F479470
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 759 | 275 | 759 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300005353|Ga0070669_101141321|Ga0070669_1011413211 |
| Length | 153 |
| Sequence | VLLCYVTSTLRAADAGTGAADVIVRPNPSSGVPIYLQLMEQVKHNIETGALRPGDQLPGIRPLAEELVINPNTVAKAYRELEHEGIIELRHGAGAFVSHAAGEKKLTERLRAGQTIVAATVDKLRSRGVTEAEIRRLFEAELTRQAVRGGSRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 103 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 169 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 173 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 174 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 175 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 176 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 177 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 178 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 179 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 180 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 181 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 182 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 183 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 184 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 187 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 189 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 192 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 193 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 194 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 198 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 200 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 203 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 204 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 207 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 208 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 211 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 212 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 213 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 214 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 240 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 241 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 242 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 245 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 246 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 247 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 248 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 249 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 250 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 255 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 256 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 257 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 258 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 259 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 260 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 273 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 274 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 275 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.98 |
| Nodule | 0 |
| Rhizoplane | 3.16 |
| Rhizosphere | 94.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065704_10078187 | 3300005289 | Bacteria | 4505 |
| 2 | Ga0065712_10823906 | 3300005290 | Bacteria | 502 |
| 3 | Ga0065707_10084528 | 3300005295 | Bacteria | 7098 |
| 4 | Ga0065707_10202879 | 3300005295 | Bacteria | 1295 |
| 5 | Ga0065707_10351777 | 3300005295 | Bacteria | 913 |
| 6 | Ga0070658_10395581 | 3300005327 | Bacteria | 1186 |
| 7 | Ga0070676_10206447 | 3300005328 | Bacteria | 1290 |
| 8 | Ga0070676_10625261 | 3300005328 | Bacteria | 779 |
| 9 | Ga0070676_10812490 | 3300005328 | Bacteria | 691 |
| 10 | Ga0070683_100317533 | 3300005329 | Unclassified | 1482 |
| 11 | Ga0070690_100004924 | 3300005330 | Bacteria | 7470 |
| 12 | Ga0070690_100090506 | 3300005330 | Bacteria | 2015 |
| 13 | Ga0070670_101138390 | 3300005331 | Bacteria | 712 |
| 14 | Ga0068869_100035909 | 3300005334 | Bacteria | 3516 |
| 15 | Ga0068869_100050073 | 3300005334 | Bacteria | 3027 |
| 16 | Ga0068869_100432584 | 3300005334 | Bacteria | 1088 |
| 17 | Ga0068869_100490718 | 3300005334 | Bacteria | 1024 |
| 18 | Ga0070666_10003143 | 3300005335 | Bacteria | 10025 |
| 19 | Ga0070680_100262195 | 3300005336 | Bacteria | 1462 |
| 20 | Ga0070680_100330327 | 3300005336 | Bacteria | 1295 |
| 21 | Ga0070680_100974999 | 3300005336 | Bacteria | 732 |
| 22 | Ga0070682_100012320 | 3300005337 | Bacteria | 4901 |
| 23 | Ga0068868_100018237 | 3300005338 | Bacteria | 5243 |
| 24 | Ga0070689_100006826 | 3300005340 | Bacteria | 7941 |
| 25 | Ga0070689_100324644 | 3300005340 | Bacteria | 1286 |
| 26 | Ga0070689_100376298 | 3300005340 | Bacteria | 1196 |
| 27 | Ga0070689_100999882 | 3300005340 | Bacteria | 744 |
| 28 | Ga0070689_101292821 | 3300005340 | Bacteria | 657 |
| 29 | Ga0070689_101797092 | 3300005340 | Bacteria | 559 |
| 30 | Ga0070691_10017688 | 3300005341 | Bacteria | 3281 |
| 31 | Ga0070691_10931129 | 3300005341 | Bacteria | 538 |
| 32 | Ga0070687_100064604 | 3300005343 | Bacteria | 1945 |
| 33 | Ga0070687_100302919 | 3300005343 | Unclassified | 1015 |
| 34 | Ga0070687_100917726 | 3300005343 | Bacteria | 629 |
| 35 | Ga0070692_10157375 | 3300005345 | Bacteria | 1299 |
| 36 | Ga0070669_100005125 | 3300005353 | Bacteria | 9477 |
| 37 | Ga0070669_100105382 | 3300005353 | Bacteria | 2133 |
| 38 | Ga0070669_101141321 | 3300005353 | Bacteria | 672 |
| 39 | Ga0070675_100026987 | 3300005354 | Bacteria | 4612 |
| 40 | Ga0070675_100070231 | 3300005354 | Unclassified | 2902 |
| 41 | Ga0070675_101754137 | 3300005354 | Bacteria | 573 |
| 42 | Ga0070671_101310663 | 3300005355 | Bacteria | 639 |
| 43 | Ga0070674_100345651 | 3300005356 | Bacteria | 1200 |
| 44 | Ga0070674_100801129 | 3300005356 | Bacteria | 813 |
| 45 | Ga0070674_101917243 | 3300005356 | Bacteria | 539 |
| 46 | Ga0070673_100169786 | 3300005364 | Bacteria | 1861 |
| 47 | Ga0070673_101242566 | 3300005364 | Bacteria | 699 |
| 48 | Ga0070673_101808543 | 3300005364 | Bacteria | 579 |
| 49 | Ga0070688_100120949 | 3300005365 | Bacteria | 1754 |
| 50 | Ga0070688_100123277 | 3300005365 | Bacteria | 1739 |
| 51 | Ga0070688_100374414 | 3300005365 | Bacteria | 1048 |
| 52 | Ga0070659_100725167 | 3300005366 | Bacteria | 861 |
| 53 | Ga0070659_101296120 | 3300005366 | Unclassified | 646 |
| 54 | Ga0070667_100980608 | 3300005367 | Bacteria | 788 |
| 55 | Ga0070713_100088982 | 3300005436 | Unclassified | 2652 |
| 56 | Ga0070710_11282513 | 3300005437 | Bacteria | 544 |
| 57 | Ga0070701_10145340 | 3300005438 | Unclassified | 1360 |
| 58 | Ga0070701_10257855 | 3300005438 | Bacteria | 1055 |
| 59 | Ga0070711_100095835 | 3300005439 | Bacteria | 2148 |
| 60 | Ga0070705_100234131 | 3300005440 | Bacteria | 1280 |
| 61 | Ga0070705_100337544 | 3300005440 | Bacteria | 1094 |
| 62 | Ga0070705_101052570 | 3300005440 | Bacteria | 663 |
| 63 | Ga0070700_100004491 | 3300005441 | Bacteria | 7290 |
| 64 | Ga0070700_100150393 | 3300005441 | Bacteria | 1592 |
| 65 | Ga0070700_100180565 | 3300005441 | Bacteria | 1468 |
| 66 | Ga0070700_100221466 | 3300005441 | Bacteria | 1341 |
| 67 | Ga0070700_100231514 | 3300005441 | Bacteria | 1315 |
| 68 | Ga0070694_100020284 | 3300005444 | Bacteria | 4235 |
| 69 | Ga0070694_100635375 | 3300005444 | Bacteria | 863 |
| 70 | Ga0070694_100919842 | 3300005444 | Bacteria | 723 |
| 71 | Ga0070708_100022843 | 3300005445 | Bacteria | 5311 |
| 72 | Ga0070663_100020449 | 3300005455 | Bacteria | 4384 |
| 73 | Ga0070678_100125812 | 3300005456 | Bacteria | 2028 |
| 74 | Ga0070678_100707635 | 3300005456 | Unclassified | 908 |
| 75 | Ga0070662_100031938 | 3300005457 | Bacteria | 3699 |
| 76 | Ga0070662_100360256 | 3300005457 | Bacteria | 1193 |
| 77 | Ga0070662_100722412 | 3300005457 | Bacteria | 844 |
| 78 | Ga0068867_100009585 | 3300005459 | Bacteria | 6827 |
| 79 | Ga0068867_101490588 | 3300005459 | Bacteria | 630 |
| 80 | Ga0070706_100304070 | 3300005467 | Bacteria | 1488 |
| 81 | Ga0070706_100796461 | 3300005467 | Bacteria | 875 |
| 82 | Ga0070706_101075290 | 3300005467 | Bacteria | 741 |
| 83 | Ga0070706_101264779 | 3300005467 | Bacteria | 677 |
| 84 | Ga0070706_101374146 | 3300005467 | Bacteria | 647 |
| 85 | Ga0070707_100310473 | 3300005468 | Bacteria | 1533 |
| 86 | Ga0070707_100559334 | 3300005468 | Bacteria | 1106 |
| 87 | Ga0070698_100004142 | 3300005471 | Bacteria | 15948 |
| 88 | Ga0070698_100026852 | 3300005471 | Bacteria | 5988 |
| 89 | Ga0070698_100189432 | 3300005471 | Bacteria | 1995 |
| 90 | Ga0070698_100194599 | 3300005471 | Bacteria | 1965 |
| 91 | Ga0070698_100217638 | 3300005471 | Bacteria | 1844 |
| 92 | Ga0070699_100004957 | 3300005518 | Bacteria | 11742 |
| 93 | Ga0070699_100177604 | 3300005518 | Bacteria | 1889 |
| 94 | Ga0070699_101301745 | 3300005518 | Bacteria | 667 |
| 95 | Ga0070684_100332131 | 3300005535 | Bacteria | 1397 |
| 96 | Ga0070684_100762004 | 3300005535 | Bacteria | 904 |
| 97 | Ga0070684_100782620 | 3300005535 | Bacteria | 891 |
| 98 | Ga0070684_102020383 | 3300005535 | Bacteria | 544 |
| 99 | Ga0070697_100049890 | 3300005536 | Bacteria | 3396 |
| 100 | Ga0070697_100302959 | 3300005536 | Bacteria | 1374 |
| 101 | Ga0070697_100481341 | 3300005536 | Bacteria | 1084 |
| 102 | Ga0070697_100584732 | 3300005536 | Bacteria | 981 |
| 103 | Ga0068853_102182565 | 3300005539 | Unclassified | 537 |
| 104 | Ga0070672_100182634 | 3300005543 | Bacteria | 1749 |
| 105 | Ga0070672_100971626 | 3300005543 | Bacteria | 752 |
| 106 | Ga0070686_100476676 | 3300005544 | Bacteria | 964 |
| 107 | Ga0070686_100555145 | 3300005544 | Bacteria | 899 |
| 108 | Ga0070686_100742458 | 3300005544 | Bacteria | 786 |
| 109 | Ga0070695_100045013 | 3300005545 | Bacteria | 2811 |
| 110 | Ga0070695_100145958 | 3300005545 | Bacteria | 1646 |
| 111 | Ga0070695_100249548 | 3300005545 | Bacteria | 1291 |
| 112 | Ga0070695_100363170 | 3300005545 | Bacteria | 1088 |
| 113 | Ga0070695_100652399 | 3300005545 | Bacteria | 831 |
| 114 | Ga0070696_100009861 | 3300005546 | Bacteria | 6388 |
| 115 | Ga0070696_100097790 | 3300005546 | Bacteria | 2099 |
| 116 | Ga0070696_100137056 | 3300005546 | Bacteria | 1785 |
| 117 | Ga0070696_100208053 | 3300005546 | Unclassified | 1463 |
| 118 | Ga0070696_100944289 | 3300005546 | Bacteria | 718 |
| 119 | Ga0070665_100002769 | 3300005548 | Bacteria | 19002 |
| 120 | Ga0070665_100009577 | 3300005548 | Bacteria | 9796 |
| 121 | Ga0070665_100481010 | 3300005548 | Bacteria | 1252 |
| 122 | Ga0070665_100741745 | 3300005548 | Bacteria | 995 |
| 123 | Ga0070704_100011386 | 3300005549 | Bacteria | 5450 |
| 124 | Ga0070704_100348025 | 3300005549 | Bacteria | 1250 |
| 125 | Ga0070704_101055739 | 3300005549 | Bacteria | 737 |
| 126 | Ga0070664_100061954 | 3300005564 | Bacteria | 3188 |
| 127 | Ga0070664_100225750 | 3300005564 | Bacteria | 1677 |
| 128 | Ga0068857_100310511 | 3300005577 | Bacteria | 1455 |
| 129 | Ga0068857_100904170 | 3300005577 | Bacteria | 847 |
| 130 | Ga0068857_102512445 | 3300005577 | Bacteria | 506 |
| 131 | Ga0068854_100348883 | 3300005578 | Bacteria | 1211 |
| 132 | Ga0068854_100724572 | 3300005578 | Bacteria | 860 |
| 133 | Ga0070702_100094102 | 3300005615 | Bacteria | 1824 |
| 134 | Ga0070702_100207918 | 3300005615 | Bacteria | 1300 |
| 135 | Ga0070702_101078281 | 3300005615 | Bacteria | 640 |
| 136 | Ga0068852_101406783 | 3300005616 | Bacteria | 720 |
| 137 | Ga0068859_100012194 | 3300005617 | Bacteria | 8640 |
| 138 | Ga0068859_100311125 | 3300005617 | Bacteria | 1669 |
| 139 | Ga0068859_100402503 | 3300005617 | Bacteria | 1465 |
| 140 | Ga0068859_100797851 | 3300005617 | Bacteria | 1032 |
| 141 | Ga0068859_101502178 | 3300005617 | Bacteria | 743 |
| 142 | Ga0068859_101838467 | 3300005617 | Bacteria | 669 |
| 143 | Ga0068864_100594986 | 3300005618 | Bacteria | 1073 |
| 144 | Ga0068864_100969643 | 3300005618 | Unclassified | 842 |
| 145 | Ga0068864_102364573 | 3300005618 | Bacteria | 538 |
| 146 | Ga0068866_10035697 | 3300005718 | Bacteria | 2430 |
| 147 | Ga0068866_10147042 | 3300005718 | Bacteria | 1360 |
| 148 | Ga0068866_10222854 | 3300005718 | Bacteria | 1139 |
| 149 | Ga0068866_10909040 | 3300005718 | Bacteria | 620 |
| 150 | Ga0068861_100000681 | 3300005719 | Bacteria | 20273 |
| 151 | Ga0068861_100014268 | 3300005719 | Bacteria | 5575 |
| 152 | Ga0068861_100053505 | 3300005719 | Bacteria | 3071 |
| 153 | Ga0068861_100155055 | 3300005719 | Bacteria | 1883 |
| 154 | Ga0068861_101031741 | 3300005719 | Bacteria | 787 |
| 155 | Ga0068851_10176965 | 3300005834 | Bacteria | 1180 |
| 156 | Ga0068870_10569804 | 3300005840 | Bacteria | 765 |
| 157 | Ga0068870_10609774 | 3300005840 | Bacteria | 743 |
| 158 | Ga0068870_10679606 | 3300005840 | Bacteria | 708 |
| 159 | Ga0068870_10931305 | 3300005840 | Bacteria | 616 |
| 160 | Ga0068870_11246658 | 3300005840 | Bacteria | 540 |
| 161 | Ga0068863_100235429 | 3300005841 | Bacteria | 1767 |
| 162 | Ga0068863_100298667 | 3300005841 | Bacteria | 1562 |
| 163 | Ga0068863_100315142 | 3300005841 | Bacteria | 1519 |
| 164 | Ga0068863_100400714 | 3300005841 | Unclassified | 1342 |
| 165 | Ga0068858_100008049 | 3300005842 | Bacteria | 10152 |
| 166 | Ga0068858_100016232 | 3300005842 | Bacteria | 6995 |
| 167 | Ga0068858_100020654 | 3300005842 | Bacteria | 6154 |
| 168 | Ga0068858_100034008 | 3300005842 | Bacteria | 4728 |
| 169 | Ga0068858_100212090 | 3300005842 | Bacteria | 1833 |
| 170 | Ga0068858_101474389 | 3300005842 | Bacteria | 671 |
| 171 | Ga0068858_102505917 | 3300005842 | Bacteria | 509 |
| 172 | Ga0068860_100013161 | 3300005843 | Bacteria | 8118 |
| 173 | Ga0068860_100131851 | 3300005843 | Bacteria | 2398 |
| 174 | Ga0068860_100157942 | 3300005843 | Bacteria | 2186 |
| 175 | Ga0068860_100247650 | 3300005843 | Bacteria | 1734 |
| 176 | Ga0068860_100474784 | 3300005843 | Bacteria | 1246 |
| 177 | Ga0068860_100865757 | 3300005843 | Bacteria | 919 |
| 178 | Ga0068860_100945359 | 3300005843 | Bacteria | 879 |
| 179 | Ga0068860_101871641 | 3300005843 | Unclassified | 622 |
| 180 | Ga0068860_102259180 | 3300005843 | Unclassified | 565 |
| 181 | Ga0068862_100022816 | 3300005844 | Bacteria | 5238 |
| 182 | Ga0068862_100077682 | 3300005844 | Bacteria | 2875 |
| 183 | Ga0068862_100078119 | 3300005844 | Bacteria | 2867 |
| 184 | Ga0068862_100161766 | 3300005844 | Bacteria | 1999 |
| 185 | Ga0068862_100313239 | 3300005844 | Bacteria | 1447 |
| 186 | Ga0068862_100801312 | 3300005844 | Bacteria | 920 |
| 187 | Ga0068862_100823686 | 3300005844 | Bacteria | 908 |
| 188 | Ga0068862_102602913 | 3300005844 | Bacteria | 518 |
| 189 | Ga0081455_10122650 | 3300005937 | Bacteria | 2045 |
| 190 | Ga0081455_10138036 | 3300005937 | Bacteria | 1897 |
| 191 | Ga0081455_10453137 | 3300005937 | Unclassified | 876 |
| 192 | Ga0081539_10000108 | 3300005985 | Bacteria | 195322 |
| 193 | Ga0081539_10002107 | 3300005985 | Bacteria | 29488 |
| 194 | Ga0081539_10025531 | 3300005985 | Bacteria | 3802 |
| 195 | Ga0081539_10100914 | 3300005985 | Bacteria | 1471 |
| 196 | Ga0075365_10035023 | 3300006038 | Bacteria | 3246 |
| 197 | Ga0075368_10221855 | 3300006042 | Unclassified | 803 |
| 198 | Ga0075364_10638724 | 3300006051 | Bacteria | 727 |
| 199 | Ga0075432_10047611 | 3300006058 | Bacteria | 1507 |
| 200 | Ga0075432_10451903 | 3300006058 | Bacteria | 564 |
| 201 | Ga0070715_10011449 | 3300006163 | Bacteria | 3195 |
| 202 | Ga0070715_10268687 | 3300006163 | Bacteria | 899 |
| 203 | Ga0070715_10791538 | 3300006163 | Bacteria | 575 |
| 204 | Ga0075367_10551863 | 3300006178 | Bacteria | 732 |
| 205 | Ga0075366_10094868 | 3300006195 | Bacteria | 1788 |
| 206 | Ga0075366_10121652 | 3300006195 | Bacteria | 1573 |
| 207 | Ga0097621_100002206 | 3300006237 | Bacteria | 13330 |
| 208 | Ga0097621_100002228 | 3300006237 | Bacteria | 13279 |
| 209 | Ga0097621_100043370 | 3300006237 | Bacteria | 3626 |
| 210 | Ga0097621_100089092 | 3300006237 | Bacteria | 2579 |
| 211 | Ga0097621_100111959 | 3300006237 | Bacteria | 2307 |
| 212 | Ga0097621_100209702 | 3300006237 | Bacteria | 1695 |
| 213 | Ga0097621_100244763 | 3300006237 | Bacteria | 1569 |
| 214 | Ga0075370_10337171 | 3300006353 | Bacteria | 899 |
| 215 | Ga0068871_100000586 | 3300006358 | Bacteria | 25004 |
| 216 | Ga0068871_100004656 | 3300006358 | Bacteria | 9584 |
| 217 | Ga0068871_100035460 | 3300006358 | Bacteria | 3964 |
| 218 | Ga0068871_100066178 | 3300006358 | Bacteria | 2961 |
| 219 | Ga0068871_100204697 | 3300006358 | Unclassified | 1705 |
| 220 | Ga0068871_100401987 | 3300006358 | Bacteria | 1220 |
| 221 | Ga0068871_101025743 | 3300006358 | Bacteria | 769 |
| 222 | Ga0075428_100105753 | 3300006844 | Bacteria | 3068 |
| 223 | Ga0075428_100486594 | 3300006844 | Bacteria | 1321 |
| 224 | Ga0075430_100123011 | 3300006846 | Bacteria | 2163 |
| 225 | Ga0075430_101017159 | 3300006846 | Bacteria | 683 |
| 226 | Ga0075431_100005294 | 3300006847 | Bacteria | 12719 |
| 227 | Ga0075431_100023894 | 3300006847 | Bacteria | 6257 |
| 228 | Ga0075431_100058861 | 3300006847 | Bacteria | 3965 |
| 229 | Ga0075431_100128064 | 3300006847 | Bacteria | 2620 |
| 230 | Ga0075431_101589350 | 3300006847 | Bacteria | 612 |
| 231 | Ga0075433_10030799 | 3300006852 | Bacteria | 4581 |
| 232 | Ga0075433_10109154 | 3300006852 | Bacteria | 2455 |
| 233 | Ga0075433_10337177 | 3300006852 | Bacteria | 1333 |
| 234 | Ga0075433_10412322 | 3300006852 | Bacteria | 1191 |
| 235 | Ga0075433_10472315 | 3300006852 | Bacteria | 1105 |
| 236 | Ga0075433_10810531 | 3300006852 | Bacteria | 818 |
| 237 | Ga0075433_10909381 | 3300006852 | Bacteria | 768 |
| 238 | Ga0075433_11442663 | 3300006852 | Bacteria | 595 |
| 239 | Ga0075434_100000538 | 3300006871 | Bacteria | 28855 |
| 240 | Ga0075434_100005479 | 3300006871 | Bacteria | 11558 |
| 241 | Ga0075434_100087037 | 3300006871 | Bacteria | 3125 |
| 242 | Ga0075434_100188581 | 3300006871 | Bacteria | 2082 |
| 243 | Ga0075434_100348387 | 3300006871 | Bacteria | 1502 |
| 244 | Ga0075434_100487152 | 3300006871 | Bacteria | 1254 |
| 245 | Ga0075434_101439069 | 3300006871 | Bacteria | 699 |
| 246 | Ga0075434_102235310 | 3300006871 | Bacteria | 550 |
| 247 | Ga0075429_100028798 | 3300006880 | Bacteria | 4824 |
| 248 | Ga0068865_100014420 | 3300006881 | Bacteria | 5021 |
| 249 | Ga0068865_100016109 | 3300006881 | Bacteria | 4775 |
| 250 | Ga0068865_100029317 | 3300006881 | Bacteria | 3650 |
| 251 | Ga0068865_100057007 | 3300006881 | Bacteria | 2724 |
| 252 | Ga0068865_101218460 | 3300006881 | Bacteria | 667 |
| 253 | Ga0068865_101354958 | 3300006881 | Bacteria | 634 |
| 254 | Ga0075436_100000641 | 3300006914 | Bacteria | 22972 |
| 255 | Ga0075436_100005174 | 3300006914 | Bacteria | 8981 |
| 256 | Ga0075436_100010981 | 3300006914 | Bacteria | 6217 |
| 257 | Ga0075436_100214603 | 3300006914 | Bacteria | 1365 |
| 258 | Ga0075436_100266632 | 3300006914 | Bacteria | 1222 |
| 259 | Ga0097620_100012195 | 3300006931 | Bacteria | 8640 |
| 260 | Ga0097620_100311115 | 3300006931 | Bacteria | 1669 |
| 261 | Ga0097620_100402499 | 3300006931 | Bacteria | 1465 |
| 262 | Ga0097620_100585708 | 3300006931 | Bacteria | 1209 |
| 263 | Ga0097620_100797920 | 3300006931 | Bacteria | 1032 |
| 264 | Ga0097620_101502223 | 3300006931 | Bacteria | 743 |
| 265 | Ga0097620_101838830 | 3300006931 | Bacteria | 669 |
| 266 | Ga0075435_100000009 | 3300007076 | Bacteria | 114381 |
| 267 | Ga0075435_100000567 | 3300007076 | Bacteria | 22751 |
| 268 | Ga0075435_100001575 | 3300007076 | Bacteria | 14706 |
| 269 | Ga0075435_100005738 | 3300007076 | Bacteria | 8708 |
| 270 | Ga0075435_100012126 | 3300007076 | Bacteria | 6373 |
| 271 | Ga0075435_100081777 | 3300007076 | Bacteria | 2654 |
| 272 | Ga0075435_100395254 | 3300007076 | Bacteria | 1188 |
| 273 | Ga0075435_100401948 | 3300007076 | Bacteria | 1178 |
| 274 | Ga0105240_10455643 | 3300009093 | Bacteria | 1430 |
| 275 | Ga0105240_11374147 | 3300009093 | Bacteria | 743 |
| 276 | Ga0105240_12068601 | 3300009093 | Bacteria | 591 |
| 277 | Ga0111539_10000151 | 3300009094 | Bacteria | 79134 |
| 278 | Ga0111539_10029847 | 3300009094 | Bacteria | 6634 |
| 279 | Ga0111539_10152490 | 3300009094 | Bacteria | 2705 |
| 280 | Ga0111539_10643147 | 3300009094 | Bacteria | 1235 |
| 281 | Ga0111539_10874617 | 3300009094 | Bacteria | 1045 |
| 282 | Ga0105245_10012218 | 3300009098 | Bacteria | 7470 |
| 283 | Ga0105245_10028212 | 3300009098 | Bacteria | 4948 |
| 284 | Ga0105245_10064778 | 3300009098 | Bacteria | 3303 |
| 285 | Ga0105245_10081028 | 3300009098 | Bacteria | 2966 |
| 286 | Ga0105245_12559262 | 3300009098 | Bacteria | 564 |
| 287 | Ga0105247_10027790 | 3300009101 | Bacteria | 3421 |
| 288 | Ga0105247_10125128 | 3300009101 | Unclassified | 1670 |
| 289 | Ga0114129_10009169 | 3300009147 | Bacteria | 14108 |
| 290 | Ga0114129_10022392 | 3300009147 | Bacteria | 8972 |
| 291 | Ga0114129_10048648 | 3300009147 | Bacteria | 5958 |
| 292 | Ga0114129_10122203 | 3300009147 | Bacteria | 3583 |
| 293 | Ga0114129_10284631 | 3300009147 | Bacteria | 2208 |
| 294 | Ga0114129_10302378 | 3300009147 | Bacteria | 2131 |
| 295 | Ga0114129_10456820 | 3300009147 | Unclassified | 1674 |
| 296 | Ga0114129_10571423 | 3300009147 | Bacteria | 1468 |
| 297 | Ga0114129_10720633 | 3300009147 | Bacteria | 1280 |
| 298 | Ga0114129_11585894 | 3300009147 | Bacteria | 802 |
| 299 | Ga0114129_11787973 | 3300009147 | Bacteria | 748 |
| 300 | Ga0114129_11863464 | 3300009147 | Bacteria | 730 |
| 301 | Ga0114129_12651297 | 3300009147 | Bacteria | 598 |
| 302 | Ga0105243_10022611 | 3300009148 | Bacteria | 4781 |
| 303 | Ga0105243_11048494 | 3300009148 | Bacteria | 821 |
| 304 | Ga0105243_11139607 | 3300009148 | Bacteria | 790 |
| 305 | Ga0105243_11224570 | 3300009148 | Bacteria | 765 |
| 306 | Ga0105243_12512079 | 3300009148 | Bacteria | 554 |
| 307 | Ga0105241_10128908 | 3300009174 | Bacteria | 2046 |
| 308 | Ga0105241_11699043 | 3300009174 | Bacteria | 613 |
| 309 | Ga0105242_10003159 | 3300009176 | Bacteria | 12863 |
| 310 | Ga0105242_10003881 | 3300009176 | Bacteria | 11615 |
| 311 | Ga0105242_10012282 | 3300009176 | Bacteria | 6592 |
| 312 | Ga0105242_10141531 | 3300009176 | Bacteria | 2088 |
| 313 | Ga0105242_10650236 | 3300009176 | Unclassified | 1025 |
| 314 | Ga0105242_11218254 | 3300009176 | Bacteria | 773 |
| 315 | Ga0105248_10077759 | 3300009177 | Bacteria | 3730 |
| 316 | Ga0105248_10313262 | 3300009177 | Bacteria | 1767 |
| 317 | Ga0105248_10361757 | 3300009177 | Bacteria | 1634 |
| 318 | Ga0105248_10384963 | 3300009177 | Bacteria | 1579 |
| 319 | Ga0105248_10538965 | 3300009177 | Bacteria | 1316 |
| 320 | Ga0105248_10804486 | 3300009177 | Bacteria | 1061 |
| 321 | Ga0105248_10817268 | 3300009177 | Unclassified | 1052 |
| 322 | Ga0105248_11346577 | 3300009177 | Bacteria | 808 |
| 323 | Ga0105248_11377764 | 3300009177 | Bacteria | 798 |
| 324 | Ga0105248_12454952 | 3300009177 | Bacteria | 594 |
| 325 | Ga0105248_12456203 | 3300009177 | Bacteria | 594 |
| 326 | Ga0105248_12906642 | 3300009177 | Bacteria | 546 |
| 327 | Ga0105237_10179827 | 3300009545 | Bacteria | 2115 |
| 328 | Ga0105238_12842607 | 3300009551 | Bacteria | 520 |
| 329 | Ga0105249_10109645 | 3300009553 | Bacteria | 2607 |
| 330 | Ga0105249_10374136 | 3300009553 | Bacteria | 1449 |
| 331 | Ga0105249_11373218 | 3300009553 | Bacteria | 778 |
| 332 | Ga0105249_12359685 | 3300009553 | Unclassified | 605 |
| 333 | Ga0105249_12494558 | 3300009553 | Bacteria | 589 |
| 334 | Ga0105239_11551149 | 3300010375 | Bacteria | 766 |
| 335 | Ga0105246_10115262 | 3300011119 | Bacteria | 1981 |
| 336 | Ga0105246_10398268 | 3300011119 | Bacteria | 1142 |
| 337 | Ga0105246_12539436 | 3300011119 | Bacteria | 505 |
| 338 | Ga0157325_1028212 | 3300012485 | Unclassified | 547 |
| 339 | Ga0157314_1019886 | 3300012500 | Bacteria | 675 |
| 340 | Ga0157373_11018196 | 3300013100 | Bacteria | 619 |
| 341 | Ga0157374_10003033 | 3300013296 | Bacteria | 14073 |
| 342 | Ga0157374_10192778 | 3300013296 | Bacteria | 1993 |
| 343 | Ga0157374_10478572 | 3300013296 | Bacteria | 1248 |
| 344 | Ga0157374_10559245 | 3300013296 | Bacteria | 1152 |
| 345 | Ga0157374_11014246 | 3300013296 | Bacteria | 849 |
| 346 | Ga0157374_11332749 | 3300013296 | Unclassified | 740 |
| 347 | Ga0157378_10000335 | 3300013297 | Bacteria | 46123 |
| 348 | Ga0157378_10000904 | 3300013297 | Bacteria | 27354 |
| 349 | Ga0157378_10009297 | 3300013297 | Bacteria | 8560 |
| 350 | Ga0157378_10107371 | 3300013297 | Bacteria | 2554 |
| 351 | Ga0157378_10419507 | 3300013297 | Bacteria | 1322 |
| 352 | Ga0157378_11695148 | 3300013297 | Bacteria | 679 |
| 353 | Ga0157378_12273019 | 3300013297 | Bacteria | 594 |
| 354 | Ga0163162_10051414 | 3300013306 | Bacteria | 4135 |
| 355 | Ga0163162_10638166 | 3300013306 | Bacteria | 1189 |
| 356 | Ga0157375_10000009 | 3300013308 | Bacteria | 366440 |
| 357 | Ga0157375_10135568 | 3300013308 | Bacteria | 2585 |
| 358 | Ga0157375_10296139 | 3300013308 | Bacteria | 1781 |
| 359 | Ga0157375_10688735 | 3300013308 | Bacteria | 1176 |
| 360 | Ga0163163_10040445 | 3300014325 | Bacteria | 4552 |
| 361 | Ga0163163_10146700 | 3300014325 | Bacteria | 2404 |
| 362 | Ga0163163_10999765 | 3300014325 | Bacteria | 900 |
| 363 | Ga0163163_11624606 | 3300014325 | Bacteria | 707 |
| 364 | Ga0157380_10071637 | 3300014326 | Bacteria | 2804 |
| 365 | Ga0157380_10216754 | 3300014326 | Bacteria | 1710 |
| 366 | Ga0157380_10713424 | 3300014326 | Bacteria | 1009 |
| 367 | Ga0157380_10717814 | 3300014326 | Bacteria | 1007 |
| 368 | Ga0157380_10850559 | 3300014326 | Bacteria | 934 |
| 369 | Ga0157380_11776746 | 3300014326 | Bacteria | 675 |
| 370 | Ga0157377_10011786 | 3300014745 | Bacteria | 4373 |
| 371 | Ga0157379_10017793 | 3300014968 | Bacteria | 6260 |
| 372 | Ga0157379_10027746 | 3300014968 | Bacteria | 5040 |
| 373 | Ga0157379_10071716 | 3300014968 | Bacteria | 3098 |
| 374 | Ga0157379_10274943 | 3300014968 | Bacteria | 1532 |
| 375 | Ga0157379_10418490 | 3300014968 | Bacteria | 1234 |
| 376 | Ga0157379_11458544 | 3300014968 | Unclassified | 665 |
| 377 | Ga0157379_11800698 | 3300014968 | Bacteria | 602 |
| 378 | Ga0157376_10033312 | 3300014969 | Bacteria | 4147 |
| 379 | Ga0157376_10196208 | 3300014969 | Bacteria | 1854 |
| 380 | Ga0157376_10457036 | 3300014969 | Bacteria | 1247 |
| 381 | Ga0157376_10484621 | 3300014969 | Bacteria | 1212 |
| 382 | Ga0157376_10797893 | 3300014969 | Bacteria | 956 |
| 383 | Ga0163161_11602166 | 3300017792 | Bacteria | 574 |
| 384 | Ga0207697_10017848 | 3300025315 | Bacteria | 2913 |
| 385 | Ga0207682_10378677 | 3300025893 | Bacteria | 668 |
| 386 | Ga0207682_10394205 | 3300025893 | Bacteria | 654 |
| 387 | Ga0207642_10236748 | 3300025899 | Bacteria | 1029 |
| 388 | Ga0207642_10341979 | 3300025899 | Bacteria | 880 |
| 389 | Ga0207710_10008364 | 3300025900 | Bacteria | 4363 |
| 390 | Ga0207710_10068574 | 3300025900 | Unclassified | 1622 |
| 391 | Ga0207680_10031313 | 3300025903 | Bacteria | 3012 |
| 392 | Ga0207680_10062012 | 3300025903 | Bacteria | 2282 |
| 393 | Ga0207680_10967130 | 3300025903 | Bacteria | 610 |
| 394 | Ga0207685_10116573 | 3300025905 | Bacteria | 1166 |
| 395 | Ga0207685_10252148 | 3300025905 | Bacteria | 854 |
| 396 | Ga0207645_10003035 | 3300025907 | Bacteria | 12919 |
| 397 | Ga0207645_10163695 | 3300025907 | Bacteria | 1456 |
| 398 | Ga0207645_10364248 | 3300025907 | Bacteria | 969 |
| 399 | Ga0207645_10588729 | 3300025907 | Bacteria | 755 |
| 400 | Ga0207643_10162025 | 3300025908 | Bacteria | 1346 |
| 401 | Ga0207643_10425752 | 3300025908 | Bacteria | 842 |
| 402 | Ga0207705_10393801 | 3300025909 | Bacteria | 1071 |
| 403 | Ga0207684_10249510 | 3300025910 | Bacteria | 1531 |
| 404 | Ga0207684_10254606 | 3300025910 | Bacteria | 1515 |
| 405 | Ga0207684_10577242 | 3300025910 | Bacteria | 961 |
| 406 | Ga0207684_10704481 | 3300025910 | Unclassified | 858 |
| 407 | Ga0207654_10627184 | 3300025911 | Bacteria | 769 |
| 408 | Ga0207654_11385935 | 3300025911 | Unclassified | 513 |
| 409 | Ga0207695_10345304 | 3300025913 | Bacteria | 1376 |
| 410 | Ga0207695_11150803 | 3300025913 | Bacteria | 656 |
| 411 | Ga0207671_10121874 | 3300025914 | Bacteria | 1994 |
| 412 | Ga0207663_10067128 | 3300025916 | Bacteria | 2299 |
| 413 | Ga0207660_11055818 | 3300025917 | Bacteria | 662 |
| 414 | Ga0207660_11081332 | 3300025917 | Bacteria | 654 |
| 415 | Ga0207660_11130175 | 3300025917 | Bacteria | 638 |
| 416 | Ga0207662_10048272 | 3300025918 | Bacteria | 2521 |
| 417 | Ga0207662_10081080 | 3300025918 | Bacteria | 1980 |
| 418 | Ga0207662_10212321 | 3300025918 | Unclassified | 1257 |
| 419 | Ga0207662_10319863 | 3300025918 | Bacteria | 1036 |
| 420 | Ga0207649_11484270 | 3300025920 | Bacteria | 537 |
| 421 | Ga0207646_10211568 | 3300025922 | Bacteria | 1751 |
| 422 | Ga0207646_10551472 | 3300025922 | Bacteria | 1036 |
| 423 | Ga0207681_10025533 | 3300025923 | Bacteria | 3801 |
| 424 | Ga0207681_11717681 | 3300025923 | Bacteria | 524 |
| 425 | Ga0207650_11246728 | 3300025925 | Bacteria | 633 |
| 426 | Ga0207650_11315215 | 3300025925 | Bacteria | 615 |
| 427 | Ga0207659_10005200 | 3300025926 | Bacteria | 7880 |
| 428 | Ga0207659_10022298 | 3300025926 | Bacteria | 4215 |
| 429 | Ga0207659_11053739 | 3300025926 | Bacteria | 700 |
| 430 | Ga0207659_11466892 | 3300025926 | Bacteria | 584 |
| 431 | Ga0207687_10000530 | 3300025927 | Bacteria | 25582 |
| 432 | Ga0207687_10188860 | 3300025927 | Bacteria | 1602 |
| 433 | Ga0207687_10643128 | 3300025927 | Bacteria | 897 |
| 434 | Ga0207687_10896303 | 3300025927 | Bacteria | 759 |
| 435 | Ga0207700_11069741 | 3300025928 | Unclassified | 721 |
| 436 | Ga0207644_11381650 | 3300025931 | Bacteria | 592 |
| 437 | Ga0207690_11027298 | 3300025932 | Bacteria | 686 |
| 438 | Ga0207690_11289617 | 3300025932 | Bacteria | 610 |
| 439 | Ga0207706_10018270 | 3300025933 | Bacteria | 6309 |
| 440 | Ga0207706_10100721 | 3300025933 | Bacteria | 2541 |
| 441 | Ga0207706_10988511 | 3300025933 | Bacteria | 707 |
| 442 | Ga0207686_10003774 | 3300025934 | Bacteria | 8128 |
| 443 | Ga0207686_10049156 | 3300025934 | Bacteria | 2616 |
| 444 | Ga0207686_10049898 | 3300025934 | Bacteria | 2600 |
| 445 | Ga0207686_10772866 | 3300025934 | Unclassified | 768 |
| 446 | Ga0207686_10772932 | 3300025934 | Bacteria | 768 |
| 447 | Ga0207709_10040099 | 3300025935 | Bacteria | 2802 |
| 448 | Ga0207709_10109876 | 3300025935 | Bacteria | 1841 |
| 449 | Ga0207709_10301669 | 3300025935 | Bacteria | 1191 |
| 450 | Ga0207709_10486492 | 3300025935 | Bacteria | 960 |
| 451 | Ga0207709_11505467 | 3300025935 | Unclassified | 558 |
| 452 | Ga0207670_10005643 | 3300025936 | Bacteria | 6884 |
| 453 | Ga0207670_10317363 | 3300025936 | Bacteria | 1225 |
| 454 | Ga0207670_10630202 | 3300025936 | Bacteria | 882 |
| 455 | Ga0207670_10837083 | 3300025936 | Bacteria | 768 |
| 456 | Ga0207670_10896550 | 3300025936 | Bacteria | 743 |
| 457 | Ga0207669_10005616 | 3300025937 | Bacteria | 5648 |
| 458 | Ga0207669_10051285 | 3300025937 | Bacteria | 2471 |
| 459 | Ga0207669_10121822 | 3300025937 | Bacteria | 1772 |
| 460 | Ga0207704_10007163 | 3300025938 | Bacteria | 5249 |
| 461 | Ga0207704_10508492 | 3300025938 | Bacteria | 972 |
| 462 | Ga0207704_11072238 | 3300025938 | Bacteria | 684 |
| 463 | Ga0207665_10374661 | 3300025939 | Bacteria | 1079 |
| 464 | Ga0207691_10227032 | 3300025940 | Bacteria | 1618 |
| 465 | Ga0207691_10386140 | 3300025940 | Bacteria | 1195 |
| 466 | Ga0207691_10574388 | 3300025940 | Bacteria | 955 |
| 467 | Ga0207691_10625892 | 3300025940 | Bacteria | 910 |
| 468 | Ga0207711_10010783 | 3300025941 | Bacteria | 7596 |
| 469 | Ga0207711_10166711 | 3300025941 | Bacteria | 1997 |
| 470 | Ga0207711_10199765 | 3300025941 | Bacteria | 1824 |
| 471 | Ga0207711_10223361 | 3300025941 | Bacteria | 1723 |
| 472 | Ga0207711_10257533 | 3300025941 | Unclassified | 1603 |
| 473 | Ga0207711_10406721 | 3300025941 | Unclassified | 1265 |
| 474 | Ga0207711_10853915 | 3300025941 | Bacteria | 847 |
| 475 | Ga0207689_10065065 | 3300025942 | Bacteria | 2999 |
| 476 | Ga0207689_10273505 | 3300025942 | Bacteria | 1398 |
| 477 | Ga0207689_10372620 | 3300025942 | Bacteria | 1188 |
| 478 | Ga0207689_11444044 | 3300025942 | Bacteria | 576 |
| 479 | Ga0207679_10098032 | 3300025945 | Bacteria | 2285 |
| 480 | Ga0207679_10382761 | 3300025945 | Bacteria | 1234 |
| 481 | Ga0207679_10444637 | 3300025945 | Unclassified | 1148 |
| 482 | Ga0207679_10562586 | 3300025945 | Bacteria | 1024 |
| 483 | Ga0207679_10973605 | 3300025945 | Bacteria | 777 |
| 484 | Ga0207679_11970956 | 3300025945 | Unclassified | 532 |
| 485 | Ga0207679_12187379 | 3300025945 | Unclassified | 502 |
| 486 | Ga0207667_10575891 | 3300025949 | Bacteria | 1137 |
| 487 | Ga0207651_10153118 | 3300025960 | Bacteria | 1798 |
| 488 | Ga0207651_10704728 | 3300025960 | Bacteria | 890 |
| 489 | Ga0207651_10725224 | 3300025960 | Bacteria | 877 |
| 490 | Ga0207651_11434911 | 3300025960 | Unclassified | 621 |
| 491 | Ga0207651_11883328 | 3300025960 | Bacteria | 538 |
| 492 | Ga0207712_10217069 | 3300025961 | Bacteria | 1527 |
| 493 | Ga0207712_11167266 | 3300025961 | Unclassified | 686 |
| 494 | Ga0207712_11455455 | 3300025961 | Bacteria | 613 |
| 495 | Ga0207712_12024963 | 3300025961 | Bacteria | 515 |
| 496 | Ga0207640_10044262 | 3300025981 | Bacteria | 2851 |
| 497 | Ga0207640_10505539 | 3300025981 | Bacteria | 1007 |
| 498 | Ga0207640_10736330 | 3300025981 | Unclassified | 849 |
| 499 | Ga0207658_10573092 | 3300025986 | Bacteria | 1012 |
| 500 | Ga0207658_11854364 | 3300025986 | Bacteria | 550 |
| 501 | Ga0207677_10425132 | 3300026023 | Bacteria | 1132 |
| 502 | Ga0207677_12012112 | 3300026023 | Bacteria | 537 |
| 503 | Ga0207703_10019292 | 3300026035 | Bacteria | 5326 |
| 504 | Ga0207703_10029802 | 3300026035 | Bacteria | 4308 |
| 505 | Ga0207703_10063621 | 3300026035 | Bacteria | 3025 |
| 506 | Ga0207703_10706967 | 3300026035 | Bacteria | 959 |
| 507 | Ga0207639_11326447 | 3300026041 | Bacteria | 675 |
| 508 | Ga0207678_10112203 | 3300026067 | Bacteria | 2326 |
| 509 | Ga0207708_10000915 | 3300026075 | Bacteria | 22111 |
| 510 | Ga0207708_10064599 | 3300026075 | Bacteria | 2796 |
| 511 | Ga0207708_10145781 | 3300026075 | Bacteria | 1860 |
| 512 | Ga0207708_10311221 | 3300026075 | Bacteria | 1283 |
| 513 | Ga0207708_10489544 | 3300026075 | Bacteria | 1029 |
| 514 | Ga0207702_11519357 | 3300026078 | Bacteria | 663 |
| 515 | Ga0207641_10112714 | 3300026088 | Bacteria | 2414 |
| 516 | Ga0207641_10200789 | 3300026088 | Bacteria | 1838 |
| 517 | Ga0207641_10380226 | 3300026088 | Bacteria | 1352 |
| 518 | Ga0207641_11344845 | 3300026088 | Unclassified | 715 |
| 519 | Ga0207648_10003983 | 3300026089 | Bacteria | 15334 |
| 520 | Ga0207648_10261089 | 3300026089 | Bacteria | 1545 |
| 521 | Ga0207648_10285998 | 3300026089 | Bacteria | 1475 |
| 522 | Ga0207648_10722726 | 3300026089 | Bacteria | 924 |
| 523 | Ga0207648_11522619 | 3300026089 | Bacteria | 629 |
| 524 | Ga0207648_11559852 | 3300026089 | Unclassified | 621 |
| 525 | Ga0207674_10048880 | 3300026116 | Bacteria | 4327 |
| 526 | Ga0207674_11159976 | 3300026116 | Bacteria | 742 |
| 527 | Ga0207675_100006469 | 3300026118 | Bacteria | 11089 |
| 528 | Ga0207675_100016792 | 3300026118 | Bacteria | 6837 |
| 529 | Ga0207675_100042052 | 3300026118 | Bacteria | 4265 |
| 530 | Ga0207675_100136023 | 3300026118 | Bacteria | 2332 |
| 531 | Ga0207675_100657184 | 3300026118 | Bacteria | 1055 |
| 532 | Ga0207675_102081948 | 3300026118 | Unclassified | 584 |
| 533 | Ga0207683_11399240 | 3300026121 | Bacteria | 647 |
| 534 | Ga0207698_10834905 | 3300026142 | Bacteria | 926 |
| 535 | Ga0207428_10000643 | 3300027907 | Bacteria | 41046 |
| 536 | Ga0207428_10041193 | 3300027907 | Bacteria | 3741 |
| 537 | Ga0207428_10130639 | 3300027907 | Bacteria | 1922 |
| 538 | Ga0268266_10042136 | 3300028379 | Bacteria | 3898 |
| 539 | Ga0268266_10053356 | 3300028379 | Bacteria | 3472 |
| 540 | Ga0268266_11734800 | 3300028379 | Bacteria | 599 |
| 541 | Ga0268266_12339295 | 3300028379 | Bacteria | 505 |
| 542 | Ga0268265_10060930 | 3300028380 | Bacteria | 2894 |
| 543 | Ga0268265_10088493 | 3300028380 | Bacteria | 2467 |
| 544 | Ga0268265_10174329 | 3300028380 | Bacteria | 1841 |
| 545 | Ga0268265_10253867 | 3300028380 | Bacteria | 1559 |
| 546 | Ga0268265_10277451 | 3300028380 | Bacteria | 1498 |
| 547 | Ga0268265_10658754 | 3300028380 | Bacteria | 1007 |
| 548 | Ga0268265_10779767 | 3300028380 | Bacteria | 930 |
| 549 | Ga0268265_10785673 | 3300028380 | Bacteria | 927 |
| 550 | Ga0268265_11302278 | 3300028380 | Bacteria | 727 |
| 551 | Ga0268265_11982088 | 3300028380 | Bacteria | 589 |
| 552 | Ga0268265_12532161 | 3300028380 | Bacteria | 519 |
| 553 | Ga0268264_10007159 | 3300028381 | Bacteria | 9347 |
| 554 | Ga0268264_10082725 | 3300028381 | Bacteria | 2748 |
| 555 | Ga0268264_10179094 | 3300028381 | Bacteria | 1924 |
| 556 | Ga0268264_10226300 | 3300028381 | Bacteria | 1724 |
| 557 | Ga0268264_10354267 | 3300028381 | Bacteria | 1398 |
| 558 | Ga0268264_10408577 | 3300028381 | Bacteria | 1306 |
| 559 | Ga0268264_10802557 | 3300028381 | Bacteria | 940 |
| 560 | Ga0268264_10853112 | 3300028381 | Bacteria | 912 |
| 561 | Ga0268264_12321047 | 3300028381 | Unclassified | 543 |
| 562 | Ga0268264_12673372 | 3300028381 | Bacteria | 503 |
| 563 | Ga0307511_10005949 | 3300030521 | Bacteria | 12326 |
| 564 | Ga0307509_10417558 | 3300031507 | Bacteria | 1043 |
| 565 | Ga0307412_10219076 | 3300031911 | Bacteria | 1458 |
| 566 | Ga0307416_102812200 | 3300032002 | Bacteria | 582 |
| 567 | Ga0307416_102930123 | 3300032002 | Unclassified | 571 |
| 568 | Ga0307414_11663409 | 3300032004 | Bacteria | 595 |
| 569 | Ga0373930_0001309 | 3300034816 | Bacteria | 3671 |
| 570 | Ga0373948_0001672 | 3300034817 | Bacteria | 3134 |
| 571 | Ga0373950_0011332 | 3300034818 | Bacteria | 1455 |
| 572 | Ga0373958_0030053 | 3300034819 | Bacteria | 1060 |
| 573 | Ga0373938_0048910 | 3300034957 | Bacteria | 960 |
| 574 | Ga0373928_0004086 | 3300035084 | Bacteria | 2781 |
| 575 | Ga0373928_0021459 | 3300035084 | Bacteria | 1362 |
| 576 | Ga0373929_0001021 | 3300035085 | Bacteria | 5432 |
| 577 | Ga0373934_0115399 | 3300035086 | Bacteria | 1091 |
| 578 | Ga0373940_0023884 | 3300035088 | Bacteria | 1581 |
| 579 | Ga0373949_0001236 | 3300035090 | Bacteria | 7543 |
| 580 | Ga0373949_0002813 | 3300035090 | Bacteria | 4325 |
| 581 | Ga0373951_0000826 | 3300035091 | Bacteria | 8417 |
| 582 | Ga0373951_0161414 | 3300035091 | Bacteria | 634 |
| 583 | Ga0373952_0002002 | 3300035092 | Bacteria | 3682 |
| 584 | Ga0373923_0150446 | 3300035111 | Bacteria | 1057 |
| 585 | Ga0373932_0002098 | 3300035112 | Bacteria | 5183 |
| 586 | Ga0373939_0000603 | 3300035114 | Bacteria | 8926 |
| 587 | Ga0373939_0241832 | 3300035114 | Bacteria | 699 |
| 588 | Ga0373939_0291909 | 3300035114 | Bacteria | 647 |
| 589 | Ga0373941_0000169 | 3300035115 | Bacteria | 12062 |
| 590 | Ga0373941_0061438 | 3300035115 | Bacteria | 1224 |
| 591 | Ga0373945_0058433 | 3300035116 | Bacteria | 1434 |
| 592 | Ga0373954_0598383 | 3300035118 | Bacteria | 547 |
| 593 | Ga0373956_0040081 | 3300035119 | Bacteria | 2077 |
| 594 | Ga0373956_0050242 | 3300035119 | Bacteria | 1872 |
| 595 | Ga0373956_0461250 | 3300035119 | Bacteria | 606 |
| 596 | Ga0373960_0001719 | 3300035121 | Bacteria | 4901 |
| 597 | Ga0373943_0100732 | 3300035170 | Bacteria | 1510 |
| 598 | Ga0373943_0776085 | 3300035170 | Bacteria | 570 |
| 599 | Ga0373946_0177356 | 3300035171 | Bacteria | 1010 |
| 600 | Ga0373955_0134470 | 3300035172 | Bacteria | 1445 |
| 601 | Ga0373942_0002266 | 3300035207 | Bacteria | 4712 |
| 602 | Ga0373961_0000682 | 3300035241 | Bacteria | 12000 |
| 603 | Ga0373962_0000733 | 3300035242 | Bacteria | 7420 |
| 604 | Ga0373962_0038267 | 3300035242 | Bacteria | 1342 |
| 605 | Ga0373924_0036283 | 3300035410 | Bacteria | 2003 |
| 606 | Ga0373931_0012937 | 3300035691 | Bacteria | 4053 |
| 607 | Ga0373931_0039343 | 3300035691 | Bacteria | 2477 |
| 608 | Ga0373931_0184085 | 3300035691 | Bacteria | 1239 |
| 609 | Ga0373935_0288794 | 3300035692 | Bacteria | 1156 |
| 610 | Ga0373935_0434848 | 3300035692 | Unclassified | 946 |
| 611 | Ga0373933_0133413 | 3300035724 | Bacteria | 1563 |
| 612 | Ga0373933_0357985 | 3300035724 | Bacteria | 949 |
| 613 | Ga0373947_0032067 | 3300035725 | Bacteria | 3095 |
| 614 | Ga0373947_0150201 | 3300035725 | Bacteria | 1500 |
| 615 | Ga0373937_0137948 | 3300036401 | Bacteria | 2281 |
| 616 | Ga0373937_0239975 | 3300036401 | Bacteria | 1708 |
| 617 | Ga0373937_1053062 | 3300036401 | Bacteria | 762 |
| 618 | Ga0373937_1990307 | 3300036401 | Unclassified | 527 |
| 619 | Ga0373925_0014745 | 3300037068 | Bacteria | 5647 |
| 620 | Ga0373925_0037974 | 3300037068 | Bacteria | 3558 |
| 621 | Ga0373925_1284105 | 3300037068 | Unclassified | 601 |
| 622 | Ga0439435_0222972 | 3300042436 | Unclassified | 628 |
| 623 | Ga0439460_0245275 | 3300042461 | Bacteria | 618 |
| 624 | Ga0453683_0474445 | 3300044673 | Unclassified | 811 |
| 625 | Ga0451576_0103290 | 3300045051 | Bacteria | 2965 |
| 626 | Ga0451576_0222034 | 3300045051 | Bacteria | 1973 |
| 627 | Ga0495603_0207111 | 3300046455 | Bacteria | 1133 |
| 628 | Ga0495641_0192905 | 3300046461 | Bacteria | 913 |
| 629 | Ga0495641_0383088 | 3300046461 | Bacteria | 637 |
| 630 | Ga0495653_0279680 | 3300046463 | Bacteria | 1096 |
| 631 | Ga0495580_0186101 | 3300046472 | Unclassified | 1433 |
| 632 | Ga0495580_0825017 | 3300046472 | Unclassified | 600 |
| 633 | Ga0495639_0023059 | 3300046475 | Bacteria | 2734 |
| 634 | Ga0495639_0249753 | 3300046475 | Bacteria | 877 |
| 635 | Ga0495594_0171845 | 3300046499 | Unclassified | 1233 |
| 636 | Ga0495594_0415948 | 3300046499 | Bacteria | 765 |
| 637 | Ga0495594_0448716 | 3300046499 | Bacteria | 733 |
| 638 | Ga0495643_0038122 | 3300046522 | Bacteria | 2633 |
| 639 | Ga0495642_0109788 | 3300046528 | Bacteria | 1179 |
| 640 | Ga0495586_0305938 | 3300046535 | Bacteria | 911 |
| 641 | Ga0495667_0519788 | 3300046559 | Bacteria | 745 |
| 642 | Ga0495634_0840089 | 3300046642 | Bacteria | 522 |
| 643 | Ga0495635_0096267 | 3300046663 | Bacteria | 2023 |
| 644 | Ga0495657_0820408 | 3300046675 | Bacteria | 531 |
| 645 | Ga0495647_0079829 | 3300046681 | Unclassified | 1325 |
| 646 | Ga0495647_0084909 | 3300046681 | Bacteria | 1289 |
| 647 | Ga0495658_0049435 | 3300046683 | Bacteria | 2375 |
| 648 | Ga0495658_0517530 | 3300046683 | Bacteria | 764 |
| 649 | Ga0495669_0018866 | 3300046684 | Bacteria | 2971 |
| 650 | Ga0495669_0446805 | 3300046684 | Bacteria | 628 |
| 651 | Ga0495669_0471746 | 3300046684 | Unclassified | 610 |
| 652 | Ga0495613_0385305 | 3300046689 | Bacteria | 958 |
| 653 | Ga0495624_0421424 | 3300046690 | Bacteria | 801 |
| 654 | Ga0495581_0195122 | 3300047315 | Unclassified | 1184 |
| 655 | Ga0495581_0293870 | 3300047315 | Bacteria | 950 |
| 656 | Ga0495581_0552094 | 3300047315 | Unclassified | 669 |
| 657 | Ga0495636_0075972 | 3300047318 | Bacteria | 1440 |
| 658 | Ga0495674_0545055 | 3300047319 | Unclassified | 924 |
| 659 | Ga0495679_032930 | 3300047446 | Bacteria | 1658 |
| 660 | Ga0495684_0258565 | 3300047471 | Bacteria | 1264 |
| 661 | Ga0495593_0380687 | 3300047673 | Bacteria | 706 |
| 662 | Ga0496100_0202665 | 3300048903 | Bacteria | 1447 |
| 663 | Ga0496102_0372060 | 3300048905 | Bacteria | 1345 |
| 664 | Ga0496104_0104582 | 3300048907 | Bacteria | 2713 |
| 665 | Ga0496104_0221115 | 3300048907 | Bacteria | 1806 |
| 666 | Ga0496104_0658909 | 3300048907 | Bacteria | 956 |
| 667 | Ga0496106_0514083 | 3300048909 | Bacteria | 962 |
| 668 | Ga0496106_1372589 | 3300048909 | Bacteria | 547 |
| 669 | Ga0496108_0629602 | 3300048911 | Bacteria | 933 |
| 670 | Ga0496108_0810758 | 3300048911 | Bacteria | 807 |
| 671 | Ga0496109_0065027 | 3300048912 | Bacteria | 3339 |
| 672 | Ga0496109_1897727 | 3300048912 | Bacteria | 528 |
| 673 | Ga0496110_0204191 | 3300048913 | Bacteria | 1796 |
| 674 | Ga0496111_0619611 | 3300048914 | Bacteria | 791 |
| 675 | Ga0496112_0080200 | 3300048915 | Bacteria | 3227 |
| 676 | Ga0496112_0436407 | 3300048915 | Bacteria | 1248 |
| 677 | Ga0496113_0029012 | 3300048916 | Bacteria | 3989 |
| 678 | Ga0496113_0119753 | 3300048916 | Bacteria | 2057 |
| 679 | Ga0496113_1449850 | 3300048916 | Bacteria | 531 |
| 680 | Ga0496114_0000610 | 3300048917 | Bacteria | 26463 |
| 681 | Ga0496114_0137636 | 3300048917 | Bacteria | 2112 |
| 682 | Ga0496114_0186712 | 3300048917 | Bacteria | 1812 |
| 683 | Ga0496114_0315889 | 3300048917 | Bacteria | 1380 |
| 684 | Ga0496115_0006311 | 3300048918 | Bacteria | 8677 |
| 685 | Ga0496115_0093271 | 3300048918 | Bacteria | 2462 |
| 686 | Ga0501071_0937726 | 3300049587 | Bacteria | 668 |
| 687 | Ga0501072_0440503 | 3300049588 | Bacteria | 1032 |
| 688 | Ga0501072_1360016 | 3300049588 | Archaea | 550 |
| 689 | Ga0501076_1191024 | 3300049592 | Bacteria | 627 |
| 690 | Ga0501081_0226752 | 3300049743 | Bacteria | 1360 |
| 691 | nmdc:mga03n38_395015_c1 | 3300050490 | Bacteria | 760 |
| 692 | nmdc:mga00v17_521917_c1 | 3300050491 | Bacteria | 769 |
| 693 | nmdc:mga0yw44_105867_c1 | 3300050492 | Bacteria | 1797 |
| 694 | nmdc:mga0k408_92239_c1 | 3300050493 | Bacteria | 1780 |
| 695 | nmdc:mga06z11_384621_c1 | 3300050494 | Bacteria | 843 |
| 696 | nmdc:mga07m45_209134_c1 | 3300050496 | Unclassified | 1135 |
| 697 | nmdc:mga05p37_101497_c1 | 3300050507 | Bacteria | 3542 |
| 698 | nmdc:mga05p37_133730_c1 | 3300050507 | Bacteria | 3042 |
| 699 | nmdc:mga05p37_1731333_c1 | 3300050507 | Bacteria | 607 |
| 700 | nmdc:mga05p37_306075_c1 | 3300050507 | Unclassified | 1886 |
| 701 | nmdc:mga05p37_3123_c1 | 3300050507 | Bacteria | 19250 |
| 702 | nmdc:mga05p37_40992_c1 | 3300050507 | Bacteria | 5685 |
| 703 | nmdc:mga05p37_431662_c1 | 3300050507 | Bacteria | 1530 |
| 704 | nmdc:mga05p37_820814_c1 | 3300050507 | Bacteria | 1014 |
| 705 | nmdc:mga09592_8523_c1 | 3300050508 | Bacteria | 8340 |
| 706 | nmdc:mga09592_876359_c1 | 3300050508 | Bacteria | 756 |
| 707 | nmdc:mga0qj67_154292_c1 | 3300050509 | Bacteria | 1863 |
| 708 | nmdc:mga0qj67_230303_c1 | 3300050509 | Unclassified | 1503 |
| 709 | nmdc:mga06r32_135291_c1 | 3300050510 | Bacteria | 2439 |
| 710 | nmdc:mga06r32_1461_c2 | 3300050510 | Bacteria | 12530 |
| 711 | nmdc:mga06r32_21918_c1 | 3300050510 | Bacteria | 5899 |
| 712 | nmdc:mga06r32_751481_c1 | 3300050510 | Bacteria | 938 |
| 713 | nmdc:mga08y16_1067757_c1 | 3300050511 | Bacteria | 784 |
| 714 | nmdc:mga08y16_125482_c1 | 3300050511 | Bacteria | 2670 |
| 715 | nmdc:mga08y16_1870670_c1 | 3300050511 | Unclassified | 552 |
| 716 | nmdc:mga08y16_2996_c1 | 3300050511 | Bacteria | 17422 |
| 717 | nmdc:mga08y16_3131_c1 | 3300050511 | Bacteria | 17131 |
| 718 | nmdc:mga08y16_378040_c1 | 3300050511 | Bacteria | 1023 |
| 719 | nmdc:mga08y16_434921_c1 | 3300050511 | Bacteria | 1340 |
| 720 | nmdc:mga08y16_55981_c1 | 3300050511 | Bacteria | 4122 |
| 721 | nmdc:mga0n895_135903_c1 | 3300050512 | Bacteria | 2485 |
| 722 | nmdc:mga0n895_1857227_c1 | 3300050512 | Bacteria | 562 |
| 723 | nmdc:mga0n895_327496_c1 | 3300050512 | Bacteria | 1552 |
| 724 | nmdc:mga0n895_5166_c1 | 3300050512 | Bacteria | 10861 |
| 725 | nmdc:mga0n895_566930_c1 | 3300050512 | Bacteria | 1140 |
| 726 | nmdc:mga0n895_600398_c1 | 3300050512 | Bacteria | 1103 |
| 727 | nmdc:mga0n895_67_c1 | 3300050512 | Bacteria | 61603 |
| 728 | nmdc:mga0n895_87614_c1 | 3300050512 | Bacteria | 3111 |
| 729 | nmdc:mga0n895_93437_c1 | 3300050512 | Bacteria | 3012 |
| 730 | nmdc:mga0rr50_116006_c1 | 3300050513 | Bacteria | 2126 |
| 731 | nmdc:mga0rr50_197820_c1 | 3300050513 | Bacteria | 1650 |
| 732 | nmdc:mga0rr50_216259_c1 | 3300050513 | Bacteria | 1581 |
| 733 | nmdc:mga0rr50_25_c1 | 3300050513 | Bacteria | 114931 |
| 734 | nmdc:mga0rr50_3824_c1 | 3300050513 | Bacteria | 8740 |
| 735 | nmdc:mga0rr50_3843_c1 | 3300050513 | Bacteria | 8723 |
| 736 | nmdc:mga0rr50_49959_c1 | 3300050513 | Bacteria | 3097 |
| 737 | nmdc:mga0rr50_606425_c1 | 3300050513 | Bacteria | 933 |
| 738 | nmdc:mga0rr50_784087_c1 | 3300050513 | Bacteria | 813 |
| 739 | nmdc:mga0rr50_9455_c1 | 3300050513 | Bacteria | 6130 |
| 740 | nmdc:mga08x19_1214_c1 | 3300050514 | Bacteria | 16039 |
| 741 | nmdc:mga08x19_162120_c1 | 3300050514 | Bacteria | 1519 |
| 742 | nmdc:mga08x19_213_c1 | 3300050514 | Bacteria | 44077 |
| 743 | nmdc:mga08x19_266926_c1 | 3300050514 | Bacteria | 1184 |
| 744 | nmdc:mga08x19_30357_c1 | 3300050514 | Bacteria | 3395 |
| 745 | nmdc:mga0a205_13083_c1 | 3300050515 | Bacteria | 2021 |
| 746 | nmdc:mga0a205_1368569_c1 | 3300050515 | Bacteria | 555 |
| 747 | nmdc:mga0a205_169814_c1 | 3300050515 | Bacteria | 2077 |
| 748 | nmdc:mga0a205_238270_c1 | 3300050515 | Bacteria | 1701 |
| 749 | nmdc:mga0a205_242761_c1 | 3300050515 | Bacteria | 1682 |
| 750 | nmdc:mga0a205_40397_c1 | 3300050515 | Bacteria | 4491 |
| 751 | nmdc:mga0a205_444030_c1 | 3300050515 | Bacteria | 1158 |
| 752 | Ga0495601_0128563 | 3300053077 | Bacteria | 1649 |
| 753 | Ga0495601_0302736 | 3300053077 | Bacteria | 1041 |
| 754 | Ga0495595_0121215 | 3300053084 | Bacteria | 1274 |
| 755 | Ga0495619_0092632 | 3300053085 | Bacteria | 2047 |
| 756 | Ga0500641_0005387 | 3300053096 | Bacteria | 4536 |
| 757 | Ga0500645_007096 | 3300053730 | Bacteria | 3935 |
| 758 | Ga0590077_050701 | 3300059426 | Bacteria | 931 |
| 759 | Ga0501082_1878601 | 3300060353 | Unclassified | 522 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025920 | Ga0207649_11484270 | Ga0207649_114842701 | 118 |
| 2 | 3300032002 | Ga0307416_102812200 | Ga0307416_1028122002 | 125 |
| 3 | 3300005327 | Ga0070658_10395581 | Ga0070658_103955812 | 126 |
| 4 | 3300005337 | Ga0070682_100012320 | Ga0070682_1000123201 | 126 |
| 5 | 3300005544 | Ga0070686_100555145 | Ga0070686_1005551452 | 126 |
| 6 | 3300005577 | Ga0068857_100310511 | Ga0068857_1003105113 | 126 |
| 7 | 3300011119 | Ga0105246_10115262 | Ga0105246_101152622 | 126 |
| 8 | 3300013296 | Ga0157374_10478572 | Ga0157374_104785722 | 126 |
| 9 | 3300013297 | Ga0157378_10000335 | Ga0157378_1000033515 | 126 |
| 10 | 3300013308 | Ga0157375_10000009 | Ga0157375_1000000953 | 126 |
| 11 | 3300025909 | Ga0207705_10393801 | Ga0207705_103938011 | 126 |
| 12 | 3300026116 | Ga0207674_10048880 | Ga0207674_100488805 | 126 |
| 13 | 3300047446 | Ga0495679_032930 | Ga0495679_032930_1050_1430 | 126 |
| 14 | 3300009147 | Ga0114129_11787973 | Ga0114129_117879732 | 127 |
| 15 | 3300009177 | Ga0105248_11346577 | Ga0105248_113465772 | 127 |
| 16 | 3300009177 | Ga0105248_12906642 | Ga0105248_129066422 | 127 |
| 17 | 3300025941 | Ga0207711_10853915 | Ga0207711_108539152 | 127 |
| 18 | 3300035118 | Ga0373954_0598383 | Ga0373954_0598383_87_473 | 127 |
| 19 | 3300046683 | Ga0495658_0049435 | Ga0495658_0049435_437_853 | 127 |
| 20 | 3300005331 | Ga0070670_101138390 | Ga0070670_1011383902 | 128 |
| 21 | 3300005340 | Ga0070689_101292821 | Ga0070689_1012928212 | 128 |
| 22 | 3300005535 | Ga0070684_100782620 | Ga0070684_1007826202 | 128 |
| 23 | 3300005618 | Ga0068864_102364573 | Ga0068864_1023645732 | 128 |
| 24 | 3300006844 | Ga0075428_100105753 | Ga0075428_1001057532 | 128 |
| 25 | 3300006846 | Ga0075430_101017159 | Ga0075430_1010171592 | 128 |
| 26 | 3300025925 | Ga0207650_11246728 | Ga0207650_112467281 | 128 |
| 27 | 3300025933 | Ga0207706_10988511 | Ga0207706_109885112 | 128 |
| 28 | 3300025936 | Ga0207670_10317363 | Ga0207670_103173632 | 128 |
| 29 | 3300035086 | Ga0373934_0115399 | Ga0373934_0115399_287_679 | 128 |
| 30 | 3300035111 | Ga0373923_0150446 | Ga0373923_0150446_605_997 | 128 |
| 31 | 3300035116 | Ga0373945_0058433 | Ga0373945_0058433_410_802 | 128 |
| 32 | 3300035119 | Ga0373956_0040081 | Ga0373956_0040081_1564_1956 | 128 |
| 33 | 3300035170 | Ga0373943_0100732 | Ga0373943_0100732_906_1298 | 128 |
| 34 | 3300035172 | Ga0373955_0134470 | Ga0373955_0134470_641_1033 | 128 |
| 35 | 3300035410 | Ga0373924_0036283 | Ga0373924_0036283_1288_1680 | 128 |
| 36 | 3300035692 | Ga0373935_0288794 | Ga0373935_0288794_128_520 | 128 |
| 37 | 3300035724 | Ga0373933_0133413 | Ga0373933_0133413_1008_1400 | 128 |
| 38 | 3300035725 | Ga0373947_0032067 | Ga0373947_0032067_1628_2020 | 128 |
| 39 | 3300036401 | Ga0373937_0239975 | Ga0373937_0239975_405_797 | 128 |
| 40 | 3300036401 | Ga0373937_1990307 | Ga0373937_1990307_86_487 | 128 |
| 41 | 3300037068 | Ga0373925_0014745 | Ga0373925_0014745_4281_4673 | 128 |
| 42 | 3300046461 | Ga0495641_0383088 | Ga0495641_0383088_225_617 | 128 |
| 43 | 3300046675 | Ga0495657_0820408 | Ga0495657_0820408_63_455 | 128 |
| 44 | 3300005615 | Ga0070702_101078281 | Ga0070702_1010782811 | 129 |
| 45 | 3300005840 | Ga0068870_10679606 | Ga0068870_106796061 | 129 |
| 46 | 3300006871 | Ga0075434_100348387 | Ga0075434_1003483872 | 129 |
| 47 | 3300013296 | Ga0157374_10003033 | Ga0157374_1000303311 | 129 |
| 48 | 3300050512 | nmdc:mga0n895_327496_c1 | nmdc:mga0n895_327496_c1_454_846 | 129 |
| 49 | 3300005295 | Ga0065707_10351777 | Ga0065707_103517772 | 130 |
| 50 | 3300005328 | Ga0070676_10206447 | Ga0070676_102064472 | 130 |
| 51 | 3300005330 | Ga0070690_100090506 | Ga0070690_1000905062 | 130 |
| 52 | 3300005334 | Ga0068869_100035909 | Ga0068869_1000359094 | 130 |
| 53 | 3300005336 | Ga0070680_100262195 | Ga0070680_1002621951 | 130 |
| 54 | 3300005336 | Ga0070680_100330327 | Ga0070680_1003303271 | 130 |
| 55 | 3300005336 | Ga0070680_100974999 | Ga0070680_1009749991 | 130 |
| 56 | 3300005340 | Ga0070689_100324644 | Ga0070689_1003246442 | 130 |
| 57 | 3300005340 | Ga0070689_100376298 | Ga0070689_1003762982 | 130 |
| 58 | 3300005341 | Ga0070691_10017688 | Ga0070691_100176882 | 130 |
| 59 | 3300005353 | Ga0070669_100105382 | Ga0070669_1001053823 | 130 |
| 60 | 3300005354 | Ga0070675_100026987 | Ga0070675_1000269874 | 130 |
| 61 | 3300005364 | Ga0070673_100169786 | Ga0070673_1001697861 | 130 |
| 62 | 3300005364 | Ga0070673_101242566 | Ga0070673_1012425661 | 130 |
| 63 | 3300005365 | Ga0070688_100123277 | Ga0070688_1001232772 | 130 |
| 64 | 3300005366 | Ga0070659_100725167 | Ga0070659_1007251671 | 130 |
| 65 | 3300005438 | Ga0070701_10257855 | Ga0070701_102578551 | 130 |
| 66 | 3300005440 | Ga0070705_100234131 | Ga0070705_1002341312 | 130 |
| 67 | 3300005441 | Ga0070700_100004491 | Ga0070700_1000044911 | 130 |
| 68 | 3300005444 | Ga0070694_100635375 | Ga0070694_1006353752 | 130 |
| 69 | 3300005459 | Ga0068867_100009585 | Ga0068867_1000095858 | 130 |
| 70 | 3300005467 | Ga0070706_101374146 | Ga0070706_1013741461 | 130 |
| 71 | 3300005535 | Ga0070684_100332131 | Ga0070684_1003321312 | 130 |
| 72 | 3300005543 | Ga0070672_100182634 | Ga0070672_1001826342 | 130 |
| 73 | 3300005543 | Ga0070672_100971626 | Ga0070672_1009716261 | 130 |
| 74 | 3300005545 | Ga0070695_100045013 | Ga0070695_1000450132 | 130 |
| 75 | 3300005546 | Ga0070696_100208053 | Ga0070696_1002080532 | 130 |
| 76 | 3300005548 | Ga0070665_100481010 | Ga0070665_1004810102 | 130 |
| 77 | 3300005549 | Ga0070704_100348025 | Ga0070704_1003480251 | 130 |
| 78 | 3300005549 | Ga0070704_101055739 | Ga0070704_1010557391 | 130 |
| 79 | 3300005564 | Ga0070664_100061954 | Ga0070664_1000619541 | 130 |
| 80 | 3300005564 | Ga0070664_100225750 | Ga0070664_1002257502 | 130 |
| 81 | 3300005578 | Ga0068854_100348883 | Ga0068854_1003488832 | 130 |
| 82 | 3300005615 | Ga0070702_100094102 | Ga0070702_1000941023 | 130 |
| 83 | 3300005718 | Ga0068866_10222854 | Ga0068866_102228541 | 130 |
| 84 | 3300005719 | Ga0068861_100000681 | Ga0068861_10000068115 | 130 |
| 85 | 3300005719 | Ga0068861_100014268 | Ga0068861_1000142683 | 130 |
| 86 | 3300005840 | Ga0068870_10569804 | Ga0068870_105698042 | 130 |
| 87 | 3300005840 | Ga0068870_10931305 | Ga0068870_109313052 | 130 |
| 88 | 3300005841 | Ga0068863_100298667 | Ga0068863_1002986672 | 130 |
| 89 | 3300005842 | Ga0068858_100212090 | Ga0068858_1002120903 | 130 |
| 90 | 3300005843 | Ga0068860_101871641 | Ga0068860_1018716411 | 130 |
| 91 | 3300005844 | Ga0068862_100077682 | Ga0068862_1000776824 | 130 |
| 92 | 3300005844 | Ga0068862_100161766 | Ga0068862_1001617661 | 130 |
| 93 | 3300005844 | Ga0068862_100823686 | Ga0068862_1008236862 | 130 |
| 94 | 3300006038 | Ga0075365_10035023 | Ga0075365_100350233 | 130 |
| 95 | 3300006051 | Ga0075364_10638724 | Ga0075364_106387242 | 130 |
| 96 | 3300006058 | Ga0075432_10047611 | Ga0075432_100476112 | 130 |
| 97 | 3300006237 | Ga0097621_100002206 | Ga0097621_1000022066 | 130 |
| 98 | 3300006358 | Ga0068871_100004656 | Ga0068871_1000046563 | 130 |
| 99 | 3300006358 | Ga0068871_100401987 | Ga0068871_1004019872 | 130 |
| 100 | 3300006844 | Ga0075428_100486594 | Ga0075428_1004865942 | 130 |
| 101 | 3300006846 | Ga0075430_100123011 | Ga0075430_1001230111 | 130 |
| 102 | 3300006847 | Ga0075431_100023894 | Ga0075431_1000238943 | 130 |
| 103 | 3300006847 | Ga0075431_100058861 | Ga0075431_1000588615 | 130 |
| 104 | 3300006847 | Ga0075431_100128064 | Ga0075431_1001280643 | 130 |
| 105 | 3300006847 | Ga0075431_101589350 | Ga0075431_1015893501 | 130 |
| 106 | 3300006852 | Ga0075433_10337177 | Ga0075433_103371772 | 130 |
| 107 | 3300006852 | Ga0075433_10472315 | Ga0075433_104723152 | 130 |
| 108 | 3300006852 | Ga0075433_10909381 | Ga0075433_109093812 | 130 |
| 109 | 3300006871 | Ga0075434_100087037 | Ga0075434_1000870373 | 130 |
| 110 | 3300006880 | Ga0075429_100028798 | Ga0075429_1000287983 | 130 |
| 111 | 3300006881 | Ga0068865_100016109 | Ga0068865_1000161097 | 130 |
| 112 | 3300006881 | Ga0068865_101354958 | Ga0068865_1013549582 | 130 |
| 113 | 3300007076 | Ga0075435_100401948 | Ga0075435_1004019482 | 130 |
| 114 | 3300009094 | Ga0111539_10000151 | Ga0111539_1000015144 | 130 |
| 115 | 3300009094 | Ga0111539_10029847 | Ga0111539_100298473 | 130 |
| 116 | 3300009094 | Ga0111539_10874617 | Ga0111539_108746172 | 130 |
| 117 | 3300009098 | Ga0105245_10081028 | Ga0105245_100810283 | 130 |
| 118 | 3300009098 | Ga0105245_12559262 | Ga0105245_125592622 | 130 |
| 119 | 3300009147 | Ga0114129_10456820 | Ga0114129_104568202 | 130 |
| 120 | 3300009147 | Ga0114129_10720633 | Ga0114129_107206332 | 130 |
| 121 | 3300009147 | Ga0114129_11585894 | Ga0114129_115858942 | 130 |
| 122 | 3300009148 | Ga0105243_11048494 | Ga0105243_110484942 | 130 |
| 123 | 3300009148 | Ga0105243_11139607 | Ga0105243_111396071 | 130 |
| 124 | 3300009176 | Ga0105242_10003159 | Ga0105242_100031595 | 130 |
| 125 | 3300009177 | Ga0105248_10804486 | Ga0105248_108044862 | 130 |
| 126 | 3300009177 | Ga0105248_12454952 | Ga0105248_124549522 | 130 |
| 127 | 3300009553 | Ga0105249_11373218 | Ga0105249_113732182 | 130 |
| 128 | 3300010375 | Ga0105239_11551149 | Ga0105239_115511492 | 130 |
| 129 | 3300011119 | Ga0105246_12539436 | Ga0105246_125394361 | 130 |
| 130 | 3300013296 | Ga0157374_11014246 | Ga0157374_110142462 | 130 |
| 131 | 3300013308 | Ga0157375_10688735 | Ga0157375_106887352 | 130 |
| 132 | 3300014325 | Ga0163163_10146700 | Ga0163163_101467004 | 130 |
| 133 | 3300014325 | Ga0163163_11624606 | Ga0163163_116246061 | 130 |
| 134 | 3300014326 | Ga0157380_10850559 | Ga0157380_108505591 | 130 |
| 135 | 3300014745 | Ga0157377_10011786 | Ga0157377_100117864 | 130 |
| 136 | 3300014969 | Ga0157376_10033312 | Ga0157376_100333123 | 130 |
| 137 | 3300014969 | Ga0157376_10457036 | Ga0157376_104570362 | 130 |
| 138 | 3300025899 | Ga0207642_10341979 | Ga0207642_103419792 | 130 |
| 139 | 3300025907 | Ga0207645_10003035 | Ga0207645_1000303515 | 130 |
| 140 | 3300025907 | Ga0207645_10163695 | Ga0207645_101636952 | 130 |
| 141 | 3300025908 | Ga0207643_10425752 | Ga0207643_104257522 | 130 |
| 142 | 3300025910 | Ga0207684_10249510 | Ga0207684_102495102 | 130 |
| 143 | 3300025910 | Ga0207684_10704481 | Ga0207684_107044812 | 130 |
| 144 | 3300025911 | Ga0207654_11385935 | Ga0207654_113859351 | 130 |
| 145 | 3300025917 | Ga0207660_11055818 | Ga0207660_110558182 | 130 |
| 146 | 3300025917 | Ga0207660_11081332 | Ga0207660_110813322 | 130 |
| 147 | 3300025917 | Ga0207660_11130175 | Ga0207660_111301752 | 130 |
| 148 | 3300025918 | Ga0207662_10081080 | Ga0207662_100810803 | 130 |
| 149 | 3300025918 | Ga0207662_10319863 | Ga0207662_103198631 | 130 |
| 150 | 3300025926 | Ga0207659_10022298 | Ga0207659_100222984 | 130 |
| 151 | 3300025926 | Ga0207659_11053739 | Ga0207659_110537391 | 130 |
| 152 | 3300025926 | Ga0207659_11466892 | Ga0207659_114668922 | 130 |
| 153 | 3300025927 | Ga0207687_10896303 | Ga0207687_108963032 | 130 |
| 154 | 3300025931 | Ga0207644_11381650 | Ga0207644_113816501 | 130 |
| 155 | 3300025932 | Ga0207690_11027298 | Ga0207690_110272982 | 130 |
| 156 | 3300025934 | Ga0207686_10049156 | Ga0207686_100491562 | 130 |
| 157 | 3300025935 | Ga0207709_10109876 | Ga0207709_101098763 | 130 |
| 158 | 3300025935 | Ga0207709_10301669 | Ga0207709_103016692 | 130 |
| 159 | 3300025935 | Ga0207709_10486492 | Ga0207709_104864922 | 130 |
| 160 | 3300025938 | Ga0207704_10007163 | Ga0207704_100071632 | 130 |
| 161 | 3300025938 | Ga0207704_11072238 | Ga0207704_110722382 | 130 |
| 162 | 3300025940 | Ga0207691_10625892 | Ga0207691_106258922 | 130 |
| 163 | 3300025941 | Ga0207711_10223361 | Ga0207711_102233611 | 130 |
| 164 | 3300025942 | Ga0207689_11444044 | Ga0207689_114440441 | 130 |
| 165 | 3300025945 | Ga0207679_10382761 | Ga0207679_103827612 | 130 |
| 166 | 3300025945 | Ga0207679_10973605 | Ga0207679_109736052 | 130 |
| 167 | 3300025960 | Ga0207651_10153118 | Ga0207651_101531183 | 130 |
| 168 | 3300025961 | Ga0207712_11455455 | Ga0207712_114554551 | 130 |
| 169 | 3300025981 | Ga0207640_10044262 | Ga0207640_100442624 | 130 |
| 170 | 3300025986 | Ga0207658_11854364 | Ga0207658_118543641 | 130 |
| 171 | 3300026023 | Ga0207677_12012112 | Ga0207677_120121121 | 130 |
| 172 | 3300026075 | Ga0207708_10000915 | Ga0207708_1000091520 | 130 |
| 173 | 3300026088 | Ga0207641_10200789 | Ga0207641_102007892 | 130 |
| 174 | 3300026089 | Ga0207648_10003983 | Ga0207648_1000398318 | 130 |
| 175 | 3300026089 | Ga0207648_10285998 | Ga0207648_102859982 | 130 |
| 176 | 3300026116 | Ga0207674_11159976 | Ga0207674_111599761 | 130 |
| 177 | 3300026118 | Ga0207675_100006469 | Ga0207675_10000646914 | 130 |
| 178 | 3300026118 | Ga0207675_100016792 | Ga0207675_1000167923 | 130 |
| 179 | 3300027907 | Ga0207428_10000643 | Ga0207428_1000064326 | 130 |
| 180 | 3300027907 | Ga0207428_10041193 | Ga0207428_100411932 | 130 |
| 181 | 3300028379 | Ga0268266_10042136 | Ga0268266_100421363 | 130 |
| 182 | 3300028380 | Ga0268265_10060930 | Ga0268265_100609301 | 130 |
| 183 | 3300028380 | Ga0268265_10277451 | Ga0268265_102774513 | 130 |
| 184 | 3300028380 | Ga0268265_10779767 | Ga0268265_107797672 | 130 |
| 185 | 3300028380 | Ga0268265_10785673 | Ga0268265_107856731 | 130 |
| 186 | 3300028381 | Ga0268264_10802557 | Ga0268264_108025572 | 130 |
| 187 | 3300028381 | Ga0268264_12321047 | Ga0268264_123210471 | 130 |
| 188 | 3300031507 | Ga0307509_10417558 | Ga0307509_104175582 | 130 |
| 189 | 3300032002 | Ga0307416_102930123 | Ga0307416_1029301231 | 130 |
| 190 | 3300035119 | Ga0373956_0050242 | Ga0373956_0050242_1398_1802 | 130 |
| 191 | 3300035119 | Ga0373956_0461250 | Ga0373956_0461250_166_558 | 130 |
| 192 | 3300035725 | Ga0373947_0150201 | Ga0373947_0150201_840_1235 | 130 |
| 193 | 3300036401 | Ga0373937_0137948 | Ga0373937_0137948_383_775 | 130 |
| 194 | 3300042436 | Ga0439435_0222972 | Ga0439435_0222972_111_506 | 130 |
| 195 | 3300042461 | Ga0439460_0245275 | Ga0439460_0245275_62_463 | 130 |
| 196 | 3300046455 | Ga0495603_0207111 | Ga0495603_0207111_506_901 | 130 |
| 197 | 3300046681 | Ga0495647_0084909 | Ga0495647_0084909_226_621 | 130 |
| 198 | 3300046683 | Ga0495658_0517530 | Ga0495658_0517530_180_575 | 130 |
| 199 | 3300046684 | Ga0495669_0446805 | Ga0495669_0446805_161_589 | 130 |
| 200 | 3300046690 | Ga0495624_0421424 | Ga0495624_0421424_385_780 | 130 |
| 201 | 3300047315 | Ga0495581_0293870 | Ga0495581_0293870_47_442 | 130 |
| 202 | 3300048907 | Ga0496104_0658909 | Ga0496104_0658909_450_851 | 130 |
| 203 | 3300048911 | Ga0496108_0810758 | Ga0496108_0810758_301_702 | 130 |
| 204 | 3300048912 | Ga0496109_0065027 | Ga0496109_0065027_773_1174 | 130 |
| 205 | 3300048913 | Ga0496110_0204191 | Ga0496110_0204191_145_540 | 130 |
| 206 | 3300048915 | Ga0496112_0436407 | Ga0496112_0436407_515_913 | 130 |
| 207 | 3300048916 | Ga0496113_0119753 | Ga0496113_0119753_220_621 | 130 |
| 208 | 3300048917 | Ga0496114_0315889 | Ga0496114_0315889_392_787 | 130 |
| 209 | 3300049588 | Ga0501072_1360016 | Ga0501072_1360016_121_522 | 130 |
| 210 | 3300049592 | Ga0501076_1191024 | Ga0501076_1191024_85_486 | 130 |
| 211 | 3300050491 | nmdc:mga00v17_521917_c1 | nmdc:mga00v17_521917_c1_47_442 | 130 |
| 212 | 3300050492 | nmdc:mga0yw44_105867_c1 | nmdc:mga0yw44_105867_c1_907_1302 | 130 |
| 213 | 3300050507 | nmdc:mga05p37_306075_c1 | nmdc:mga05p37_306075_c1_200_601 | 130 |
| 214 | 3300050508 | nmdc:mga09592_8523_c1 | nmdc:mga09592_8523_c1_1276_1677 | 130 |
| 215 | 3300050508 | nmdc:mga09592_876359_c1 | nmdc:mga09592_876359_c1_224_649 | 130 |
| 216 | 3300050509 | nmdc:mga0qj67_154292_c1 | nmdc:mga0qj67_154292_c1_1380_1781 | 130 |
| 217 | 3300050509 | nmdc:mga0qj67_230303_c1 | nmdc:mga0qj67_230303_c1_803_1198 | 130 |
| 218 | 3300050510 | nmdc:mga06r32_135291_c1 | nmdc:mga06r32_135291_c1_576_971 | 130 |
| 219 | 3300050510 | nmdc:mga06r32_21918_c1 | nmdc:mga06r32_21918_c1_2505_2906 | 130 |
| 220 | 3300050510 | nmdc:mga06r32_751481_c1 | nmdc:mga06r32_751481_c1_190_585 | 130 |
| 221 | 3300050511 | nmdc:mga08y16_125482_c1 | nmdc:mga08y16_125482_c1_245_703 | 130 |
| 222 | 3300050511 | nmdc:mga08y16_2996_c1 | nmdc:mga08y16_2996_c1_4454_4849 | 130 |
| 223 | 3300050511 | nmdc:mga08y16_3131_c1 | nmdc:mga08y16_3131_c1_11045_11446 | 130 |
| 224 | 3300050511 | nmdc:mga08y16_378040_c1 | nmdc:mga08y16_378040_c1_170_574 | 130 |
| 225 | 3300050511 | nmdc:mga08y16_434921_c1 | nmdc:mga08y16_434921_c1_67_468 | 130 |
| 226 | 3300050512 | nmdc:mga0n895_135903_c1 | nmdc:mga0n895_135903_c1_617_1018 | 130 |
| 227 | 3300050513 | nmdc:mga0rr50_216259_c1 | nmdc:mga0rr50_216259_c1_758_1156 | 130 |
| 228 | 3300050513 | nmdc:mga0rr50_606425_c1 | nmdc:mga0rr50_606425_c1_445_840 | 130 |
| 229 | 3300050515 | nmdc:mga0a205_169814_c1 | nmdc:mga0a205_169814_c1_317_718 | 130 |
| 230 | 3300050515 | nmdc:mga0a205_444030_c1 | nmdc:mga0a205_444030_c1_126_524 | 130 |
| 231 | 3300005290 | Ga0065712_10823906 | Ga0065712_108239061 | 131 |
| 232 | 3300005295 | Ga0065707_10202879 | Ga0065707_102028793 | 131 |
| 233 | 3300005328 | Ga0070676_10625261 | Ga0070676_106252611 | 131 |
| 234 | 3300005329 | Ga0070683_100317533 | Ga0070683_1003175332 | 131 |
| 235 | 3300005330 | Ga0070690_100004924 | Ga0070690_1000049244 | 131 |
| 236 | 3300005334 | Ga0068869_100490718 | Ga0068869_1004907182 | 131 |
| 237 | 3300005335 | Ga0070666_10003143 | Ga0070666_100031436 | 131 |
| 238 | 3300005338 | Ga0068868_100018237 | Ga0068868_1000182377 | 131 |
| 239 | 3300005340 | Ga0070689_101797092 | Ga0070689_1017970921 | 131 |
| 240 | 3300005343 | Ga0070687_100064604 | Ga0070687_1000646042 | 131 |
| 241 | 3300005343 | Ga0070687_100917726 | Ga0070687_1009177261 | 131 |
| 242 | 3300005345 | Ga0070692_10157375 | Ga0070692_101573752 | 131 |
| 243 | 3300005353 | Ga0070669_100005125 | Ga0070669_1000051259 | 131 |
| 244 | 3300005354 | Ga0070675_101754137 | Ga0070675_1017541371 | 131 |
| 245 | 3300005355 | Ga0070671_101310663 | Ga0070671_1013106631 | 131 |
| 246 | 3300005356 | Ga0070674_100345651 | Ga0070674_1003456512 | 131 |
| 247 | 3300005356 | Ga0070674_101917243 | Ga0070674_1019172431 | 131 |
| 248 | 3300005364 | Ga0070673_101808543 | Ga0070673_1018085431 | 131 |
| 249 | 3300005366 | Ga0070659_101296120 | Ga0070659_1012961201 | 131 |
| 250 | 3300005367 | Ga0070667_100980608 | Ga0070667_1009806081 | 131 |
| 251 | 3300005436 | Ga0070713_100088982 | Ga0070713_1000889822 | 131 |
| 252 | 3300005437 | Ga0070710_11282513 | Ga0070710_112825131 | 131 |
| 253 | 3300005439 | Ga0070711_100095835 | Ga0070711_1000958352 | 131 |
| 254 | 3300005440 | Ga0070705_100337544 | Ga0070705_1003375442 | 131 |
| 255 | 3300005440 | Ga0070705_101052570 | Ga0070705_1010525701 | 131 |
| 256 | 3300005441 | Ga0070700_100150393 | Ga0070700_1001503932 | 131 |
| 257 | 3300005441 | Ga0070700_100180565 | Ga0070700_1001805652 | 131 |
| 258 | 3300005441 | Ga0070700_100221466 | Ga0070700_1002214662 | 131 |
| 259 | 3300005444 | Ga0070694_100919842 | Ga0070694_1009198422 | 131 |
| 260 | 3300005445 | Ga0070708_100022843 | Ga0070708_1000228437 | 131 |
| 261 | 3300005455 | Ga0070663_100020449 | Ga0070663_1000204493 | 131 |
| 262 | 3300005457 | Ga0070662_100031938 | Ga0070662_1000319381 | 131 |
| 263 | 3300005457 | Ga0070662_100360256 | Ga0070662_1003602562 | 131 |
| 264 | 3300005457 | Ga0070662_100722412 | Ga0070662_1007224121 | 131 |
| 265 | 3300005467 | Ga0070706_100304070 | Ga0070706_1003040703 | 131 |
| 266 | 3300005467 | Ga0070706_100796461 | Ga0070706_1007964612 | 131 |
| 267 | 3300005467 | Ga0070706_101075290 | Ga0070706_1010752901 | 131 |
| 268 | 3300005468 | Ga0070707_100310473 | Ga0070707_1003104733 | 131 |
| 269 | 3300005471 | Ga0070698_100004142 | Ga0070698_1000041425 | 131 |
| 270 | 3300005471 | Ga0070698_100026852 | Ga0070698_1000268527 | 131 |
| 271 | 3300005471 | Ga0070698_100189432 | Ga0070698_1001894322 | 131 |
| 272 | 3300005471 | Ga0070698_100194599 | Ga0070698_1001945993 | 131 |
| 273 | 3300005471 | Ga0070698_100217638 | Ga0070698_1002176382 | 131 |
| 274 | 3300005518 | Ga0070699_100004957 | Ga0070699_1000049579 | 131 |
| 275 | 3300005518 | Ga0070699_100177604 | Ga0070699_1001776041 | 131 |
| 276 | 3300005535 | Ga0070684_100762004 | Ga0070684_1007620042 | 131 |
| 277 | 3300005536 | Ga0070697_100049890 | Ga0070697_1000498902 | 131 |
| 278 | 3300005536 | Ga0070697_100302959 | Ga0070697_1003029592 | 131 |
| 279 | 3300005536 | Ga0070697_100481341 | Ga0070697_1004813412 | 131 |
| 280 | 3300005544 | Ga0070686_100476676 | Ga0070686_1004766762 | 131 |
| 281 | 3300005544 | Ga0070686_100742458 | Ga0070686_1007424582 | 131 |
| 282 | 3300005545 | Ga0070695_100145958 | Ga0070695_1001459583 | 131 |
| 283 | 3300005545 | Ga0070695_100363170 | Ga0070695_1003631702 | 131 |
| 284 | 3300005546 | Ga0070696_100009861 | Ga0070696_1000098614 | 131 |
| 285 | 3300005546 | Ga0070696_100137056 | Ga0070696_1001370561 | 131 |
| 286 | 3300005546 | Ga0070696_100944289 | Ga0070696_1009442891 | 131 |
| 287 | 3300005548 | Ga0070665_100009577 | Ga0070665_1000095777 | 131 |
| 288 | 3300005548 | Ga0070665_100741745 | Ga0070665_1007417452 | 131 |
| 289 | 3300005577 | Ga0068857_100904170 | Ga0068857_1009041702 | 131 |
| 290 | 3300005577 | Ga0068857_102512445 | Ga0068857_1025124451 | 131 |
| 291 | 3300005578 | Ga0068854_100724572 | Ga0068854_1007245722 | 131 |
| 292 | 3300005616 | Ga0068852_101406783 | Ga0068852_1014067831 | 131 |
| 293 | 3300005617 | Ga0068859_100311125 | Ga0068859_1003111252 | 131 |
| 294 | 3300005617 | Ga0068859_101502178 | Ga0068859_1015021781 | 131 |
| 295 | 3300005617 | Ga0068859_101838467 | Ga0068859_1018384672 | 131 |
| 296 | 3300005618 | Ga0068864_100969643 | Ga0068864_1009696432 | 131 |
| 297 | 3300005718 | Ga0068866_10035697 | Ga0068866_100356973 | 131 |
| 298 | 3300005718 | Ga0068866_10147042 | Ga0068866_101470422 | 131 |
| 299 | 3300005719 | Ga0068861_100053505 | Ga0068861_1000535052 | 131 |
| 300 | 3300005719 | Ga0068861_100155055 | Ga0068861_1001550552 | 131 |
| 301 | 3300005719 | Ga0068861_101031741 | Ga0068861_1010317411 | 131 |
| 302 | 3300005834 | Ga0068851_10176965 | Ga0068851_101769652 | 131 |
| 303 | 3300005840 | Ga0068870_10609774 | Ga0068870_106097741 | 131 |
| 304 | 3300005841 | Ga0068863_100315142 | Ga0068863_1003151423 | 131 |
| 305 | 3300005842 | Ga0068858_100008049 | Ga0068858_1000080497 | 131 |
| 306 | 3300005842 | Ga0068858_100016232 | Ga0068858_1000162325 | 131 |
| 307 | 3300005842 | Ga0068858_100034008 | Ga0068858_1000340082 | 131 |
| 308 | 3300005842 | Ga0068858_101474389 | Ga0068858_1014743891 | 131 |
| 309 | 3300005842 | Ga0068858_102505917 | Ga0068858_1025059171 | 131 |
| 310 | 3300005843 | Ga0068860_100131851 | Ga0068860_1001318512 | 131 |
| 311 | 3300005843 | Ga0068860_100157942 | Ga0068860_1001579423 | 131 |
| 312 | 3300005843 | Ga0068860_100247650 | Ga0068860_1002476502 | 131 |
| 313 | 3300005843 | Ga0068860_100474784 | Ga0068860_1004747842 | 131 |
| 314 | 3300005843 | Ga0068860_100865757 | Ga0068860_1008657572 | 131 |
| 315 | 3300005843 | Ga0068860_100945359 | Ga0068860_1009453592 | 131 |
| 316 | 3300005843 | Ga0068860_102259180 | Ga0068860_1022591801 | 131 |
| 317 | 3300005844 | Ga0068862_100022816 | Ga0068862_1000228166 | 131 |
| 318 | 3300005844 | Ga0068862_100078119 | Ga0068862_1000781193 | 131 |
| 319 | 3300005844 | Ga0068862_100313239 | Ga0068862_1003132392 | 131 |
| 320 | 3300005844 | Ga0068862_100801312 | Ga0068862_1008013122 | 131 |
| 321 | 3300005937 | Ga0081455_10122650 | Ga0081455_101226501 | 131 |
| 322 | 3300005937 | Ga0081455_10138036 | Ga0081455_101380362 | 131 |
| 323 | 3300005937 | Ga0081455_10453137 | Ga0081455_104531371 | 131 |
| 324 | 3300005985 | Ga0081539_10000108 | Ga0081539_1000010891 | 131 |
| 325 | 3300005985 | Ga0081539_10002107 | Ga0081539_1000210722 | 131 |
| 326 | 3300005985 | Ga0081539_10025531 | Ga0081539_100255312 | 131 |
| 327 | 3300006042 | Ga0075368_10221855 | Ga0075368_102218552 | 131 |
| 328 | 3300006058 | Ga0075432_10451903 | Ga0075432_104519032 | 131 |
| 329 | 3300006163 | Ga0070715_10011449 | Ga0070715_100114493 | 131 |
| 330 | 3300006163 | Ga0070715_10268687 | Ga0070715_102686872 | 131 |
| 331 | 3300006163 | Ga0070715_10791538 | Ga0070715_107915382 | 131 |
| 332 | 3300006178 | Ga0075367_10551863 | Ga0075367_105518632 | 131 |
| 333 | 3300006195 | Ga0075366_10094868 | Ga0075366_100948682 | 131 |
| 334 | 3300006195 | Ga0075366_10121652 | Ga0075366_101216522 | 131 |
| 335 | 3300006237 | Ga0097621_100002228 | Ga0097621_1000022288 | 131 |
| 336 | 3300006237 | Ga0097621_100043370 | Ga0097621_1000433704 | 131 |
| 337 | 3300006237 | Ga0097621_100111959 | Ga0097621_1001119592 | 131 |
| 338 | 3300006237 | Ga0097621_100244763 | Ga0097621_1002447632 | 131 |
| 339 | 3300006353 | Ga0075370_10337171 | Ga0075370_103371712 | 131 |
| 340 | 3300006358 | Ga0068871_100000586 | Ga0068871_10000058627 | 131 |
| 341 | 3300006358 | Ga0068871_100066178 | Ga0068871_1000661783 | 131 |
| 342 | 3300006358 | Ga0068871_100204697 | Ga0068871_1002046971 | 131 |
| 343 | 3300006358 | Ga0068871_101025743 | Ga0068871_1010257432 | 131 |
| 344 | 3300006847 | Ga0075431_100005294 | Ga0075431_1000052944 | 131 |
| 345 | 3300006852 | Ga0075433_10030799 | Ga0075433_100307995 | 131 |
| 346 | 3300006852 | Ga0075433_10109154 | Ga0075433_101091543 | 131 |
| 347 | 3300006852 | Ga0075433_10810531 | Ga0075433_108105311 | 131 |
| 348 | 3300006852 | Ga0075433_11442663 | Ga0075433_114426631 | 131 |
| 349 | 3300006871 | Ga0075434_100000538 | Ga0075434_10000053812 | 131 |
| 350 | 3300006871 | Ga0075434_100005479 | Ga0075434_1000054798 | 131 |
| 351 | 3300006871 | Ga0075434_100188581 | Ga0075434_1001885812 | 131 |
| 352 | 3300006871 | Ga0075434_100487152 | Ga0075434_1004871523 | 131 |
| 353 | 3300006871 | Ga0075434_101439069 | Ga0075434_1014390692 | 131 |
| 354 | 3300006871 | Ga0075434_102235310 | Ga0075434_1022353101 | 131 |
| 355 | 3300006881 | Ga0068865_100057007 | Ga0068865_1000570073 | 131 |
| 356 | 3300006881 | Ga0068865_101218460 | Ga0068865_1012184601 | 131 |
| 357 | 3300006914 | Ga0075436_100000641 | Ga0075436_1000006418 | 131 |
| 358 | 3300006914 | Ga0075436_100005174 | Ga0075436_1000051744 | 131 |
| 359 | 3300006914 | Ga0075436_100010981 | Ga0075436_1000109817 | 131 |
| 360 | 3300006914 | Ga0075436_100214603 | Ga0075436_1002146032 | 131 |
| 361 | 3300006914 | Ga0075436_100266632 | Ga0075436_1002666322 | 131 |
| 362 | 3300006931 | Ga0097620_100311115 | Ga0097620_1003111152 | 131 |
| 363 | 3300006931 | Ga0097620_100585708 | Ga0097620_1005857082 | 131 |
| 364 | 3300006931 | Ga0097620_101502223 | Ga0097620_1015022231 | 131 |
| 365 | 3300006931 | Ga0097620_101838830 | Ga0097620_1018388302 | 131 |
| 366 | 3300007076 | Ga0075435_100000009 | Ga0075435_10000000929 | 131 |
| 367 | 3300007076 | Ga0075435_100000567 | Ga0075435_1000005677 | 131 |
| 368 | 3300007076 | Ga0075435_100001575 | Ga0075435_10000157510 | 131 |
| 369 | 3300007076 | Ga0075435_100005738 | Ga0075435_1000057383 | 131 |
| 370 | 3300007076 | Ga0075435_100012126 | Ga0075435_1000121267 | 131 |
| 371 | 3300007076 | Ga0075435_100081777 | Ga0075435_1000817772 | 131 |
| 372 | 3300007076 | Ga0075435_100395254 | Ga0075435_1003952542 | 131 |
| 373 | 3300009093 | Ga0105240_10455643 | Ga0105240_104556432 | 131 |
| 374 | 3300009093 | Ga0105240_12068601 | Ga0105240_120686012 | 131 |
| 375 | 3300009094 | Ga0111539_10643147 | Ga0111539_106431471 | 131 |
| 376 | 3300009098 | Ga0105245_10012218 | Ga0105245_100122184 | 131 |
| 377 | 3300009098 | Ga0105245_10028212 | Ga0105245_100282122 | 131 |
| 378 | 3300009101 | Ga0105247_10027790 | Ga0105247_100277906 | 131 |
| 379 | 3300009101 | Ga0105247_10125128 | Ga0105247_101251282 | 131 |
| 380 | 3300009147 | Ga0114129_10009169 | Ga0114129_100091698 | 131 |
| 381 | 3300009147 | Ga0114129_10022392 | Ga0114129_100223929 | 131 |
| 382 | 3300009147 | Ga0114129_10048648 | Ga0114129_100486486 | 131 |
| 383 | 3300009147 | Ga0114129_10122203 | Ga0114129_101222034 | 131 |
| 384 | 3300009147 | Ga0114129_10284631 | Ga0114129_102846312 | 131 |
| 385 | 3300009147 | Ga0114129_10302378 | Ga0114129_103023781 | 131 |
| 386 | 3300009147 | Ga0114129_12651297 | Ga0114129_126512971 | 131 |
| 387 | 3300009148 | Ga0105243_10022611 | Ga0105243_100226114 | 131 |
| 388 | 3300009148 | Ga0105243_12512079 | Ga0105243_125120791 | 131 |
| 389 | 3300009174 | Ga0105241_10128908 | Ga0105241_101289083 | 131 |
| 390 | 3300009174 | Ga0105241_11699043 | Ga0105241_116990432 | 131 |
| 391 | 3300009176 | Ga0105242_10003881 | Ga0105242_100038817 | 131 |
| 392 | 3300009176 | Ga0105242_10141531 | Ga0105242_101415312 | 131 |
| 393 | 3300009177 | Ga0105248_10077759 | Ga0105248_100777596 | 131 |
| 394 | 3300009177 | Ga0105248_10313262 | Ga0105248_103132623 | 131 |
| 395 | 3300009177 | Ga0105248_10361757 | Ga0105248_103617572 | 131 |
| 396 | 3300009177 | Ga0105248_10538965 | Ga0105248_105389651 | 131 |
| 397 | 3300009177 | Ga0105248_11377764 | Ga0105248_113777641 | 131 |
| 398 | 3300009177 | Ga0105248_12456203 | Ga0105248_124562032 | 131 |
| 399 | 3300009545 | Ga0105237_10179827 | Ga0105237_101798272 | 131 |
| 400 | 3300009551 | Ga0105238_12842607 | Ga0105238_128426071 | 131 |
| 401 | 3300009553 | Ga0105249_10109645 | Ga0105249_101096452 | 131 |
| 402 | 3300009553 | Ga0105249_10374136 | Ga0105249_103741361 | 131 |
| 403 | 3300009553 | Ga0105249_12359685 | Ga0105249_123596852 | 131 |
| 404 | 3300009553 | Ga0105249_12494558 | Ga0105249_124945582 | 131 |
| 405 | 3300011119 | Ga0105246_10398268 | Ga0105246_103982682 | 131 |
| 406 | 3300013296 | Ga0157374_10192778 | Ga0157374_101927783 | 131 |
| 407 | 3300013296 | Ga0157374_10559245 | Ga0157374_105592452 | 131 |
| 408 | 3300013297 | Ga0157378_10000904 | Ga0157378_1000090423 | 131 |
| 409 | 3300013297 | Ga0157378_10009297 | Ga0157378_100092972 | 131 |
| 410 | 3300013297 | Ga0157378_10419507 | Ga0157378_104195072 | 131 |
| 411 | 3300013297 | Ga0157378_11695148 | Ga0157378_116951482 | 131 |
| 412 | 3300013297 | Ga0157378_12273019 | Ga0157378_122730191 | 131 |
| 413 | 3300013306 | Ga0163162_10051414 | Ga0163162_100514143 | 131 |
| 414 | 3300014325 | Ga0163163_10040445 | Ga0163163_100404456 | 131 |
| 415 | 3300014325 | Ga0163163_10999765 | Ga0163163_109997652 | 131 |
| 416 | 3300014326 | Ga0157380_10071637 | Ga0157380_100716373 | 131 |
| 417 | 3300014326 | Ga0157380_10216754 | Ga0157380_102167542 | 131 |
| 418 | 3300014326 | Ga0157380_10713424 | Ga0157380_107134242 | 131 |
| 419 | 3300014326 | Ga0157380_10717814 | Ga0157380_107178142 | 131 |
| 420 | 3300014968 | Ga0157379_10017793 | Ga0157379_100177935 | 131 |
| 421 | 3300014968 | Ga0157379_10027746 | Ga0157379_100277466 | 131 |
| 422 | 3300014968 | Ga0157379_10071716 | Ga0157379_100717163 | 131 |
| 423 | 3300014968 | Ga0157379_10274943 | Ga0157379_102749432 | 131 |
| 424 | 3300014968 | Ga0157379_10418490 | Ga0157379_104184902 | 131 |
| 425 | 3300014969 | Ga0157376_10484621 | Ga0157376_104846212 | 131 |
| 426 | 3300017792 | Ga0163161_11602166 | Ga0163161_116021662 | 131 |
| 427 | 3300025315 | Ga0207697_10017848 | Ga0207697_100178482 | 131 |
| 428 | 3300025893 | Ga0207682_10378677 | Ga0207682_103786772 | 131 |
| 429 | 3300025893 | Ga0207682_10394205 | Ga0207682_103942052 | 131 |
| 430 | 3300025899 | Ga0207642_10236748 | Ga0207642_102367482 | 131 |
| 431 | 3300025900 | Ga0207710_10008364 | Ga0207710_100083644 | 131 |
| 432 | 3300025900 | Ga0207710_10068574 | Ga0207710_100685742 | 131 |
| 433 | 3300025903 | Ga0207680_10031313 | Ga0207680_100313133 | 131 |
| 434 | 3300025903 | Ga0207680_10062012 | Ga0207680_100620122 | 131 |
| 435 | 3300025905 | Ga0207685_10252148 | Ga0207685_102521482 | 131 |
| 436 | 3300025907 | Ga0207645_10364248 | Ga0207645_103642482 | 131 |
| 437 | 3300025907 | Ga0207645_10588729 | Ga0207645_105887292 | 131 |
| 438 | 3300025908 | Ga0207643_10162025 | Ga0207643_101620252 | 131 |
| 439 | 3300025910 | Ga0207684_10254606 | Ga0207684_102546062 | 131 |
| 440 | 3300025910 | Ga0207684_10577242 | Ga0207684_105772422 | 131 |
| 441 | 3300025911 | Ga0207654_10627184 | Ga0207654_106271842 | 131 |
| 442 | 3300025913 | Ga0207695_10345304 | Ga0207695_103453041 | 131 |
| 443 | 3300025913 | Ga0207695_11150803 | Ga0207695_111508032 | 131 |
| 444 | 3300025914 | Ga0207671_10121874 | Ga0207671_101218743 | 131 |
| 445 | 3300025918 | Ga0207662_10048272 | Ga0207662_100482722 | 131 |
| 446 | 3300025922 | Ga0207646_10211568 | Ga0207646_102115682 | 131 |
| 447 | 3300025923 | Ga0207681_10025533 | Ga0207681_100255333 | 131 |
| 448 | 3300025925 | Ga0207650_11315215 | Ga0207650_113152151 | 131 |
| 449 | 3300025927 | Ga0207687_10000530 | Ga0207687_1000053025 | 131 |
| 450 | 3300025927 | Ga0207687_10188860 | Ga0207687_101888601 | 131 |
| 451 | 3300025927 | Ga0207687_10643128 | Ga0207687_106431282 | 131 |
| 452 | 3300025928 | Ga0207700_11069741 | Ga0207700_110697412 | 131 |
| 453 | 3300025932 | Ga0207690_11289617 | Ga0207690_112896172 | 131 |
| 454 | 3300025933 | Ga0207706_10018270 | Ga0207706_100182708 | 131 |
| 455 | 3300025933 | Ga0207706_10100721 | Ga0207706_101007213 | 131 |
| 456 | 3300025934 | Ga0207686_10049898 | Ga0207686_100498984 | 131 |
| 457 | 3300025934 | Ga0207686_10772932 | Ga0207686_107729322 | 131 |
| 458 | 3300025935 | Ga0207709_10040099 | Ga0207709_100400991 | 131 |
| 459 | 3300025935 | Ga0207709_11505467 | Ga0207709_115054671 | 131 |
| 460 | 3300025936 | Ga0207670_10630202 | Ga0207670_106302022 | 131 |
| 461 | 3300025936 | Ga0207670_10837083 | Ga0207670_108370831 | 131 |
| 462 | 3300025937 | Ga0207669_10121822 | Ga0207669_101218222 | 131 |
| 463 | 3300025938 | Ga0207704_10508492 | Ga0207704_105084921 | 131 |
| 464 | 3300025940 | Ga0207691_10386140 | Ga0207691_103861401 | 131 |
| 465 | 3300025940 | Ga0207691_10574388 | Ga0207691_105743881 | 131 |
| 466 | 3300025941 | Ga0207711_10010783 | Ga0207711_100107836 | 131 |
| 467 | 3300025941 | Ga0207711_10166711 | Ga0207711_101667112 | 131 |
| 468 | 3300025941 | Ga0207711_10199765 | Ga0207711_101997653 | 131 |
| 469 | 3300025942 | Ga0207689_10372620 | Ga0207689_103726201 | 131 |
| 470 | 3300025945 | Ga0207679_10098032 | Ga0207679_100980322 | 131 |
| 471 | 3300025945 | Ga0207679_10562586 | Ga0207679_105625861 | 131 |
| 472 | 3300025945 | Ga0207679_11970956 | Ga0207679_119709561 | 131 |
| 473 | 3300025945 | Ga0207679_12187379 | Ga0207679_121873791 | 131 |
| 474 | 3300025949 | Ga0207667_10575891 | Ga0207667_105758912 | 131 |
| 475 | 3300025960 | Ga0207651_10704728 | Ga0207651_107047282 | 131 |
| 476 | 3300025960 | Ga0207651_10725224 | Ga0207651_107252242 | 131 |
| 477 | 3300025960 | Ga0207651_11883328 | Ga0207651_118833282 | 131 |
| 478 | 3300025961 | Ga0207712_10217069 | Ga0207712_102170692 | 131 |
| 479 | 3300025961 | Ga0207712_11167266 | Ga0207712_111672661 | 131 |
| 480 | 3300025961 | Ga0207712_12024963 | Ga0207712_120249631 | 131 |
| 481 | 3300025981 | Ga0207640_10505539 | Ga0207640_105055392 | 131 |
| 482 | 3300025981 | Ga0207640_10736330 | Ga0207640_107363302 | 131 |
| 483 | 3300025986 | Ga0207658_10573092 | Ga0207658_105730922 | 131 |
| 484 | 3300026023 | Ga0207677_10425132 | Ga0207677_104251322 | 131 |
| 485 | 3300026035 | Ga0207703_10019292 | Ga0207703_100192922 | 131 |
| 486 | 3300026035 | Ga0207703_10029802 | Ga0207703_100298027 | 131 |
| 487 | 3300026035 | Ga0207703_10063621 | Ga0207703_100636212 | 131 |
| 488 | 3300026041 | Ga0207639_11326447 | Ga0207639_113264471 | 131 |
| 489 | 3300026067 | Ga0207678_10112203 | Ga0207678_101122031 | 131 |
| 490 | 3300026075 | Ga0207708_10145781 | Ga0207708_101457812 | 131 |
| 491 | 3300026075 | Ga0207708_10311221 | Ga0207708_103112212 | 131 |
| 492 | 3300026075 | Ga0207708_10489544 | Ga0207708_104895442 | 131 |
| 493 | 3300026088 | Ga0207641_10380226 | Ga0207641_103802262 | 131 |
| 494 | 3300026089 | Ga0207648_10722726 | Ga0207648_107227261 | 131 |
| 495 | 3300026089 | Ga0207648_11559852 | Ga0207648_115598521 | 131 |
| 496 | 3300026118 | Ga0207675_100042052 | Ga0207675_1000420522 | 131 |
| 497 | 3300026118 | Ga0207675_100136023 | Ga0207675_1001360232 | 131 |
| 498 | 3300026118 | Ga0207675_100657184 | Ga0207675_1006571842 | 131 |
| 499 | 3300026118 | Ga0207675_102081948 | Ga0207675_1020819482 | 131 |
| 500 | 3300026121 | Ga0207683_11399240 | Ga0207683_113992401 | 131 |
| 501 | 3300026142 | Ga0207698_10834905 | Ga0207698_108349052 | 131 |
| 502 | 3300028379 | Ga0268266_10053356 | Ga0268266_100533565 | 131 |
| 503 | 3300028379 | Ga0268266_12339295 | Ga0268266_123392951 | 131 |
| 504 | 3300028380 | Ga0268265_10088493 | Ga0268265_100884933 | 131 |
| 505 | 3300028380 | Ga0268265_10174329 | Ga0268265_101743291 | 131 |
| 506 | 3300028380 | Ga0268265_10253867 | Ga0268265_102538672 | 131 |
| 507 | 3300028380 | Ga0268265_10658754 | Ga0268265_106587542 | 131 |
| 508 | 3300028380 | Ga0268265_11302278 | Ga0268265_113022781 | 131 |
| 509 | 3300028380 | Ga0268265_11982088 | Ga0268265_119820881 | 131 |
| 510 | 3300028380 | Ga0268265_12532161 | Ga0268265_125321611 | 131 |
| 511 | 3300028381 | Ga0268264_10082725 | Ga0268264_100827253 | 131 |
| 512 | 3300028381 | Ga0268264_10179094 | Ga0268264_101790941 | 131 |
| 513 | 3300028381 | Ga0268264_10226300 | Ga0268264_102263003 | 131 |
| 514 | 3300028381 | Ga0268264_10354267 | Ga0268264_103542672 | 131 |
| 515 | 3300028381 | Ga0268264_10408577 | Ga0268264_104085772 | 131 |
| 516 | 3300028381 | Ga0268264_10853112 | Ga0268264_108531122 | 131 |
| 517 | 3300028381 | Ga0268264_12673372 | Ga0268264_126733721 | 131 |
| 518 | 3300030521 | Ga0307511_10005949 | Ga0307511_100059496 | 131 |
| 519 | 3300031911 | Ga0307412_10219076 | Ga0307412_102190761 | 131 |
| 520 | 3300032004 | Ga0307414_11663409 | Ga0307414_116634092 | 131 |
| 521 | 3300034816 | Ga0373930_0001309 | Ga0373930_0001309_343_741 | 131 |
| 522 | 3300034817 | Ga0373948_0001672 | Ga0373948_0001672_1786_2184 | 131 |
| 523 | 3300034818 | Ga0373950_0011332 | Ga0373950_0011332_790_1188 | 131 |
| 524 | 3300034819 | Ga0373958_0030053 | Ga0373958_0030053_646_1044 | 131 |
| 525 | 3300034957 | Ga0373938_0048910 | Ga0373938_0048910_93_491 | 131 |
| 526 | 3300035084 | Ga0373928_0004086 | Ga0373928_0004086_2167_2565 | 131 |
| 527 | 3300035084 | Ga0373928_0021459 | Ga0373928_0021459_542_943 | 131 |
| 528 | 3300035085 | Ga0373929_0001021 | Ga0373929_0001021_3154_3552 | 131 |
| 529 | 3300035088 | Ga0373940_0023884 | Ga0373940_0023884_978_1376 | 131 |
| 530 | 3300035090 | Ga0373949_0001236 | Ga0373949_0001236_5970_6368 | 131 |
| 531 | 3300035090 | Ga0373949_0002813 | Ga0373949_0002813_3719_4126 | 131 |
| 532 | 3300035091 | Ga0373951_0000826 | Ga0373951_0000826_527_925 | 131 |
| 533 | 3300035091 | Ga0373951_0161414 | Ga0373951_0161414_176_577 | 131 |
| 534 | 3300035092 | Ga0373952_0002002 | Ga0373952_0002002_244_642 | 131 |
| 535 | 3300035112 | Ga0373932_0002098 | Ga0373932_0002098_3843_4241 | 131 |
| 536 | 3300035114 | Ga0373939_0000603 | Ga0373939_0000603_2231_2629 | 131 |
| 537 | 3300035114 | Ga0373939_0241832 | Ga0373939_0241832_140_541 | 131 |
| 538 | 3300035114 | Ga0373939_0291909 | Ga0373939_0291909_225_632 | 131 |
| 539 | 3300035115 | Ga0373941_0000169 | Ga0373941_0000169_5000_5398 | 131 |
| 540 | 3300035115 | Ga0373941_0061438 | Ga0373941_0061438_798_1199 | 131 |
| 541 | 3300035121 | Ga0373960_0001719 | Ga0373960_0001719_1432_1830 | 131 |
| 542 | 3300035170 | Ga0373943_0776085 | Ga0373943_0776085_56_454 | 131 |
| 543 | 3300035171 | Ga0373946_0177356 | Ga0373946_0177356_392_790 | 131 |
| 544 | 3300035207 | Ga0373942_0002266 | Ga0373942_0002266_2588_2986 | 131 |
| 545 | 3300035241 | Ga0373961_0000682 | Ga0373961_0000682_8451_8849 | 131 |
| 546 | 3300035242 | Ga0373962_0000733 | Ga0373962_0000733_115_513 | 131 |
| 547 | 3300035691 | Ga0373931_0039343 | Ga0373931_0039343_932_1330 | 131 |
| 548 | 3300035691 | Ga0373931_0184085 | Ga0373931_0184085_289_690 | 131 |
| 549 | 3300035692 | Ga0373935_0434848 | Ga0373935_0434848_256_657 | 131 |
| 550 | 3300035724 | Ga0373933_0357985 | Ga0373933_0357985_289_687 | 131 |
| 551 | 3300036401 | Ga0373937_1053062 | Ga0373937_1053062_132_530 | 131 |
| 552 | 3300037068 | Ga0373925_0037974 | Ga0373925_0037974_949_1347 | 131 |
| 553 | 3300037068 | Ga0373925_1284105 | Ga0373925_1284105_189_590 | 131 |
| 554 | 3300045051 | Ga0451576_0222034 | Ga0451576_0222034_437_844 | 131 |
| 555 | 3300046461 | Ga0495641_0192905 | Ga0495641_0192905_353_751 | 131 |
| 556 | 3300046463 | Ga0495653_0279680 | Ga0495653_0279680_429_827 | 131 |
| 557 | 3300046472 | Ga0495580_0186101 | Ga0495580_0186101_409_810 | 131 |
| 558 | 3300046475 | Ga0495639_0023059 | Ga0495639_0023059_1469_1870 | 131 |
| 559 | 3300046475 | Ga0495639_0249753 | Ga0495639_0249753_72_470 | 131 |
| 560 | 3300046499 | Ga0495594_0171845 | Ga0495594_0171845_150_548 | 131 |
| 561 | 3300046522 | Ga0495643_0038122 | Ga0495643_0038122_927_1325 | 131 |
| 562 | 3300046528 | Ga0495642_0109788 | Ga0495642_0109788_685_1083 | 131 |
| 563 | 3300046535 | Ga0495586_0305938 | Ga0495586_0305938_227_625 | 131 |
| 564 | 3300046559 | Ga0495667_0519788 | Ga0495667_0519788_232_630 | 131 |
| 565 | 3300046642 | Ga0495634_0840089 | Ga0495634_0840089_33_440 | 131 |
| 566 | 3300046663 | Ga0495635_0096267 | Ga0495635_0096267_928_1326 | 131 |
| 567 | 3300046681 | Ga0495647_0079829 | Ga0495647_0079829_420_827 | 131 |
| 568 | 3300046684 | Ga0495669_0018866 | Ga0495669_0018866_143_541 | 131 |
| 569 | 3300046684 | Ga0495669_0471746 | Ga0495669_0471746_55_462 | 131 |
| 570 | 3300046689 | Ga0495613_0385305 | Ga0495613_0385305_28_426 | 131 |
| 571 | 3300047315 | Ga0495581_0195122 | Ga0495581_0195122_744_1145 | 131 |
| 572 | 3300047315 | Ga0495581_0552094 | Ga0495581_0552094_208_606 | 131 |
| 573 | 3300047318 | Ga0495636_0075972 | Ga0495636_0075972_123_521 | 131 |
| 574 | 3300047319 | Ga0495674_0545055 | Ga0495674_0545055_302_697 | 131 |
| 575 | 3300047471 | Ga0495684_0258565 | Ga0495684_0258565_610_1008 | 131 |
| 576 | 3300047673 | Ga0495593_0380687 | Ga0495593_0380687_78_476 | 131 |
| 577 | 3300048903 | Ga0496100_0202665 | Ga0496100_0202665_131_529 | 131 |
| 578 | 3300048905 | Ga0496102_0372060 | Ga0496102_0372060_253_651 | 131 |
| 579 | 3300048907 | Ga0496104_0104582 | Ga0496104_0104582_563_961 | 131 |
| 580 | 3300048907 | Ga0496104_0221115 | Ga0496104_0221115_929_1327 | 131 |
| 581 | 3300048909 | Ga0496106_0514083 | Ga0496106_0514083_455_853 | 131 |
| 582 | 3300048909 | Ga0496106_1372589 | Ga0496106_1372589_60_458 | 131 |
| 583 | 3300048911 | Ga0496108_0629602 | Ga0496108_0629602_236_634 | 131 |
| 584 | 3300048914 | Ga0496111_0619611 | Ga0496111_0619611_287_685 | 131 |
| 585 | 3300048915 | Ga0496112_0080200 | Ga0496112_0080200_1123_1521 | 131 |
| 586 | 3300048916 | Ga0496113_0029012 | Ga0496113_0029012_1329_1727 | 131 |
| 587 | 3300048916 | Ga0496113_1449850 | Ga0496113_1449850_87_485 | 131 |
| 588 | 3300048917 | Ga0496114_0000610 | Ga0496114_0000610_6366_6764 | 131 |
| 589 | 3300048917 | Ga0496114_0137636 | Ga0496114_0137636_1014_1412 | 131 |
| 590 | 3300048917 | Ga0496114_0186712 | Ga0496114_0186712_272_670 | 131 |
| 591 | 3300048918 | Ga0496115_0006311 | Ga0496115_0006311_5683_6081 | 131 |
| 592 | 3300048918 | Ga0496115_0093271 | Ga0496115_0093271_1850_2248 | 131 |
| 593 | 3300049587 | Ga0501071_0937726 | Ga0501071_0937726_175_573 | 131 |
| 594 | 3300049588 | Ga0501072_0440503 | Ga0501072_0440503_186_587 | 131 |
| 595 | 3300050490 | nmdc:mga03n38_395015_c1 | nmdc:mga03n38_395015_c1_112_510 | 131 |
| 596 | 3300050493 | nmdc:mga0k408_92239_c1 | nmdc:mga0k408_92239_c1_1173_1571 | 131 |
| 597 | 3300050494 | nmdc:mga06z11_384621_c1 | nmdc:mga06z11_384621_c1_363_761 | 131 |
| 598 | 3300050496 | nmdc:mga07m45_209134_c1 | nmdc:mga07m45_209134_c1_375_773 | 131 |
| 599 | 3300050507 | nmdc:mga05p37_101497_c1 | nmdc:mga05p37_101497_c1_26_424 | 131 |
| 600 | 3300050507 | nmdc:mga05p37_133730_c1 | nmdc:mga05p37_133730_c1_404_802 | 131 |
| 601 | 3300050507 | nmdc:mga05p37_3123_c1 | nmdc:mga05p37_3123_c1_1536_1934 | 131 |
| 602 | 3300050507 | nmdc:mga05p37_40992_c1 | nmdc:mga05p37_40992_c1_1615_2046 | 131 |
| 603 | 3300050507 | nmdc:mga05p37_431662_c1 | nmdc:mga05p37_431662_c1_377_784 | 131 |
| 604 | 3300050510 | nmdc:mga06r32_1461_c2 | nmdc:mga06r32_1461_c2_5089_5487 | 131 |
| 605 | 3300050511 | nmdc:mga08y16_1870670_c1 | nmdc:mga08y16_1870670_c1_101_499 | 131 |
| 606 | 3300050512 | nmdc:mga0n895_1857227_c1 | nmdc:mga0n895_1857227_c1_153_551 | 131 |
| 607 | 3300050512 | nmdc:mga0n895_5166_c1 | nmdc:mga0n895_5166_c1_7644_8042 | 131 |
| 608 | 3300050512 | nmdc:mga0n895_566930_c1 | nmdc:mga0n895_566930_c1_655_1053 | 131 |
| 609 | 3300050512 | nmdc:mga0n895_600398_c1 | nmdc:mga0n895_600398_c1_242_673 | 131 |
| 610 | 3300050512 | nmdc:mga0n895_67_c1 | nmdc:mga0n895_67_c1_16801_17199 | 131 |
| 611 | 3300050512 | nmdc:mga0n895_87614_c1 | nmdc:mga0n895_87614_c1_812_1210 | 131 |
| 612 | 3300050512 | nmdc:mga0n895_93437_c1 | nmdc:mga0n895_93437_c1_86_493 | 131 |
| 613 | 3300050513 | nmdc:mga0rr50_116006_c1 | nmdc:mga0rr50_116006_c1_1496_1903 | 131 |
| 614 | 3300050513 | nmdc:mga0rr50_197820_c1 | nmdc:mga0rr50_197820_c1_625_1023 | 131 |
| 615 | 3300050513 | nmdc:mga0rr50_25_c1 | nmdc:mga0rr50_25_c1_74392_74790 | 131 |
| 616 | 3300050513 | nmdc:mga0rr50_3824_c1 | nmdc:mga0rr50_3824_c1_1089_1487 | 131 |
| 617 | 3300050513 | nmdc:mga0rr50_3843_c1 | nmdc:mga0rr50_3843_c1_3892_4290 | 131 |
| 618 | 3300050513 | nmdc:mga0rr50_49959_c1 | nmdc:mga0rr50_49959_c1_38_436 | 131 |
| 619 | 3300050513 | nmdc:mga0rr50_784087_c1 | nmdc:mga0rr50_784087_c1_217_615 | 131 |
| 620 | 3300050513 | nmdc:mga0rr50_9455_c1 | nmdc:mga0rr50_9455_c1_4403_4801 | 131 |
| 621 | 3300050514 | nmdc:mga08x19_1214_c1 | nmdc:mga08x19_1214_c1_5963_6361 | 131 |
| 622 | 3300050514 | nmdc:mga08x19_162120_c1 | nmdc:mga08x19_162120_c1_594_992 | 131 |
| 623 | 3300050514 | nmdc:mga08x19_213_c1 | nmdc:mga08x19_213_c1_38994_39392 | 131 |
| 624 | 3300050514 | nmdc:mga08x19_266926_c1 | nmdc:mga08x19_266926_c1_581_988 | 131 |
| 625 | 3300050514 | nmdc:mga08x19_30357_c1 | nmdc:mga08x19_30357_c1_176_574 | 131 |
| 626 | 3300050515 | nmdc:mga0a205_13083_c1 | nmdc:mga0a205_13083_c1_302_700 | 131 |
| 627 | 3300050515 | nmdc:mga0a205_1368569_c1 | nmdc:mga0a205_1368569_c1_89_487 | 131 |
| 628 | 3300050515 | nmdc:mga0a205_242761_c1 | nmdc:mga0a205_242761_c1_1205_1666 | 131 |
| 629 | 3300050515 | nmdc:mga0a205_40397_c1 | nmdc:mga0a205_40397_c1_3116_3514 | 131 |
| 630 | 3300053077 | Ga0495601_0128563 | Ga0495601_0128563_313_714 | 131 |
| 631 | 3300053077 | Ga0495601_0302736 | Ga0495601_0302736_612_1010 | 131 |
| 632 | 3300053084 | Ga0495595_0121215 | Ga0495595_0121215_212_610 | 131 |
| 633 | 3300053085 | Ga0495619_0092632 | Ga0495619_0092632_767_1165 | 131 |
| 634 | 3300053096 | Ga0500641_0005387 | Ga0500641_0005387_3400_3798 | 131 |
| 635 | 3300053730 | Ga0500645_007096 | Ga0500645_007096_1467_1865 | 131 |
| 636 | 3300059426 | Ga0590077_050701 | Ga0590077_050701_238_636 | 131 |
| 637 | 3300060353 | Ga0501082_1878601 | Ga0501082_1878601_79_477 | 131 |
| 638 | 3300005328 | Ga0070676_10812490 | Ga0070676_108124901 | 132 |
| 639 | 3300005334 | Ga0068869_100432584 | Ga0068869_1004325842 | 132 |
| 640 | 3300005356 | Ga0070674_100801129 | Ga0070674_1008011291 | 132 |
| 641 | 3300005459 | Ga0068867_101490588 | Ga0068867_1014905881 | 132 |
| 642 | 3300005548 | Ga0070665_100002769 | Ga0070665_10000276915 | 132 |
| 643 | 3300005617 | Ga0068859_100402503 | Ga0068859_1004025031 | 132 |
| 644 | 3300005617 | Ga0068859_100797851 | Ga0068859_1007978511 | 132 |
| 645 | 3300005618 | Ga0068864_100594986 | Ga0068864_1005949862 | 132 |
| 646 | 3300005718 | Ga0068866_10909040 | Ga0068866_109090402 | 132 |
| 647 | 3300005841 | Ga0068863_100400714 | Ga0068863_1004007141 | 132 |
| 648 | 3300005844 | Ga0068862_102602913 | Ga0068862_1026029131 | 132 |
| 649 | 3300005985 | Ga0081539_10100914 | Ga0081539_101009142 | 132 |
| 650 | 3300006237 | Ga0097621_100089092 | Ga0097621_1000890923 | 132 |
| 651 | 3300006358 | Ga0068871_100035460 | Ga0068871_1000354603 | 132 |
| 652 | 3300006881 | Ga0068865_100029317 | Ga0068865_1000293176 | 132 |
| 653 | 3300006931 | Ga0097620_100402499 | Ga0097620_1004024991 | 132 |
| 654 | 3300006931 | Ga0097620_100797920 | Ga0097620_1007979201 | 132 |
| 655 | 3300009093 | Ga0105240_11374147 | Ga0105240_113741472 | 132 |
| 656 | 3300009098 | Ga0105245_10064778 | Ga0105245_100647785 | 132 |
| 657 | 3300009147 | Ga0114129_10571423 | Ga0114129_105714232 | 132 |
| 658 | 3300009176 | Ga0105242_10012282 | Ga0105242_100122826 | 132 |
| 659 | 3300009176 | Ga0105242_10650236 | Ga0105242_106502362 | 132 |
| 660 | 3300009177 | Ga0105248_10384963 | Ga0105248_103849633 | 132 |
| 661 | 3300013306 | Ga0163162_10638166 | Ga0163162_106381662 | 132 |
| 662 | 3300013308 | Ga0157375_10135568 | Ga0157375_101355682 | 132 |
| 663 | 3300014968 | Ga0157379_11800698 | Ga0157379_118006982 | 132 |
| 664 | 3300014969 | Ga0157376_10196208 | Ga0157376_101962083 | 132 |
| 665 | 3300025934 | Ga0207686_10003774 | Ga0207686_100037742 | 132 |
| 666 | 3300025937 | Ga0207669_10005616 | Ga0207669_100056168 | 132 |
| 667 | 3300025939 | Ga0207665_10374661 | Ga0207665_103746612 | 132 |
| 668 | 3300025941 | Ga0207711_10257533 | Ga0207711_102575332 | 132 |
| 669 | 3300025942 | Ga0207689_10273505 | Ga0207689_102735052 | 132 |
| 670 | 3300026035 | Ga0207703_10706967 | Ga0207703_107069672 | 132 |
| 671 | 3300026088 | Ga0207641_10112714 | Ga0207641_101127142 | 132 |
| 672 | 3300026089 | Ga0207648_10261089 | Ga0207648_102610892 | 132 |
| 673 | 3300026089 | Ga0207648_11522619 | Ga0207648_115226191 | 132 |
| 674 | 3300028379 | Ga0268266_11734800 | Ga0268266_117348001 | 132 |
| 675 | 3300046472 | Ga0495580_0825017 | Ga0495580_0825017_50_454 | 132 |
| 676 | 3300048912 | Ga0496109_1897727 | Ga0496109_1897727_13_429 | 132 |
| 677 | 3300050507 | nmdc:mga05p37_820814_c1 | nmdc:mga05p37_820814_c1_548_949 | 132 |
| 678 | 3300005341 | Ga0070691_10931129 | Ga0070691_109311291 | 133 |
| 679 | 3300005343 | Ga0070687_100302919 | Ga0070687_1003029191 | 133 |
| 680 | 3300005444 | Ga0070694_100020284 | Ga0070694_1000202842 | 133 |
| 681 | 3300005468 | Ga0070707_100559334 | Ga0070707_1005593342 | 133 |
| 682 | 3300005518 | Ga0070699_101301745 | Ga0070699_1013017451 | 133 |
| 683 | 3300005545 | Ga0070695_100249548 | Ga0070695_1002495482 | 133 |
| 684 | 3300005546 | Ga0070696_100097790 | Ga0070696_1000977902 | 133 |
| 685 | 3300005549 | Ga0070704_100011386 | Ga0070704_1000113865 | 133 |
| 686 | 3300006852 | Ga0075433_10412322 | Ga0075433_104123222 | 133 |
| 687 | 3300009094 | Ga0111539_10152490 | Ga0111539_101524903 | 133 |
| 688 | 3300009148 | Ga0105243_11224570 | Ga0105243_112245702 | 133 |
| 689 | 3300013296 | Ga0157374_11332749 | Ga0157374_113327491 | 133 |
| 690 | 3300013308 | Ga0157375_10296139 | Ga0157375_102961392 | 133 |
| 691 | 3300014968 | Ga0157379_11458544 | Ga0157379_114585442 | 133 |
| 692 | 3300025918 | Ga0207662_10212321 | Ga0207662_102123212 | 133 |
| 693 | 3300025922 | Ga0207646_10551472 | Ga0207646_105514721 | 133 |
| 694 | 3300027907 | Ga0207428_10130639 | Ga0207428_101306392 | 133 |
| 695 | 3300046499 | Ga0495594_0415948 | Ga0495594_0415948_134_538 | 133 |
| 696 | 3300050507 | nmdc:mga05p37_1731333_c1 | nmdc:mga05p37_1731333_c1_31_438 | 133 |
| 697 | 3300050511 | nmdc:mga08y16_55981_c1 | nmdc:mga08y16_55981_c1_2742_3146 | 133 |
| 698 | 3300050515 | nmdc:mga0a205_238270_c1 | nmdc:mga0a205_238270_c1_713_1126 | 133 |
| 699 | 3300005334 | Ga0068869_100050073 | Ga0068869_1000500732 | 134 |
| 700 | 3300005340 | Ga0070689_100006826 | Ga0070689_1000068264 | 134 |
| 701 | 3300005353 | Ga0070669_101141321 | Ga0070669_1011413211 | 134 |
| 702 | 3300005354 | Ga0070675_100070231 | Ga0070675_1000702314 | 134 |
| 703 | 3300005365 | Ga0070688_100120949 | Ga0070688_1001209491 | 134 |
| 704 | 3300005365 | Ga0070688_100374414 | Ga0070688_1003744142 | 134 |
| 705 | 3300005438 | Ga0070701_10145340 | Ga0070701_101453401 | 134 |
| 706 | 3300005456 | Ga0070678_100707635 | Ga0070678_1007076352 | 134 |
| 707 | 3300005536 | Ga0070697_100584732 | Ga0070697_1005847321 | 134 |
| 708 | 3300005615 | Ga0070702_100207918 | Ga0070702_1002079182 | 134 |
| 709 | 3300005617 | Ga0068859_100012194 | Ga0068859_1000121948 | 134 |
| 710 | 3300005840 | Ga0068870_11246658 | Ga0068870_112466581 | 134 |
| 711 | 3300005842 | Ga0068858_100020654 | Ga0068858_1000206542 | 134 |
| 712 | 3300005843 | Ga0068860_100013161 | Ga0068860_10001316110 | 134 |
| 713 | 3300006931 | Ga0097620_100012195 | Ga0097620_1000121953 | 134 |
| 714 | 3300009147 | Ga0114129_11863464 | Ga0114129_118634641 | 134 |
| 715 | 3300009176 | Ga0105242_11218254 | Ga0105242_112182542 | 134 |
| 716 | 3300009177 | Ga0105248_10817268 | Ga0105248_108172682 | 134 |
| 717 | 3300013297 | Ga0157378_10107371 | Ga0157378_101073712 | 134 |
| 718 | 3300014326 | Ga0157380_11776746 | Ga0157380_117767462 | 134 |
| 719 | 3300025903 | Ga0207680_10967130 | Ga0207680_109671301 | 134 |
| 720 | 3300025905 | Ga0207685_10116573 | Ga0207685_101165731 | 134 |
| 721 | 3300025916 | Ga0207663_10067128 | Ga0207663_100671282 | 134 |
| 722 | 3300025923 | Ga0207681_11717681 | Ga0207681_117176811 | 134 |
| 723 | 3300025926 | Ga0207659_10005200 | Ga0207659_100052008 | 134 |
| 724 | 3300025934 | Ga0207686_10772866 | Ga0207686_107728661 | 134 |
| 725 | 3300025936 | Ga0207670_10005643 | Ga0207670_100056433 | 134 |
| 726 | 3300025937 | Ga0207669_10051285 | Ga0207669_100512853 | 134 |
| 727 | 3300025940 | Ga0207691_10227032 | Ga0207691_102270321 | 134 |
| 728 | 3300025941 | Ga0207711_10406721 | Ga0207711_104067212 | 134 |
| 729 | 3300025942 | Ga0207689_10065065 | Ga0207689_100650653 | 134 |
| 730 | 3300025945 | Ga0207679_10444637 | Ga0207679_104446372 | 134 |
| 731 | 3300026078 | Ga0207702_11519357 | Ga0207702_115193571 | 134 |
| 732 | 3300026088 | Ga0207641_11344845 | Ga0207641_113448451 | 134 |
| 733 | 3300028381 | Ga0268264_10007159 | Ga0268264_100071592 | 134 |
| 734 | 3300046499 | Ga0495594_0448716 | Ga0495594_0448716_107_511 | 134 |
| 735 | 3300049743 | Ga0501081_0226752 | Ga0501081_0226752_772_1182 | 134 |
| 736 | 3300050511 | nmdc:mga08y16_1067757_c1 | nmdc:mga08y16_1067757_c1_343_753 | 134 |
| 737 | 3300005289 | Ga0065704_10078187 | Ga0065704_100781876 | 135 |
| 738 | 3300005295 | Ga0065707_10084528 | Ga0065707_100845289 | 135 |
| 739 | 3300005340 | Ga0070689_100999882 | Ga0070689_1009998821 | 135 |
| 740 | 3300005441 | Ga0070700_100231514 | Ga0070700_1002315142 | 135 |
| 741 | 3300005456 | Ga0070678_100125812 | Ga0070678_1001258121 | 135 |
| 742 | 3300005467 | Ga0070706_101264779 | Ga0070706_1012647792 | 135 |
| 743 | 3300005535 | Ga0070684_102020383 | Ga0070684_1020203831 | 135 |
| 744 | 3300005539 | Ga0068853_102182565 | Ga0068853_1021825651 | 135 |
| 745 | 3300005545 | Ga0070695_100652399 | Ga0070695_1006523992 | 135 |
| 746 | 3300005841 | Ga0068863_100235429 | Ga0068863_1002354292 | 135 |
| 747 | 3300006237 | Ga0097621_100209702 | Ga0097621_1002097022 | 135 |
| 748 | 3300006881 | Ga0068865_100014420 | Ga0068865_1000144205 | 135 |
| 749 | 3300012485 | Ga0157325_1028212 | Ga0157325_10282122 | 135 |
| 750 | 3300012500 | Ga0157314_1019886 | Ga0157314_10198861 | 135 |
| 751 | 3300013100 | Ga0157373_11018196 | Ga0157373_110181962 | 135 |
| 752 | 3300014969 | Ga0157376_10797893 | Ga0157376_107978932 | 135 |
| 753 | 3300025936 | Ga0207670_10896550 | Ga0207670_108965502 | 135 |
| 754 | 3300025960 | Ga0207651_11434911 | Ga0207651_114349111 | 135 |
| 755 | 3300026075 | Ga0207708_10064599 | Ga0207708_100645992 | 135 |
| 756 | 3300035242 | Ga0373962_0038267 | Ga0373962_0038267_592_999 | 135 |
| 757 | 3300035691 | Ga0373931_0012937 | Ga0373931_0012937_2474_2881 | 135 |
| 758 | 3300044673 | Ga0453683_0474445 | Ga0453683_0474445_298_705 | 135 |
| 759 | 3300045051 | Ga0451576_0103290 | Ga0451576_0103290_1134_1541 | 135 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4u0y-assembly1.cif.gz_A | crystal structure of the dna-binding domains of yvoa in complex with palindromic operator dna | 0.9602 | 9 | 80 |
| 2wv0-assembly3.cif.gz_E | crystal structure of the gntr-hutc family member yvoa from bacillus subtilis | 0.9589 | 9 | 80 |
| 2wv0-assembly5.cif.gz_I | crystal structure of the gntr-hutc family member yvoa from bacillus subtilis | 0.9579 | 9 | 80 |
| 4wwc-assembly1.cif.gz_A | crystal structure of full length yvoa in complex with palindromic operator dna | 0.9413 | 6 | 80 |
| 2wv0-assembly4.cif.gz_G-2 | crystal structure of the gntr-hutc family member yvoa from bacillus subtilis | 0.9375 | 7 | 80 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2wv0D01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9784 | 14 | 80 | 1.10.10.10 |
| 2wv0E01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9698 | 14 | 80 | 1.10.10.10 |
| 2wv0I01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.962 | 14 | 80 | 1.10.10.10 |
| 4hamA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9593 | 9 | 80 | 1.10.10.10 |
| 4u0vA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9524 | 6 | 80 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1PDA0-F1-model_v4 | HTH gntR-type domain-containing protein | 0.9889 | 6 | 82 |
GO:0003677
GO:0003700 |
| AF-A0A061AGQ9-F1-model_v4 | Transcription regulator HTH, GntR | 0.9746 | 4 | 80 |
GO:0003677
GO:0003700 |
| AF-A0A838IV63-F1-model_v4 | GntR family transcriptional regulator | 0.9731 | 6 | 81 |
GO:0003677
GO:0003700 GO:0045892 |
| AF-A0A4V6BI82-F1-model_v4 | GntR family transcriptional regulator | 0.972 | 4 | 84 |
GO:0003677
GO:0003700 GO:0005737 |
| AF-A0A353NHR9-F1-model_v4 | HTH gntR-type domain-containing protein | 0.9706 | 9 | 82 |
GO:0003677
GO:0003700 GO:0009058 GO:0030170 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar