0209233_1000056 Ga0209233_1000056320 403
311 3300025261 Ga0209233_1000152 Ga0209233_1000152158 403
312 3300025261 Ga0209233_1000271 Ga0209233_100027151 403
313 3300025284 Ga0209130_1000038 Ga0209130_1000038125 403
314 3300025302 Ga0207426_1000081 Ga0207426_1000081165 403
315 3300025913 Ga0207695_10000024 Ga0207695_10000024484 403
316 3300025914 Ga0207671_10001033 Ga0207671_1000103332 403
317 3300026078 Ga0207702_10060372 Ga0207702_100603722 403
318 3300026142 Ga0207698_10149033 Ga0207698_101490332 403
319 3300027312 Ga0209371_1002612 Ga0209371_10026123 403
320 3300028379 Ga0268266_10099091 Ga0268266_100990912 403
321 3300030500 Ga0268256_1002306 Ga0268256_10023063 403
322 3300031616 Ga0307508_10031735 Ga0307508_100317355 403
323 3300042007 Ga0439449_0002007 Ga0439449_0002007_844_2190 403
324 3300044684 Ga0466966_0006828 Ga0466966_0006828_2914_4221 403
325 3300044684 Ga0466966_0114037 Ga0466966_0114037_36_1367 403
326 3300044693 Ga0466961_0001713 Ga0466961_0001713_3987_5294 403
327 3300044694 Ga0466963_0013795 Ga0466963_0013795_2799_4130 403
328 3300044765 Ga0466970_0002744 Ga0466970_0002744_4668_5975 403
329 3300044765 Ga0466970_0005938 Ga0466970_0005938_3014_4345 403
330 3300045049 Ga0466959_0001599 Ga0466959_0001599_8390_9697 403
331 3300045976 Ga0466967_0273145 Ga0466967_0273145_11_1342 403
332 3300046460 Ga0495638_0000032 Ga0495638_0000032_228321_229628 403
333 3300046558 Ga0495633_0000232 Ga0495633_0000232_5049_6356 403
334 3300046660 Ga0495625_0000118 Ga0495625_0000118_103711_105018 403
335 3300046660 Ga0495625_0000326 Ga0495625_0000326_52257_53564 403
336 3300047470 Ga0495681_0000091 Ga0495681_0000091_13930_15237 403
337 3300048903 Ga0496100_0044484 Ga0496100_0044484_667_1992 403
338 3300048906 Ga0496103_0021165 Ga0496103_0021165_650_1975 403
339 3300048920 Ga0496117_0033596 Ga0496117_0033596_2214_3539 403
340 3300048921 Ga0496118_0001729 Ga0496118_0001729_572_1897 403
341 3300048922 Ga0496119_0014796 Ga0496119_0014796_3021_4346 403
342 3300048924 Ga0496121_0003867 Ga0496121_0003867_16247_17572 403
343 3300048924 Ga0496121_0014859 Ga0496121_0014859_478_1803 403
344 3300048925 Ga0496122_0008923 Ga0496122_0008923_977_2368 403
345 3300048925 Ga0496122_0034273 Ga0496122_0034273_632_1957 403
346 3300048925 Ga0496122_0091061 Ga0496122_0091061_309_1634 403
347 3300048926 Ga0496123_0048314 Ga0496123_0048314_696_2021 403
348 3300048927 Ga0496124_0134119 Ga0496124_0134119_576_1901 403
349 3300048928 Ga0496125_0087396 Ga0496125_0087396_494_1819 403
350 3300048929 Ga0496126_0066081 Ga0496126_0066081_347_1672 403
351 3300049460 Ga0495682_0000105 Ga0495682_0000105_53995_55302 403
352 3300050492 nmdc:mga0yw44_152151_c1 nmdc:mga0yw44_152151_c1_144_1460 403
353 3300050496 nmdc:mga07m45_6637_c1 nmdc:mga07m45_6637_c1_620_1936 403
354 3300050516 nmdc:mga0sz30_1704_c1 nmdc:mga0sz30_1704_c1_3798_5114 403
355 3300060346 Ga0587111_0011353 Ga0587111_0011353_166_1491 403
356 iso_pu_bacteria 2508501122 2509110296 403
357 iso_pu_bacteria 2509276019 2509377262 403
358 iso_pu_bacteria 2510917022 2511133899 403
359 iso_pu_bacteria 2513237351 2514592536 403
360 iso_pu_bacteria 2516143018 2516206748 403
361 iso_pu_bacteria 2524023209 2524457759 403
362 iso_pu_bacteria 2545555834 2545679348 403
363 iso_pu_bacteria 2558860100 2558862213 403
364 iso_pu_bacteria 2582581307 2585276671 403
365 iso_pu_bacteria 2582581308 2585278642 403
366 iso_pu_bacteria 2582581315 2585325742 403
367 iso_pu_bacteria 2582581316 2585329911 403
368 iso_pu_bacteria 2585427527 2585536292 403
369 iso_pu_bacteria 2585427530 2585554166 403
370 iso_pu_bacteria 2585427531 2585560357 403
371 iso_pu_bacteria 2585427608 2585901369 403
372 iso_pu_bacteria 2585427609 2585905457 403
373 iso_pu_bacteria 2585428125 2587979427 403
374 iso_pu_bacteria 2615840626 2616306083 403
375 iso_pu_bacteria 2615840698 2616553663 403
376 iso_pu_bacteria 2617270742 2617382066 403
377 iso_pu_bacteria 2667528174 2671112608 403
378 iso_pu_bacteria 2690316117 2692319148 403
379 iso_pu_bacteria 2738543024 2739310318 403
380 iso_pu_bacteria 2751185821 2753463855 403
381 iso_pu_bacteria 2775507266 2778174406 403
382 iso_pu_bacteria 2791355091 2792621576 403
383 iso_pu_bacteria 2791355092 2792627737 403
384 iso_pu_bacteria 2791355094 2792640303 403
385 iso_pu_bacteria 2818991448 2819608156 403
386 iso_pu_bacteria 2818991453 2819639514 403
387 iso_pu_bacteria 2818991467 2819717846 403
388 iso_pu_bacteria 2838029111 2838031161 403
389 iso_pu_bacteria 2842298080 2842300626 403
390 iso_pu_bacteria 2842357229 2842358256 403
391 iso_pu_bacteria 2842475841 2842478244 403
392 iso_pu_bacteria 2842482326 2842482598 403
393 iso_pu_bacteria 2842502639 2842505053 403
394 iso_pu_bacteria 2842509118 2842509447 403
395 iso_pu_bacteria 2847417321 2847422346 403
396 iso_pu_bacteria 2848992105 2848998205 403
397 iso_pu_bacteria 2850079185 2850085400 403
398 iso_pu_bacteria 2852387548 2852388780 403
399 iso_pu_bacteria 2855872281 2855875728 403
400 iso_pu_bacteria 2886627955 2886632548 403
401 iso_pu_bacteria 2909042592 2909045654 403
402 iso_pu_bacteria 2919408235 2919409043 403
403 iso_pu_bacteria 3005416602 3005417584 403
404 iso_pu_bacteria 641522639 641644567 403
405 iso_pu_bacteria 643692032 643823730 403
406 iso_pu_bacteria 8005314921 8005314939 403
407 iso_pu_bacteria 8005484373 8005485893 403
408 iso_pu_bacteria 8005645114 8005646726 403
409 iso_pu_bacteria 8005658619 8005661211 403
410 iso_pu_bacteria 8005682033 8005684868 403
411 iso_pu_bacteria 8024486573 8024490279 403
412 iso_pu_bacteria 8046767195 8046769738 403
413 iso_pu_bacteria 8057575449 8057577353 403
414 3300003187 JGI25151J46595_10000723 JGI25151J46595_1000072311 404
415 3300003354 JGI25160J50197_1000782 JGI25160J50197_100078215 404
416 3300003374 JGI25161J50226_1004458 JGI25161J50226_10044584 404
417 3300003771 Ga0055526_1007484 Ga0055526_10074846 404
418 3300003790 Ga0055528_1000331 Ga0055528_100033135 404
419 3300003792 Ga0055540_1000508 Ga0055540_100050827 404
420 3300004625 Ga0055543_1002085 Ga0055543_10020854 404
421 3300005365 Ga0070688_100041762 Ga0070688_1000417622 404
422 3300005456 Ga0070678_100018012 Ga0070678_1000180126 404
423 3300006038 Ga0075365_10000388 Ga0075365_1000038816 404
424 3300006178 Ga0075367_10001308 Ga0075367_100013085 404
425 3300006353 Ga0075370_10039003 Ga0075370_100390033 404
426 3300009765 Ga0123341_1000576 Ga0123341_100057626 404
427 3300025272 Ga0209455_1001167 Ga0209455_10011674 404
428 3300025273 Ga0209673_1000384 Ga0209673_100038411 404
429 3300025273 Ga0209673_1005485 Ga0209673_10054852 404
430 3300025273 Ga0209673_1005540 Ga0209673_10055402 404
431 3300025294 Ga0209025_1000058 Ga0209025_1000058202 404
432 3300025295 Ga0209564_1000388 Ga0209564_100038811 404
433 3300025295 Ga0209564_1000458 Ga0209564_10004584 404
434 3300025297 Ga0209758_1001805 Ga0209758_100180518 404
435 3300025297 Ga0209758_1007127 Ga0209758_10071272 404
436 3300025299 Ga0209256_1001984 Ga0209256_100198413 404
437 3300025299 Ga0209256_1016697 Ga0209256_10166972 404
438 3300025302 Ga0207426_1001412 Ga0207426_100141217 404
439 3300025303 Ga0209051_1002798 Ga0209051_100279811 404
440 3300025304 Ga0209257_1001598 Ga0209257_100159811 404
441 3300025938 Ga0207704_10059725 Ga0207704_100597252 404
442 3300025940 Ga0207691_10052459 Ga0207691_100524593 404
443 3300026089 Ga0207648_10044647 Ga0207648_100446472 404
444 3300026121 Ga0207683_10024976 Ga0207683_100249766 404
445 3300028577 Ga0265318_10034433 Ga0265318_100344332 404
446 3300028794 Ga0307515_10005688 Ga0307515_1000568814 404
447 3300031456 Ga0307513_10046157 Ga0307513_100461574 404
448 3300041413 Ga0439465_0010016 Ga0439465_0010016_269_1600 404
449 3300041441 Ga0451787_044841 Ga0451787_044841_384_1715 404
450 3300041512 Ga0451853_1774076 Ga0451853_1774076_75_1406 404
451 3300042006 Ga0439432_017708 Ga0439432_017708_923_2254 404
452 3300046452 Ga0495617_024020 Ga0495617_024020_453_1784 404
453 3300046474 Ga0495605_0041683 Ga0495605_0041683_583_1914 404
454 3300046492 Ga0495585_0006766 Ga0495585_0006766_4599_5930 404
455 3300046492 Ga0495585_0058989 Ga0495585_0058989_638_1969 404
456 3300046501 Ga0495607_0052311 Ga0495607_0052311_616_1947 404
457 3300046506 Ga0495583_0003636 Ga0495583_0003636_8156_9487 404
458 3300046515 Ga0495620_0032172 Ga0495620_0032172_277_1608 404
459 3300046518 Ga0495631_0035123 Ga0495631_0035123_282_1613 404
460 3300046518 Ga0495631_0067618 Ga0495631_0067618_93_1424 404
461 3300046519 Ga0495632_0041211 Ga0495632_0041211_702_2033 404
462 3300046522 Ga0495643_0037042 Ga0495643_0037042_30_1361 404
463 3300046530 Ga0495654_0025092 Ga0495654_0025092_808_2139 404
464 3300046615 Ga0495656_0031338 Ga0495656_0031338_26_1357 404
465 3300046660 Ga0495625_0028356 Ga0495625_0028356_964_2295 404
466 3300046665 Ga0495661_0077909 Ga0495661_0077909_462_1793 404
467 3300046794 Ga0495589_0029632 Ga0495589_0029632_88_1419 404
468 3300046810 Ga0495660_0018736 Ga0495660_0018736_1740_3071 404
469 3300047443 Ga0495687_059714 Ga0495687_059714_40_1371 404
470 3300047470 Ga0495681_0033089 Ga0495681_0033089_244_1575 404
471 3300048921 Ga0496118_0008530 Ga0496118_0008530_5555_6886 404
472 3300050494 nmdc:mga06z11_44862_c1 nmdc:mga06z11_44862_c1_259_1590 404
473 3300050496 nmdc:mga07m45_928_c1 nmdc:mga07m45_928_c1_108_1439 404
474 3300053134 Ga0500658_0000578 Ga0500658_0000578_13469_14800 404
475 3300053139 Ga0500568_0000366 Ga0500568_0000366_22849_24198 404
476 3300053153 Ga0500616_0006752 Ga0500616_0006752_30_1361 404
477 3300053156 Ga0500622_0042881 Ga0500622_0042881_485_1816 404
478 iso_pu_bacteria 2509276021 2509392194 404
479 iso_pu_bacteria 2509276033 2509445840 404
480 iso_pu_bacteria 2509276033 2509446856 404
481 iso_pu_bacteria 2510065019 2510133807 404
482 iso_pu_bacteria 2510461076 2510895236 404
483 iso_pu_bacteria 2513237084 2513574153 404
484 iso_pu_bacteria 2513237085 2513576811 404
485 iso_pu_bacteria 2513237093 2513629541 404
486 iso_pu_bacteria 2513237103 2513708183 404
487 iso_pu_bacteria 2513237138 2513871026 404
488 iso_pu_bacteria 2513237144 2513910687 404
489 iso_pu_bacteria 2513237146 2513927293 404
490 iso_pu_bacteria 2513237162 2514020144 404
491 iso_pu_bacteria 2515075009 2515112852 404
492 iso_pu_bacteria 2515154113 2515636460 404
493 iso_pu_bacteria 2515154114 2515640824 404
494 iso_pu_bacteria 2515154116 2515655492 404
495 iso_pu_bacteria 2515154134 2515739349 404
496 iso_pu_bacteria 2516653077 2517036560 404
497 iso_pu_bacteria 2516653085 2517076930 404
498 iso_pu_bacteria 2517093000 2517095692 404
499 iso_pu_bacteria 2517287029 2517407253 404
500 iso_pu_bacteria 2529292951 2530646151 404
501 iso_pu_bacteria 2582581299 2585231701 404
502 iso_pu_bacteria 2582581304 2585256051 404
503 iso_pu_bacteria 2582581867 2585404387 404
504 iso_pu_bacteria 2585427526 2585527307 404
505 iso_pu_bacteria 2585427528 2585538045 404
506 iso_pu_bacteria 2585427590 2585824705 404
507 iso_pu_bacteria 2585427593 2585835993 404
508 iso_pu_bacteria 2599185170 2599415265 404
509 iso_pu_bacteria 2615840624 2616293513 404
510 iso_pu_bacteria 2643221634 2644193467 404
511 iso_pu_bacteria 2718217882 2719181663 404
512 iso_pu_bacteria 2718217927 2719386195 404
513 iso_pu_bacteria 2718217997 2719666004 404
514 iso_pu_bacteria 2718218009 2719732327 404
515 iso_pu_bacteria 2718218199 2720492424 404
516 iso_pu_bacteria 2718218232 2720613779 404
517 iso_pu_bacteria 2718218233 2720620567 404
518 iso_pu_bacteria 2718218235 2720631992 404
519 iso_pu_bacteria 2718218269 2720775720 404
520 iso_pu_bacteria 2718218363 2721147755 404
521 iso_pu_bacteria 2718218365 2721159202 404
522 iso_pu_bacteria 2718218366 2721164590 404
523 iso_pu_bacteria 2718218423 2721399977 404
524 iso_pu_bacteria 2721755514 2722840760 404
525 iso_pu_bacteria 2721755556 2723027327 404
526 iso_pu_bacteria 2721755684 2723560946 404
527 iso_pu_bacteria 2721755685 2723567539 404
528 iso_pu_bacteria 2721755809 2724038790 404
529 iso_pu_bacteria 2721755810 2724045083 404
530 iso_pu_bacteria 2721755819 2724090327 404
531 iso_pu_bacteria 2721755822 2724104804 404
532 iso_pu_bacteria 2721755823 2724110606 404
533 iso_pu_bacteria 2724679232 2725952701 404
534 iso_pu_bacteria 2728369352 2730108263 404
535 iso_pu_bacteria 2728369365 2730164898 404
536 iso_pu_bacteria 2728369397 2730298834 404
537 iso_pu_bacteria 2738541333 2739032702 404
538 iso_pu_bacteria 2765235942 2766065729 404
539 iso_pu_bacteria 2791355256 2793298706 404
540 iso_pu_bacteria 2791355259 2793314677 404
541 iso_pu_bacteria 2791355260 2793320512 404
542 iso_pu_bacteria 2791355261 2793330447 404
543 iso_pu_bacteria 2791355262 2793338329 404
544 iso_pu_bacteria 2791355263 2793339067 404
545 iso_pu_bacteria 2791355264 2793348735 404
546 iso_pu_bacteria 2791355265 2793351973 404
547 iso_pu_bacteria 2791355266 2793363851 404
548 iso_pu_bacteria 2791355267 2793370327 404
549 iso_pu_bacteria 2802429605 2805930996 404
550 iso_pu_bacteria 2802429606 2805937990 404
551 iso_pu_bacteria 2802429633 2806043682 404
552 iso_pu_bacteria 2802429636 2806064585 404
553 iso_pu_bacteria 2802429637 2806071852 404
554 iso_pu_bacteria 2838016132 2838017808 404
555 iso_pu_bacteria 2838022645 2838028597 404
556 iso_pu_bacteria 2838035591 2838039010 404
557 iso_pu_bacteria 2838042994 2838043831 404
558 iso_pu_bacteria 2838048938 2838051901 404
559 iso_pu_bacteria 2838061910 2838068321 404
560 iso_pu_bacteria 2838068647 2838070297 404
561 iso_pu_bacteria 2838661181 2838664398 404
562 iso_pu_bacteria 2838668709 2838674149 404
563 iso_pu_bacteria 2838680041 2838681749 404
564 iso_pu_bacteria 2838686498 2838687190 404
565 iso_pu_bacteria 2838694306 2838696321 404
566 iso_pu_bacteria 2838701080 2838706605 404
567 iso_pu_bacteria 2838707686 2838710440 404
568 iso_pu_bacteria 2838729681 2838729838 404
569 iso_pu_bacteria 2838742623 2838743147 404
570 iso_pu_bacteria 2841851746 2841852633 404
571 iso_pu_bacteria 2841864319 2841869935 404
572 iso_pu_bacteria 2842077413 2842078614 404
573 iso_pu_bacteria 2842110456 2842114840 404
574 iso_pu_bacteria 2842118031 2842118877 404
575 iso_pu_bacteria 2842146304 2842151340 404
576 iso_pu_bacteria 2842156927 2842157907 404
577 iso_pu_bacteria 2842163707 2842167545 404
578 iso_pu_bacteria 2842180545 2842181526 404
579 iso_pu_bacteria 2842192696 2842198412 404
580 iso_pu_bacteria 2842198810 2842204625 404
581 iso_pu_bacteria 2842205361 2842205626 404
582 iso_pu_bacteria 2842217011 2842217790 404
583 iso_pu_bacteria 2842229732 2842230423 404
584 iso_pu_bacteria 2842237096 2842239852 404
585 iso_pu_bacteria 2842243621 2842244325 404
586 iso_pu_bacteria 2842250916 2842256343 404
587 iso_pu_bacteria 2842257432 2842257589 404
588 iso_pu_bacteria 2842264693 2842266110 404
589 iso_pu_bacteria 2842271015 2842271272 404
590 iso_pu_bacteria 2842278818 2842279083 404
591 iso_pu_bacteria 2842285085 2842285749 404
592 iso_pu_bacteria 2842291075 2842292276 404
593 iso_pu_bacteria 2842304105 2842304900 404
594 iso_pu_bacteria 2842311132 2842315063 404
595 iso_pu_bacteria 2842317721 2842320561 404
596 iso_pu_bacteria 2842341865 2842346318 404
597 iso_pu_bacteria 2842363717 2842369102 404
598 iso_pu_bacteria 2842370503 2842372316 404
599 iso_pu_bacteria 2842377471 2842378673 404
600 iso_pu_bacteria 2842384541 2842385387 404
601 iso_pu_bacteria 2842395702 2842401930 404
602 iso_pu_bacteria 2842402390 2842403108 404
603 iso_pu_bacteria 2842409023 2842409519 404
604 iso_pu_bacteria 2842415677 2842416171 404
605 iso_pu_bacteria 2842422224 2842423911 404
606 iso_pu_bacteria 2842428310 2842430573 404
607 iso_pu_bacteria 2842434925 2842437440 404
608 iso_pu_bacteria 2842441272 2842443810 404
609 iso_pu_bacteria 2842447887 2842454466 404
610 iso_pu_bacteria 2842462802 2842464716 404
611 iso_pu_bacteria 2842469257 2842472058 404
612 iso_pu_bacteria 2842489311 2842490433 404
613 iso_pu_bacteria 2842495871 2842496975 404
614 iso_pu_bacteria 2844454524 2844458556 404
615 iso_pu_bacteria 2857516855 2857517577 404
616 iso_pu_bacteria 2923556063 2923559900 404
617 iso_pu_bacteria 2933016740 2933017894 404
618 iso_pu_bacteria 2933570622 2933570708 404
619 iso_pu_bacteria 2933586486 2933591212 404
620 iso_pu_bacteria 2933599457 2933601102 404
621 iso_pu_bacteria 2935894831 2935900674 404
622 iso_pu_bacteria 2935901341 2935902094 404
623 iso_pu_bacteria 2936367885 2936372185 404
624 iso_pu_bacteria 2936375103 2936381012 404
625 iso_pu_bacteria 2936381700 2936383033 404
626 iso_pu_bacteria 2996893221 2996896495 404
627 iso_pu_bacteria 3005409236 3005413524 404
628 iso_pu_bacteria 639633055 639649056 404
629 iso_pu_bacteria 643348564 643601816 404
630 iso_pu_bacteria 8005275841 8005280985 404
631 iso_pu_bacteria 8005282627 8005283412 404
632 iso_pu_bacteria 8005289223 8005293494 404
633 iso_pu_bacteria 8005301065 8005302967 404
634 iso_pu_bacteria 8005307578 8005312694 404
635 iso_pu_bacteria 8005376324 8005380784 404
636 iso_pu_bacteria 8005395548 8005396274 404
637 iso_pu_bacteria 8005430974 8005434999 404
638 iso_pu_bacteria 8005460587 8005463527 404
639 iso_pu_bacteria 8005497431 8005500740 404
640 iso_pu_bacteria 8005556819 8005557157 404
641 iso_pu_bacteria 8005563573 8005567847 404
642 iso_pu_bacteria 8005570704 8005573607 404
643 iso_pu_bacteria 8005619151 8005622113 404
644 iso_pu_bacteria 8005626139 8005632404 404
645 iso_pu_bacteria 8005668836 8005672158 404
646 iso_pu_bacteria 8005688590 8005692264 404
647 iso_pu_bacteria 8005695170 8005699726 404
648 iso_pu_bacteria 8018127388 8018133933 404
649 iso_pu_bacteria 8018163183 8018166237 404
650 iso_pu_bacteria 8018176218 8018181467 404
651 iso_pu_bacteria 8023680758 8023683308 404
652 iso_pu_bacteria 8024479707 8024483010 404
653 iso_pu_bacteria 8024501048 8024503923 404
654 iso_pu_bacteria 8056375014 8056378371 404
655 iso_pu_bacteria 8056382006 8056386578 404
656 iso_pu_bacteria 8057874678 8057877384 404
657 3300006353 Ga0075370_10005893 Ga0075370_100058935 405
658 3300045051 Ga0451576_0029706 Ga0451576_0029706_240_1556 405
659 3300048929 Ga0496126_0158160 Ga0496126_0158160_497_1834 405
660 3300049569 Ga0501032_0097438 Ga0501032_0097438_471_1808 405
661 3300049571 Ga0501034_0141850 Ga0501034_0141850_134_1471 405
662 3300049572 Ga0501036_0126188 Ga0501036_0126188_216_1553 405
663 3300049582 Ga0501048_0025351 Ga0501048_0025351_2552_3889 405
664 3300049822 Ga0501035_0117345 Ga0501035_0117345_652_1989 405
665 iso_pu_bacteria 2757320392 2757571154 405
666 iso_pu_bacteria 2888578766 2888580666 405
667 iso_pu_bacteria 2889049205 2889050679 405
668 iso_pu_bacteria 3003665799 3003670394 405
669 iso_pu_bacteria 8005382845 8005385355 405
670 3300005445 Ga0070708_100264862 Ga0070708_1002648622 406
671 3300005471 Ga0070698_100141780 Ga0070698_1001417801 406
672 3300009093 Ga0105240_10083097 Ga0105240_100830972 406
673 3300025913 Ga0207695_10154117 Ga0207695_101541172 406
674 3300025922 Ga0207646_10015623 Ga0207646_100156235 406
675 3300032126 Ga0307415_100181588 Ga0307415_1001815882 406
676 3300045051 Ga0451576_0003396 Ga0451576_0003396_11682_13004 406
677 3300049576 Ga0501040_0052172 Ga0501040_0052172_621_1961 406
678 iso_pu_bacteria 2721755755 2723845644 406
679 iso_pu_bacteria 2929199973 2929201880 406
680 iso_pu_bacteria 8055909800 8055910871 406
681 3300005548 Ga0070665_100000062 Ga0070665_100000062196 407
682 3300014326 Ga0157380_10367686 Ga0157380_103676861 407
683 3300028379 Ga0268266_10000001 Ga0268266_100000011874 407
684 3300031548 Ga0307408_100066548 Ga0307408_1000665482 407
685 3300032002 Ga0307416_100167753 Ga0307416_1001677532 407
686 3300044712 Ga0453684_0126109 Ga0453684_0126109_430_1737 407
687 3300046522 Ga0495643_0048962 Ga0495643_0048962_435_1757 407
688 3300049591 Ga0501075_0119491 Ga0501075_0119491_15_1400 407
689 3300053156 Ga0500622_0056464 Ga0500622_0056464_229_1551 407
690 3300053161 Ga0500634_0024095 Ga0500634_0024095_1495_2841 407
691 iso_pu_bacteria 2767802442 2770200427 407
692 iso_pu_bacteria 2791355123 2792746114 407
693 iso_pu_bacteria 2939669807 2939670501 407
694 iso_pu_bacteria 2958064165 2958065540 407
695 3300003322 rootL2_10112396 rootL2_101123962 408
696 3300005618 Ga0068864_100018691 Ga0068864_1000186913 408
697 3300025908 Ga0207643_10019727 Ga0207643_100197274 408
698 3300026095 Ga0207676_10068903 Ga0207676_100689034 408
699 3300049515 Ga0501292_005106 Ga0501292_005106_226_1524 408
700 3300049522 Ga0501299_002807 Ga0501299_002807_95_1393 408
701 iso_pu_bacteria 2534681796 2535518410 408
702 iso_pu_bacteria 8005542996 8005549323 408
703 3300005293 Ga0065715_10144541 Ga0065715_101445411 409
704 3300005334 Ga0068869_100164561 Ga0068869_1001645612 409
705 3300005617 Ga0068859_100047771 Ga0068859_1000477713 409
706 3300006931 Ga0097620_100047772 Ga0097620_1000477722 409
707 3300009094 Ga0111539_10018085 Ga0111539_100180852 409
708 3300049589 Ga0501073_0132844 Ga0501073_0132844_277_1626 409
709 3300049822 Ga0501035_0104174 Ga0501035_0104174_397_1746 409
710 3300060353 Ga0501082_0001805 Ga0501082_0001805_17244_18740 409
711 3300005364 Ga0070673_100004801 Ga0070673_1000048012 410
712 3300005441 Ga0070700_100066774 Ga0070700_1000667742 410
713 3300005546 Ga0070696_100032609 Ga0070696_1000326092 410
714 3300013308 Ga0157375_10162492 Ga0157375_101624922 410
715 3300026075 Ga0207708_10053629 Ga0207708_100536292 410
716 3300003214 JGI25165J46597_1000028 JGI25165J46597_1000028246 412
717 3300025261 Ga0209233_1000087 Ga0209233_1000087248 412
718 3300005331 Ga0070670_100088723 Ga0070670_1000887233 415
719 3300005546 Ga0070696_100162136 Ga0070696_1001621361 415
720 3300005844 Ga0068862_100130067 Ga0068862_1001300672 415
721 3300009174 Ga0105241_10030333 Ga0105241_100303333 415
722 3300013306 Ga0163162_10076836 Ga0163162_100768362 415
723 3300031911 Ga0307412_10117185 Ga0307412_101171852 415
724 3300032004 Ga0307414_10143445 Ga0307414_101434453 419
725 3300049705 Ga0501225_0005946 Ga0501225_0005946_183_1562 419
726 3300049779 Ga0501283_000179 Ga0501283_000179_797_2176 419
727 3300005339 Ga0070660_100088287 Ga0070660_1000882872 420
728 3300005539 Ga0068853_100025963 Ga0068853_1000259632 420
729 3300005843 Ga0068860_100091604 Ga0068860_1000916042 420
730 3300006237 Ga0097621_100000830 Ga0097621_10000083011 420
731 3300006358 Ga0068871_100013903 Ga0068871_1000139032 420
732 3300025904 Ga0207647_10006297 Ga0207647_100062973 420
733 3300026041 Ga0207639_10196110 Ga0207639_101961102 420
734 3300031548 Ga0307408_100002979 Ga0307408_10000297912 420
735 3300031731 Ga0307405_10005397 Ga0307405_100053975 420
736 3300031901 Ga0307406_10001179 Ga0307406_100011798 420
737 3300031911 Ga0307412_10006822 Ga0307412_100068224 420
738 3300032004 Ga0307414_10002528 Ga0307414_100025282 420
739 3300032126 Ga0307415_100000420 Ga0307415_10000042010 420
740 3300049649 Ga0501198_000362 Ga0501198_000362_483_1880 420
741 3300049652 Ga0501202_000781 Ga0501202_000781_827_2224 420
742 3300049654 Ga0501207_000403 Ga0501207_000403_421_1818 420
743 3300049660 Ga0501216_000695 Ga0501216_000695_160_1557 420
744 3300049661 Ga0501217_000196 Ga0501217_000196_3789_5186 420
745 3300049663 Ga0501223_000642 Ga0501223_000642_1225_2622 420
746 3300049664 Ga0501224_000087 Ga0501224_000087_4904_6301 420
747 3300049668 Ga0501233_000366 Ga0501233_000366_25_1422 420
748 3300049669 Ga0501235_001486 Ga0501235_001486_2598_3995 420
749 3300049675 Ga0501243_002548 Ga0501243_002548_1226_2623 420
750 3300049688 Ga0501259_002323 Ga0501259_002323_523_1920 420
751 3300049707 Ga0501234_000618 Ga0501234_000618_3600_4997 420
752 3300049851 Ga0501212_000171 Ga0501212_000171_2449_3846 420
753 3300049853 Ga0501226_000297 Ga0501226_000297_1599_2996 420
754 3300005444 Ga0070694_100168259 Ga0070694_1001682591 421
755 3300014325 Ga0163163_10151820 Ga0163163_101518201 421
756 3300000531 CNBas_1000573 CNBas_10005731 422

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01595

CNNM

Cyclin M transmembrane N-terminal domain

60

256

0.97

PF03471

CorC_HlyC

Transporter associated domain

404

484

0.94

PF00571

CBS

CBS domain

339

391

0.86

Feature Viewer

pLDDT pTM Quality
76.99 0.43 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map