F479470

General Info

Members Datasets Scaffolds Average Seq Length
759 275 759 133

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_101141321|Ga0070669_1011413211
Length 153
Sequence VLLCYVTSTLRAADAGTGAADVIVRPNPSSGVPIYLQLMEQVKHNIETGALRPGDQLPGIRPLAEELVINPNTVAKAYRELEHEGIIELRHGAGAFVSHAAGEKKLTERLRAGQTIVAATVDKLRSRGVTEAEIRRLFEAELTRQAVRGGSRG

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
103 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
173 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
178 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
179 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
180 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
181 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
182 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
183 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
184 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
185 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
186 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
187 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
188 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
189 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
191 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
192 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
193 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
194 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
195 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
196 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
197 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
198 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
199 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
200 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
201 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
202 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
203 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
207 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
211 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
212 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
215 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
216 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
219 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
220 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
221 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
222 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
223 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
224 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
227 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
228 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
229 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
230 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
231 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
254 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
255 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
256 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
257 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
258 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
259 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
273 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
274 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
275 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.98
Nodule 0
Rhizoplane 3.16
Rhizosphere 94.6
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10078187 3300005289 Bacteria 4505
2 Ga0065712_10823906 3300005290 Bacteria 502
3 Ga0065707_10084528 3300005295 Bacteria 7098
4 Ga0065707_10202879 3300005295 Bacteria 1295
5 Ga0065707_10351777 3300005295 Bacteria 913
6 Ga0070658_10395581 3300005327 Bacteria 1186
7 Ga0070676_10206447 3300005328 Bacteria 1290
8 Ga0070676_10625261 3300005328 Bacteria 779
9 Ga0070676_10812490 3300005328 Bacteria 691
10 Ga0070683_100317533 3300005329 Unclassified 1482
11 Ga0070690_100004924 3300005330 Bacteria 7470
12 Ga0070690_100090506 3300005330 Bacteria 2015
13 Ga0070670_101138390 3300005331 Bacteria 712
14 Ga0068869_100035909 3300005334 Bacteria 3516
15 Ga0068869_100050073 3300005334 Bacteria 3027
16 Ga0068869_100432584 3300005334 Bacteria 1088
17 Ga0068869_100490718 3300005334 Bacteria 1024
18 Ga0070666_10003143 3300005335 Bacteria 10025
19 Ga0070680_100262195 3300005336 Bacteria 1462
20 Ga0070680_100330327 3300005336 Bacteria 1295
21 Ga0070680_100974999 3300005336 Bacteria 732
22 Ga0070682_100012320 3300005337 Bacteria 4901
23 Ga0068868_100018237 3300005338 Bacteria 5243
24 Ga0070689_100006826 3300005340 Bacteria 7941
25 Ga0070689_100324644 3300005340 Bacteria 1286
26 Ga0070689_100376298 3300005340 Bacteria 1196
27 Ga0070689_100999882 3300005340 Bacteria 744
28 Ga0070689_101292821 3300005340 Bacteria 657
29 Ga0070689_101797092 3300005340 Bacteria 559
30 Ga0070691_10017688 3300005341 Bacteria 3281
31 Ga0070691_10931129 3300005341 Bacteria 538
32 Ga0070687_100064604 3300005343 Bacteria 1945
33 Ga0070687_100302919 3300005343 Unclassified 1015
34 Ga0070687_100917726 3300005343 Bacteria 629
35 Ga0070692_10157375 3300005345 Bacteria 1299
36 Ga0070669_100005125 3300005353 Bacteria 9477
37 Ga0070669_100105382 3300005353 Bacteria 2133
38 Ga0070669_101141321 3300005353 Bacteria 672
39 Ga0070675_100026987 3300005354 Bacteria 4612
40 Ga0070675_100070231 3300005354 Unclassified 2902
41 Ga0070675_101754137 3300005354 Bacteria 573
42 Ga0070671_101310663 3300005355 Bacteria 639
43 Ga0070674_100345651 3300005356 Bacteria 1200
44 Ga0070674_100801129 3300005356 Bacteria 813
45 Ga0070674_101917243 3300005356 Bacteria 539
46 Ga0070673_100169786 3300005364 Bacteria 1861
47 Ga0070673_101242566 3300005364 Bacteria 699
48 Ga0070673_101808543 3300005364 Bacteria 579
49 Ga0070688_100120949 3300005365 Bacteria 1754
50 Ga0070688_100123277 3300005365 Bacteria 1739
51 Ga0070688_100374414 3300005365 Bacteria 1048
52 Ga0070659_100725167 3300005366 Bacteria 861
53 Ga0070659_101296120 3300005366 Unclassified 646
54 Ga0070667_100980608 3300005367 Bacteria 788
55 Ga0070713_100088982 3300005436 Unclassified 2652
56 Ga0070710_11282513 3300005437 Bacteria 544
57 Ga0070701_10145340 3300005438 Unclassified 1360
58 Ga0070701_10257855 3300005438 Bacteria 1055
59 Ga0070711_100095835 3300005439 Bacteria 2148
60 Ga0070705_100234131 3300005440 Bacteria 1280
61 Ga0070705_100337544 3300005440 Bacteria 1094
62 Ga0070705_101052570 3300005440 Bacteria 663
63 Ga0070700_100004491 3300005441 Bacteria 7290
64 Ga0070700_100150393 3300005441 Bacteria 1592
65 Ga0070700_100180565 3300005441 Bacteria 1468
66 Ga0070700_100221466 3300005441 Bacteria 1341
67 Ga0070700_100231514 3300005441 Bacteria 1315
68 Ga0070694_100020284 3300005444 Bacteria 4235
69 Ga0070694_100635375 3300005444 Bacteria 863
70 Ga0070694_100919842 3300005444 Bacteria 723
71 Ga0070708_100022843 3300005445 Bacteria 5311
72 Ga0070663_100020449 3300005455 Bacteria 4384
73 Ga0070678_100125812 3300005456 Bacteria 2028
74 Ga0070678_100707635 3300005456 Unclassified 908
75 Ga0070662_100031938 3300005457 Bacteria 3699
76 Ga0070662_100360256 3300005457 Bacteria 1193
77 Ga0070662_100722412 3300005457 Bacteria 844
78 Ga0068867_100009585 3300005459 Bacteria 6827
79 Ga0068867_101490588 3300005459 Bacteria 630
80 Ga0070706_100304070 3300005467 Bacteria 1488
81 Ga0070706_100796461 3300005467 Bacteria 875
82 Ga0070706_101075290 3300005467 Bacteria 741
83 Ga0070706_101264779 3300005467 Bacteria 677
84 Ga0070706_101374146 3300005467 Bacteria 647
85 Ga0070707_100310473 3300005468 Bacteria 1533
86 Ga0070707_100559334 3300005468 Bacteria 1106
87 Ga0070698_100004142 3300005471 Bacteria 15948
88 Ga0070698_100026852 3300005471 Bacteria 5988
89 Ga0070698_100189432 3300005471 Bacteria 1995
90 Ga0070698_100194599 3300005471 Bacteria 1965
91 Ga0070698_100217638 3300005471 Bacteria 1844
92 Ga0070699_100004957 3300005518 Bacteria 11742
93 Ga0070699_100177604 3300005518 Bacteria 1889
94 Ga0070699_101301745 3300005518 Bacteria 667
95 Ga0070684_100332131 3300005535 Bacteria 1397
96 Ga0070684_100762004 3300005535 Bacteria 904
97 Ga0070684_100782620 3300005535 Bacteria 891
98 Ga0070684_102020383 3300005535 Bacteria 544
99 Ga0070697_100049890 3300005536 Bacteria 3396
100 Ga0070697_100302959 3300005536 Bacteria 1374
101 Ga0070697_100481341 3300005536 Bacteria 1084
102 Ga0070697_100584732 3300005536 Bacteria 981
103 Ga0068853_102182565 3300005539 Unclassified 537
104 Ga0070672_100182634 3300005543 Bacteria 1749
105 Ga0070672_100971626 3300005543 Bacteria 752
106 Ga0070686_100476676 3300005544 Bacteria 964
107 Ga0070686_100555145 3300005544 Bacteria 899
108 Ga0070686_100742458 3300005544 Bacteria 786
109 Ga0070695_100045013 3300005545 Bacteria 2811
110 Ga0070695_100145958 3300005545 Bacteria 1646
111 Ga0070695_100249548 3300005545 Bacteria 1291
112 Ga0070695_100363170 3300005545 Bacteria 1088
113 Ga0070695_100652399 3300005545 Bacteria 831
114 Ga0070696_100009861 3300005546 Bacteria 6388
115 Ga0070696_100097790 3300005546 Bacteria 2099
116 Ga0070696_100137056 3300005546 Bacteria 1785
117 Ga0070696_100208053 3300005546 Unclassified 1463
118 Ga0070696_100944289 3300005546 Bacteria 718
119 Ga0070665_100002769 3300005548 Bacteria 19002
120 Ga0070665_100009577 3300005548 Bacteria 9796
121 Ga0070665_100481010 3300005548 Bacteria 1252
122 Ga0070665_100741745 3300005548 Bacteria 995
123 Ga0070704_100011386 3300005549 Bacteria 5450
124 Ga0070704_100348025 3300005549 Bacteria 1250
125 Ga0070704_101055739 3300005549 Bacteria 737
126 Ga0070664_100061954 3300005564 Bacteria 3188
127 Ga0070664_100225750 3300005564 Bacteria 1677
128 Ga0068857_100310511 3300005577 Bacteria 1455
129 Ga0068857_100904170 3300005577 Bacteria 847
130 Ga0068857_102512445 3300005577 Bacteria 506
131 Ga0068854_100348883 3300005578 Bacteria 1211
132 Ga0068854_100724572 3300005578 Bacteria 860
133 Ga0070702_100094102 3300005615 Bacteria 1824
134 Ga0070702_100207918 3300005615 Bacteria 1300
135 Ga0070702_101078281 3300005615 Bacteria 640
136 Ga0068852_101406783 3300005616 Bacteria 720
137 Ga0068859_100012194 3300005617 Bacteria 8640
138 Ga0068859_100311125 3300005617 Bacteria 1669
139 Ga0068859_100402503 3300005617 Bacteria 1465
140 Ga0068859_100797851 3300005617 Bacteria 1032
141 Ga0068859_101502178 3300005617 Bacteria 743
142 Ga0068859_101838467 3300005617 Bacteria 669
143 Ga0068864_100594986 3300005618 Bacteria 1073
144 Ga0068864_100969643 3300005618 Unclassified 842
145 Ga0068864_102364573 3300005618 Bacteria 538
146 Ga0068866_10035697 3300005718 Bacteria 2430
147 Ga0068866_10147042 3300005718 Bacteria 1360
148 Ga0068866_10222854 3300005718 Bacteria 1139
149 Ga0068866_10909040 3300005718 Bacteria 620
150 Ga0068861_100000681 3300005719 Bacteria 20273
151 Ga0068861_100014268 3300005719 Bacteria 5575
152 Ga0068861_100053505 3300005719 Bacteria 3071
153 Ga0068861_100155055 3300005719 Bacteria 1883
154 Ga0068861_101031741 3300005719 Bacteria 787
155 Ga0068851_10176965 3300005834 Bacteria 1180
156 Ga0068870_10569804 3300005840 Bacteria 765
157 Ga0068870_10609774 3300005840 Bacteria 743
158 Ga0068870_10679606 3300005840 Bacteria 708
159 Ga0068870_10931305 3300005840 Bacteria 616
160 Ga0068870_11246658 3300005840 Bacteria 540
161 Ga0068863_100235429 3300005841 Bacteria 1767
162 Ga0068863_100298667 3300005841 Bacteria 1562
163 Ga0068863_100315142 3300005841 Bacteria 1519
164 Ga0068863_100400714 3300005841 Unclassified 1342
165 Ga0068858_100008049 3300005842 Bacteria 10152
166 Ga0068858_100016232 3300005842 Bacteria 6995
167 Ga0068858_100020654 3300005842 Bacteria 6154
168 Ga0068858_100034008 3300005842 Bacteria 4728
169 Ga0068858_100212090 3300005842 Bacteria 1833
170 Ga0068858_101474389 3300005842 Bacteria 671
171 Ga0068858_102505917 3300005842 Bacteria 509
172 Ga0068860_100013161 3300005843 Bacteria 8118
173 Ga0068860_100131851 3300005843 Bacteria 2398
174 Ga0068860_100157942 3300005843 Bacteria 2186
175 Ga0068860_100247650 3300005843 Bacteria 1734
176 Ga0068860_100474784 3300005843 Bacteria 1246
177 Ga0068860_100865757 3300005843 Bacteria 919
178 Ga0068860_100945359 3300005843 Bacteria 879
179 Ga0068860_101871641 3300005843 Unclassified 622
180 Ga0068860_102259180 3300005843 Unclassified 565
181 Ga0068862_100022816 3300005844 Bacteria 5238
182 Ga0068862_100077682 3300005844 Bacteria 2875
183 Ga0068862_100078119 3300005844 Bacteria 2867
184 Ga0068862_100161766 3300005844 Bacteria 1999
185 Ga0068862_100313239 3300005844 Bacteria 1447
186 Ga0068862_100801312 3300005844 Bacteria 920
187 Ga0068862_100823686 3300005844 Bacteria 908
188 Ga0068862_102602913 3300005844 Bacteria 518
189 Ga0081455_10122650 3300005937 Bacteria 2045
190 Ga0081455_10138036 3300005937 Bacteria 1897
191 Ga0081455_10453137 3300005937 Unclassified 876
192 Ga0081539_10000108 3300005985 Bacteria 195322
193 Ga0081539_10002107 3300005985 Bacteria 29488
194 Ga0081539_10025531 3300005985 Bacteria 3802
195 Ga0081539_10100914 3300005985 Bacteria 1471
196 Ga0075365_10035023 3300006038 Bacteria 3246
197 Ga0075368_10221855 3300006042 Unclassified 803
198 Ga0075364_10638724 3300006051 Bacteria 727
199 Ga0075432_10047611 3300006058 Bacteria 1507
200 Ga0075432_10451903 3300006058 Bacteria 564
201 Ga0070715_10011449 3300006163 Bacteria 3195
202 Ga0070715_10268687 3300006163 Bacteria 899
203 Ga0070715_10791538 3300006163 Bacteria 575
204 Ga0075367_10551863 3300006178 Bacteria 732
205 Ga0075366_10094868 3300006195 Bacteria 1788
206 Ga0075366_10121652 3300006195 Bacteria 1573
207 Ga0097621_100002206 3300006237 Bacteria 13330
208 Ga0097621_100002228 3300006237 Bacteria 13279
209 Ga0097621_100043370 3300006237 Bacteria 3626
210 Ga0097621_100089092 3300006237 Bacteria 2579
211 Ga0097621_100111959 3300006237 Bacteria 2307
212 Ga0097621_100209702 3300006237 Bacteria 1695
213 Ga0097621_100244763 3300006237 Bacteria 1569
214 Ga0075370_10337171 3300006353 Bacteria 899
215 Ga0068871_100000586 3300006358 Bacteria 25004
216 Ga0068871_100004656 3300006358 Bacteria 9584
217 Ga0068871_100035460 3300006358 Bacteria 3964
218 Ga0068871_100066178 3300006358 Bacteria 2961
219 Ga0068871_100204697 3300006358 Unclassified 1705
220 Ga0068871_100401987 3300006358 Bacteria 1220
221 Ga0068871_101025743 3300006358 Bacteria 769
222 Ga0075428_100105753 3300006844 Bacteria 3068
223 Ga0075428_100486594 3300006844 Bacteria 1321
224 Ga0075430_100123011 3300006846 Bacteria 2163
225 Ga0075430_101017159 3300006846 Bacteria 683
226 Ga0075431_100005294 3300006847 Bacteria 12719
227 Ga0075431_100023894 3300006847 Bacteria 6257
228 Ga0075431_100058861 3300006847 Bacteria 3965
229 Ga0075431_100128064 3300006847 Bacteria 2620
230 Ga0075431_101589350 3300006847 Bacteria 612
231 Ga0075433_10030799 3300006852 Bacteria 4581
232 Ga0075433_10109154 3300006852 Bacteria 2455
233 Ga0075433_10337177 3300006852 Bacteria 1333
234 Ga0075433_10412322 3300006852 Bacteria 1191
235 Ga0075433_10472315 3300006852 Bacteria 1105
236 Ga0075433_10810531 3300006852 Bacteria 818
237 Ga0075433_10909381 3300006852 Bacteria 768
238 Ga0075433_11442663 3300006852 Bacteria 595
239 Ga0075434_100000538 3300006871 Bacteria 28855
240 Ga0075434_100005479 3300006871 Bacteria 11558
241 Ga0075434_100087037 3300006871 Bacteria 3125
242 Ga0075434_100188581 3300006871 Bacteria 2082
243 Ga0075434_100348387 3300006871 Bacteria 1502
244 Ga0075434_100487152 3300006871 Bacteria 1254
245 Ga0075434_101439069 3300006871 Bacteria 699
246 Ga0075434_102235310 3300006871 Bacteria 550
247 Ga0075429_100028798 3300006880 Bacteria 4824
248 Ga0068865_100014420 3300006881 Bacteria 5021
249 Ga0068865_100016109 3300006881 Bacteria 4775
250 Ga0068865_100029317 3300006881 Bacteria 3650
251 Ga0068865_100057007 3300006881 Bacteria 2724
252 Ga0068865_101218460 3300006881 Bacteria 667
253 Ga0068865_101354958 3300006881 Bacteria 634
254 Ga0075436_100000641 3300006914 Bacteria 22972
255 Ga0075436_100005174 3300006914 Bacteria 8981
256 Ga0075436_100010981 3300006914 Bacteria 6217
257 Ga0075436_100214603 3300006914 Bacteria 1365
258 Ga0075436_100266632 3300006914 Bacteria 1222
259 Ga0097620_100012195 3300006931 Bacteria 8640
260 Ga0097620_100311115 3300006931 Bacteria 1669
261 Ga0097620_100402499 3300006931 Bacteria 1465
262 Ga0097620_100585708 3300006931 Bacteria 1209
263 Ga0097620_100797920 3300006931 Bacteria 1032
264 Ga0097620_101502223 3300006931 Bacteria 743
265 Ga0097620_101838830 3300006931 Bacteria 669
266 Ga0075435_100000009 3300007076 Bacteria 114381
267 Ga0075435_100000567 3300007076 Bacteria 22751
268 Ga0075435_100001575 3300007076 Bacteria 14706
269 Ga0075435_100005738 3300007076 Bacteria 8708
270 Ga0075435_100012126 3300007076 Bacteria 6373
271 Ga0075435_100081777 3300007076 Bacteria 2654
272 Ga0075435_100395254 3300007076 Bacteria 1188
273 Ga0075435_100401948 3300007076 Bacteria 1178
274 Ga0105240_10455643 3300009093 Bacteria 1430
275 Ga0105240_11374147 3300009093 Bacteria 743
276 Ga0105240_12068601 3300009093 Bacteria 591
277 Ga0111539_10000151 3300009094 Bacteria 79134
278 Ga0111539_10029847 3300009094 Bacteria 6634
279 Ga0111539_10152490 3300009094 Bacteria 2705
280 Ga0111539_10643147 3300009094 Bacteria 1235
281 Ga0111539_10874617 3300009094 Bacteria 1045
282 Ga0105245_10012218 3300009098 Bacteria 7470
283 Ga0105245_10028212 3300009098 Bacteria 4948
284 Ga0105245_10064778 3300009098 Bacteria 3303
285 Ga0105245_10081028 3300009098 Bacteria 2966
286 Ga0105245_12559262 3300009098 Bacteria 564
287 Ga0105247_10027790 3300009101 Bacteria 3421
288 Ga0105247_10125128 3300009101 Unclassified 1670
289 Ga0114129_10009169 3300009147 Bacteria 14108
290 Ga0114129_10022392 3300009147 Bacteria 8972
291 Ga0114129_10048648 3300009147 Bacteria 5958
292 Ga0114129_10122203 3300009147 Bacteria 3583
293 Ga0114129_10284631 3300009147 Bacteria 2208
294 Ga0114129_10302378 3300009147 Bacteria 2131
295 Ga0114129_10456820 3300009147 Unclassified 1674
296 Ga0114129_10571423 3300009147 Bacteria 1468
297 Ga0114129_10720633 3300009147 Bacteria 1280
298 Ga0114129_11585894 3300009147 Bacteria 802
299 Ga0114129_11787973 3300009147 Bacteria 748
300 Ga0114129_11863464 3300009147 Bacteria 730
301 Ga0114129_12651297 3300009147 Bacteria 598
302 Ga0105243_10022611 3300009148 Bacteria 4781
303 Ga0105243_11048494 3300009148 Bacteria 821
304 Ga0105243_11139607 3300009148 Bacteria 790
305 Ga0105243_11224570 3300009148 Bacteria 765
306 Ga0105243_12512079 3300009148 Bacteria 554
307 Ga0105241_10128908 3300009174 Bacteria 2046
308 Ga0105241_11699043 3300009174 Bacteria 613
309 Ga0105242_10003159 3300009176 Bacteria 12863
310 Ga0105242_10003881 3300009176 Bacteria 11615
311 Ga0105242_10012282 3300009176 Bacteria 6592
312 Ga0105242_10141531 3300009176 Bacteria 2088
313 Ga0105242_10650236 3300009176 Unclassified 1025
314 Ga0105242_11218254 3300009176 Bacteria 773
315 Ga0105248_10077759 3300009177 Bacteria 3730
316 Ga0105248_10313262 3300009177 Bacteria 1767
317 Ga0105248_10361757 3300009177 Bacteria 1634
318 Ga0105248_10384963 3300009177 Bacteria 1579
319 Ga0105248_10538965 3300009177 Bacteria 1316
320 Ga0105248_10804486 3300009177 Bacteria 1061
321 Ga0105248_10817268 3300009177 Unclassified 1052
322 Ga0105248_11346577 3300009177 Bacteria 808
323 Ga0105248_11377764 3300009177 Bacteria 798
324 Ga0105248_12454952 3300009177 Bacteria 594
325 Ga0105248_12456203 3300009177 Bacteria 594
326 Ga0105248_12906642 3300009177 Bacteria 546
327 Ga0105237_10179827 3300009545 Bacteria 2115
328 Ga0105238_12842607 3300009551 Bacteria 520
329 Ga0105249_10109645 3300009553 Bacteria 2607
330 Ga0105249_10374136 3300009553 Bacteria 1449
331 Ga0105249_11373218 3300009553 Bacteria 778
332 Ga0105249_12359685 3300009553 Unclassified 605
333 Ga0105249_12494558 3300009553 Bacteria 589
334 Ga0105239_11551149 3300010375 Bacteria 766
335 Ga0105246_10115262 3300011119 Bacteria 1981
336 Ga0105246_10398268 3300011119 Bacteria 1142
337 Ga0105246_12539436 3300011119 Bacteria 505
338 Ga0157325_1028212 3300012485 Unclassified 547
339 Ga0157314_1019886 3300012500 Bacteria 675
340 Ga0157373_11018196 3300013100 Bacteria 619
341 Ga0157374_10003033 3300013296 Bacteria 14073
342 Ga0157374_10192778 3300013296 Bacteria 1993
343 Ga0157374_10478572 3300013296 Bacteria 1248
344 Ga0157374_10559245 3300013296 Bacteria 1152
345 Ga0157374_11014246 3300013296 Bacteria 849
346 Ga0157374_11332749 3300013296 Unclassified 740
347 Ga0157378_10000335 3300013297 Bacteria 46123
348 Ga0157378_10000904 3300013297 Bacteria 27354
349 Ga0157378_10009297 3300013297 Bacteria 8560
350 Ga0157378_10107371 3300013297 Bacteria 2554
351 Ga0157378_10419507 3300013297 Bacteria 1322
352 Ga0157378_11695148 3300013297 Bacteria 679
353 Ga0157378_12273019 3300013297 Bacteria 594
354 Ga0163162_10051414 3300013306 Bacteria 4135
355 Ga0163162_10638166 3300013306 Bacteria 1189
356 Ga0157375_10000009 3300013308 Bacteria 366440
357 Ga0157375_10135568 3300013308 Bacteria 2585
358 Ga0157375_10296139 3300013308 Bacteria 1781
359 Ga0157375_10688735 3300013308 Bacteria 1176
360 Ga0163163_10040445 3300014325 Bacteria 4552
361 Ga0163163_10146700 3300014325 Bacteria 2404
362 Ga0163163_10999765 3300014325 Bacteria 900
363 Ga0163163_11624606 3300014325 Bacteria 707
364 Ga0157380_10071637 3300014326 Bacteria 2804
365 Ga0157380_10216754 3300014326 Bacteria 1710
366 Ga0157380_10713424 3300014326 Bacteria 1009
367 Ga0157380_10717814 3300014326 Bacteria 1007
368 Ga0157380_10850559 3300014326 Bacteria 934
369 Ga0157380_11776746 3300014326 Bacteria 675
370 Ga0157377_10011786 3300014745 Bacteria 4373
371 Ga0157379_10017793 3300014968 Bacteria 6260
372 Ga0157379_10027746 3300014968 Bacteria 5040
373 Ga0157379_10071716 3300014968 Bacteria 3098
374 Ga0157379_10274943 3300014968 Bacteria 1532
375 Ga0157379_10418490 3300014968 Bacteria 1234
376 Ga0157379_11458544 3300014968 Unclassified 665
377 Ga0157379_11800698 3300014968 Bacteria 602
378 Ga0157376_10033312 3300014969 Bacteria 4147
379 Ga0157376_10196208 3300014969 Bacteria 1854
380 Ga0157376_10457036 3300014969 Bacteria 1247
381 Ga0157376_10484621 3300014969 Bacteria 1212
382 Ga0157376_10797893 3300014969 Bacteria 956
383 Ga0163161_11602166 3300017792 Bacteria 574
384 Ga0207697_10017848 3300025315 Bacteria 2913
385 Ga0207682_10378677 3300025893 Bacteria 668
386 Ga0207682_10394205 3300025893 Bacteria 654
387 Ga0207642_10236748 3300025899 Bacteria 1029
388 Ga0207642_10341979 3300025899 Bacteria 880
389 Ga0207710_10008364 3300025900 Bacteria 4363
390 Ga0207710_10068574 3300025900 Unclassified 1622
391 Ga0207680_10031313 3300025903 Bacteria 3012
392 Ga0207680_10062012 3300025903 Bacteria 2282
393 Ga0207680_10967130 3300025903 Bacteria 610
394 Ga0207685_10116573 3300025905 Bacteria 1166
395 Ga0207685_10252148 3300025905 Bacteria 854
396 Ga0207645_10003035 3300025907 Bacteria 12919
397 Ga0207645_10163695 3300025907 Bacteria 1456
398 Ga0207645_10364248 3300025907 Bacteria 969
399 Ga0207645_10588729 3300025907 Bacteria 755
400 Ga0207643_10162025 3300025908 Bacteria 1346
401 Ga0207643_10425752 3300025908 Bacteria 842
402 Ga0207705_10393801 3300025909 Bacteria 1071
403 Ga0207684_10249510 3300025910 Bacteria 1531
404 Ga0207684_10254606 3300025910 Bacteria 1515
405 Ga0207684_10577242 3300025910 Bacteria 961
406 Ga0207684_10704481 3300025910 Unclassified 858
407 Ga0207654_10627184 3300025911 Bacteria 769
408 Ga0207654_11385935 3300025911 Unclassified 513
409 Ga0207695_10345304 3300025913 Bacteria 1376
410 Ga0207695_11150803 3300025913 Bacteria 656
411 Ga0207671_10121874 3300025914 Bacteria 1994
412 Ga0207663_10067128 3300025916 Bacteria 2299
413 Ga0207660_11055818 3300025917 Bacteria 662
414 Ga0207660_11081332 3300025917 Bacteria 654
415 Ga0207660_11130175 3300025917 Bacteria 638
416 Ga0207662_10048272 3300025918 Bacteria 2521
417 Ga0207662_10081080 3300025918 Bacteria 1980
418 Ga0207662_10212321 3300025918 Unclassified 1257
419 Ga0207662_10319863 3300025918 Bacteria 1036
420 Ga0207649_11484270 3300025920 Bacteria 537
421 Ga0207646_10211568 3300025922 Bacteria 1751
422 Ga0207646_10551472 3300025922 Bacteria 1036
423 Ga0207681_10025533 3300025923 Bacteria 3801
424 Ga0207681_11717681 3300025923 Bacteria 524
425 Ga0207650_11246728 3300025925 Bacteria 633
426 Ga0207650_11315215 3300025925 Bacteria 615
427 Ga0207659_10005200 3300025926 Bacteria 7880
428 Ga0207659_10022298 3300025926 Bacteria 4215
429 Ga0207659_11053739 3300025926 Bacteria 700
430 Ga0207659_11466892 3300025926 Bacteria 584
431 Ga0207687_10000530 3300025927 Bacteria 25582
432 Ga0207687_10188860 3300025927 Bacteria 1602
433 Ga0207687_10643128 3300025927 Bacteria 897
434 Ga0207687_10896303 3300025927 Bacteria 759
435 Ga0207700_11069741 3300025928 Unclassified 721
436 Ga0207644_11381650 3300025931 Bacteria 592
437 Ga0207690_11027298 3300025932 Bacteria 686
438 Ga0207690_11289617 3300025932 Bacteria 610
439 Ga0207706_10018270 3300025933 Bacteria 6309
440 Ga0207706_10100721 3300025933 Bacteria 2541
441 Ga0207706_10988511 3300025933 Bacteria 707
442 Ga0207686_10003774 3300025934 Bacteria 8128
443 Ga0207686_10049156 3300025934 Bacteria 2616
444 Ga0207686_10049898 3300025934 Bacteria 2600
445 Ga0207686_10772866 3300025934 Unclassified 768
446 Ga0207686_10772932 3300025934 Bacteria 768
447 Ga0207709_10040099 3300025935 Bacteria 2802
448 Ga0207709_10109876 3300025935 Bacteria 1841
449 Ga0207709_10301669 3300025935 Bacteria 1191
450 Ga0207709_10486492 3300025935 Bacteria 960
451 Ga0207709_11505467 3300025935 Unclassified 558
452 Ga0207670_10005643 3300025936 Bacteria 6884
453 Ga0207670_10317363 3300025936 Bacteria 1225
454 Ga0207670_10630202 3300025936 Bacteria 882
455 Ga0207670_10837083 3300025936 Bacteria 768
456 Ga0207670_10896550 3300025936 Bacteria 743
457 Ga0207669_10005616 3300025937 Bacteria 5648
458 Ga0207669_10051285 3300025937 Bacteria 2471
459 Ga0207669_10121822 3300025937 Bacteria 1772
460 Ga0207704_10007163 3300025938 Bacteria 5249
461 Ga0207704_10508492 3300025938 Bacteria 972
462 Ga0207704_11072238 3300025938 Bacteria 684
463 Ga0207665_10374661 3300025939 Bacteria 1079
464 Ga0207691_10227032 3300025940 Bacteria 1618
465 Ga0207691_10386140 3300025940 Bacteria 1195
466 Ga0207691_10574388 3300025940 Bacteria 955
467 Ga0207691_10625892 3300025940 Bacteria 910
468 Ga0207711_10010783 3300025941 Bacteria 7596
469 Ga0207711_10166711 3300025941 Bacteria 1997
470 Ga0207711_10199765 3300025941 Bacteria 1824
471 Ga0207711_10223361 3300025941 Bacteria 1723
472 Ga0207711_10257533 3300025941 Unclassified 1603
473 Ga0207711_10406721 3300025941 Unclassified 1265
474 Ga0207711_10853915 3300025941 Bacteria 847
475 Ga0207689_10065065 3300025942 Bacteria 2999
476 Ga0207689_10273505 3300025942 Bacteria 1398
477 Ga0207689_10372620 3300025942 Bacteria 1188
478 Ga0207689_11444044 3300025942 Bacteria 576
479 Ga0207679_10098032 3300025945 Bacteria 2285
480 Ga0207679_10382761 3300025945 Bacteria 1234
481 Ga0207679_10444637 3300025945 Unclassified 1148
482 Ga0207679_10562586 3300025945 Bacteria 1024
483 Ga0207679_10973605 3300025945 Bacteria 777
484 Ga0207679_11970956 3300025945 Unclassified 532
485 Ga0207679_12187379 3300025945 Unclassified 502
486 Ga0207667_10575891 3300025949 Bacteria 1137
487 Ga0207651_10153118 3300025960 Bacteria 1798
488 Ga0207651_10704728 3300025960 Bacteria 890
489 Ga0207651_10725224 3300025960 Bacteria 877
490 Ga0207651_11434911 3300025960 Unclassified 621
491 Ga0207651_11883328 3300025960 Bacteria 538
492 Ga0207712_10217069 3300025961 Bacteria 1527
493 Ga0207712_11167266 3300025961 Unclassified 686
494 Ga0207712_11455455 3300025961 Bacteria 613
495 Ga0207712_12024963 3300025961 Bacteria 515
496 Ga0207640_10044262 3300025981 Bacteria 2851
497 Ga0207640_10505539 3300025981 Bacteria 1007
498 Ga0207640_10736330 3300025981 Unclassified 849
499 Ga0207658_10573092 3300025986 Bacteria 1012
500 Ga0207658_11854364 3300025986 Bacteria 550
501 Ga0207677_10425132 3300026023 Bacteria 1132
502 Ga0207677_12012112 3300026023 Bacteria 537
503 Ga0207703_10019292 3300026035 Bacteria 5326
504 Ga0207703_10029802 3300026035 Bacteria 4308
505 Ga0207703_10063621 3300026035 Bacteria 3025
506 Ga0207703_10706967 3300026035 Bacteria 959
507 Ga0207639_11326447 3300026041 Bacteria 675
508 Ga0207678_10112203 3300026067 Bacteria 2326
509 Ga0207708_10000915 3300026075 Bacteria 22111
510 Ga0207708_10064599 3300026075 Bacteria 2796
511 Ga0207708_10145781 3300026075 Bacteria 1860
512 Ga0207708_10311221 3300026075 Bacteria 1283
513 Ga0207708_10489544 3300026075 Bacteria 1029
514 Ga0207702_11519357 3300026078 Bacteria 663
515 Ga0207641_10112714 3300026088 Bacteria 2414
516 Ga0207641_10200789 3300026088 Bacteria 1838
517 Ga0207641_10380226 3300026088 Bacteria 1352
518 Ga0207641_11344845 3300026088 Unclassified 715
519 Ga0207648_10003983 3300026089 Bacteria 15334
520 Ga0207648_10261089 3300026089 Bacteria 1545
521 Ga0207648_10285998 3300026089 Bacteria 1475
522 Ga0207648_10722726 3300026089 Bacteria 924
523 Ga0207648_11522619 3300026089 Bacteria 629
524 Ga0207648_11559852 3300026089 Unclassified 621
525 Ga0207674_10048880 3300026116 Bacteria 4327
526 Ga0207674_11159976 3300026116 Bacteria 742
527 Ga0207675_100006469 3300026118 Bacteria 11089
528 Ga0207675_100016792 3300026118 Bacteria 6837
529 Ga0207675_100042052 3300026118 Bacteria 4265
530 Ga0207675_100136023 3300026118 Bacteria 2332
531 Ga0207675_100657184 3300026118 Bacteria 1055
532 Ga0207675_102081948 3300026118 Unclassified 584
533 Ga0207683_11399240 3300026121 Bacteria 647
534 Ga0207698_10834905 3300026142 Bacteria 926
535 Ga0207428_10000643 3300027907 Bacteria 41046
536 Ga0207428_10041193 3300027907 Bacteria 3741
537 Ga0207428_10130639 3300027907 Bacteria 1922
538 Ga0268266_10042136 3300028379 Bacteria 3898
539 Ga0268266_10053356 3300028379 Bacteria 3472
540 Ga0268266_11734800 3300028379 Bacteria 599
541 Ga0268266_12339295 3300028379 Bacteria 505
542 Ga0268265_10060930 3300028380 Bacteria 2894
543 Ga0268265_10088493 3300028380 Bacteria 2467
544 Ga0268265_10174329 3300028380 Bacteria 1841
545 Ga0268265_10253867 3300028380 Bacteria 1559
546 Ga0268265_10277451 3300028380 Bacteria 1498
547 Ga0268265_10658754 3300028380 Bacteria 1007
548 Ga0268265_10779767 3300028380 Bacteria 930
549 Ga0268265_10785673 3300028380 Bacteria 927
550 Ga0268265_11302278 3300028380 Bacteria 727
551 Ga0268265_11982088 3300028380 Bacteria 589
552 Ga0268265_12532161 3300028380 Bacteria 519
553 Ga0268264_10007159 3300028381 Bacteria 9347
554 Ga0268264_10082725 3300028381 Bacteria 2748
555 Ga0268264_10179094 3300028381 Bacteria 1924
556 Ga0268264_10226300 3300028381 Bacteria 1724
557 Ga0268264_10354267 3300028381 Bacteria 1398
558 Ga0268264_10408577 3300028381 Bacteria 1306
559 Ga0268264_10802557 3300028381 Bacteria 940
560 Ga0268264_10853112 3300028381 Bacteria 912
561 Ga0268264_12321047 3300028381 Unclassified 543
562 Ga0268264_12673372 3300028381 Bacteria 503
563 Ga0307511_10005949 3300030521 Bacteria 12326
564 Ga0307509_10417558 3300031507 Bacteria 1043
565 Ga0307412_10219076 3300031911 Bacteria 1458
566 Ga0307416_102812200 3300032002 Bacteria 582
567 Ga0307416_102930123 3300032002 Unclassified 571
568 Ga0307414_11663409 3300032004 Bacteria 595
569 Ga0373930_0001309 3300034816 Bacteria 3671
570 Ga0373948_0001672 3300034817 Bacteria 3134
571 Ga0373950_0011332 3300034818 Bacteria 1455
572 Ga0373958_0030053 3300034819 Bacteria 1060
573 Ga0373938_0048910 3300034957 Bacteria 960
574 Ga0373928_0004086 3300035084 Bacteria 2781
575 Ga0373928_0021459 3300035084 Bacteria 1362
576 Ga0373929_0001021 3300035085 Bacteria 5432
577 Ga0373934_0115399 3300035086 Bacteria 1091
578 Ga0373940_0023884 3300035088 Bacteria 1581
579 Ga0373949_0001236 3300035090 Bacteria 7543
580 Ga0373949_0002813 3300035090 Bacteria 4325
581 Ga0373951_0000826 3300035091 Bacteria 8417
582 Ga0373951_0161414 3300035091 Bacteria 634
583 Ga0373952_0002002 3300035092 Bacteria 3682
584 Ga0373923_0150446 3300035111 Bacteria 1057
585 Ga0373932_0002098 3300035112 Bacteria 5183
586 Ga0373939_0000603 3300035114 Bacteria 8926
587 Ga0373939_0241832 3300035114 Bacteria 699
588 Ga0373939_0291909 3300035114 Bacteria 647
589 Ga0373941_0000169 3300035115 Bacteria 12062
590 Ga0373941_0061438 3300035115 Bacteria 1224
591 Ga0373945_0058433 3300035116 Bacteria 1434
592 Ga0373954_0598383 3300035118 Bacteria 547
593 Ga0373956_0040081 3300035119 Bacteria 2077
594 Ga0373956_0050242 3300035119 Bacteria 1872
595 Ga0373956_0461250 3300035119 Bacteria 606
596 Ga0373960_0001719 3300035121 Bacteria 4901
597 Ga0373943_0100732 3300035170 Bacteria 1510
598 Ga0373943_0776085 3300035170 Bacteria 570
599 Ga0373946_0177356 3300035171 Bacteria 1010
600 Ga0373955_0134470 3300035172 Bacteria 1445
601 Ga0373942_0002266 3300035207 Bacteria 4712
602 Ga0373961_0000682 3300035241 Bacteria 12000
603 Ga0373962_0000733 3300035242 Bacteria 7420
604 Ga0373962_0038267 3300035242 Bacteria 1342
605 Ga0373924_0036283 3300035410 Bacteria 2003
606 Ga0373931_0012937 3300035691 Bacteria 4053
607 Ga0373931_0039343 3300035691 Bacteria 2477
608 Ga0373931_0184085 3300035691 Bacteria 1239
609 Ga0373935_0288794 3300035692 Bacteria 1156
610 Ga0373935_0434848 3300035692 Unclassified 946
611 Ga0373933_0133413 3300035724 Bacteria 1563
612 Ga0373933_0357985 3300035724 Bacteria 949
613 Ga0373947_0032067 3300035725 Bacteria 3095
614 Ga0373947_0150201 3300035725 Bacteria 1500
615 Ga0373937_0137948 3300036401 Bacteria 2281
616 Ga0373937_0239975 3300036401 Bacteria 1708
617 Ga0373937_1053062 3300036401 Bacteria 762
618 Ga0373937_1990307 3300036401 Unclassified 527
619 Ga0373925_0014745 3300037068 Bacteria 5647
620 Ga0373925_0037974 3300037068 Bacteria 3558
621 Ga0373925_1284105 3300037068 Unclassified 601
622 Ga0439435_0222972 3300042436 Unclassified 628
623 Ga0439460_0245275 3300042461 Bacteria 618
624 Ga0453683_0474445 3300044673 Unclassified 811
625 Ga0451576_0103290 3300045051 Bacteria 2965
626 Ga0451576_0222034 3300045051 Bacteria 1973
627 Ga0495603_0207111 3300046455 Bacteria 1133
628 Ga0495641_0192905 3300046461 Bacteria 913
629 Ga0495641_0383088 3300046461 Bacteria 637
630 Ga0495653_0279680 3300046463 Bacteria 1096
631 Ga0495580_0186101 3300046472 Unclassified 1433
632 Ga0495580_0825017 3300046472 Unclassified 600
633 Ga0495639_0023059 3300046475 Bacteria 2734
634 Ga0495639_0249753 3300046475 Bacteria 877
635 Ga0495594_0171845 3300046499 Unclassified 1233
636 Ga0495594_0415948 3300046499 Bacteria 765
637 Ga0495594_0448716 3300046499 Bacteria 733
638 Ga0495643_0038122 3300046522 Bacteria 2633
639 Ga0495642_0109788 3300046528 Bacteria 1179
640 Ga0495586_0305938 3300046535 Bacteria 911
641 Ga0495667_0519788 3300046559 Bacteria 745
642 Ga0495634_0840089 3300046642 Bacteria 522
643 Ga0495635_0096267 3300046663 Bacteria 2023
644 Ga0495657_0820408 3300046675 Bacteria 531
645 Ga0495647_0079829 3300046681 Unclassified 1325
646 Ga0495647_0084909 3300046681 Bacteria 1289
647 Ga0495658_0049435 3300046683 Bacteria 2375
648 Ga0495658_0517530 3300046683 Bacteria 764
649 Ga0495669_0018866 3300046684 Bacteria 2971
650 Ga0495669_0446805 3300046684 Bacteria 628
651 Ga0495669_0471746 3300046684 Unclassified 610
652 Ga0495613_0385305 3300046689 Bacteria 958
653 Ga0495624_0421424 3300046690 Bacteria 801
654 Ga0495581_0195122 3300047315 Unclassified 1184
655 Ga0495581_0293870 3300047315 Bacteria 950
656 Ga0495581_0552094 3300047315 Unclassified 669
657 Ga0495636_0075972 3300047318 Bacteria 1440
658 Ga0495674_0545055 3300047319 Unclassified 924
659 Ga0495679_032930 3300047446 Bacteria 1658
660 Ga0495684_0258565 3300047471 Bacteria 1264
661 Ga0495593_0380687 3300047673 Bacteria 706
662 Ga0496100_0202665 3300048903 Bacteria 1447
663 Ga0496102_0372060 3300048905 Bacteria 1345
664 Ga0496104_0104582 3300048907 Bacteria 2713
665 Ga0496104_0221115 3300048907 Bacteria 1806
666 Ga0496104_0658909 3300048907 Bacteria 956
667 Ga0496106_0514083 3300048909 Bacteria 962
668 Ga0496106_1372589 3300048909 Bacteria 547
669 Ga0496108_0629602 3300048911 Bacteria 933
670 Ga0496108_0810758 3300048911 Bacteria 807
671 Ga0496109_0065027 3300048912 Bacteria 3339
672 Ga0496109_1897727 3300048912 Bacteria 528
673 Ga0496110_0204191 3300048913 Bacteria 1796
674 Ga0496111_0619611 3300048914 Bacteria 791
675 Ga0496112_0080200 3300048915 Bacteria 3227
676 Ga0496112_0436407 3300048915 Bacteria 1248
677 Ga0496113_0029012 3300048916 Bacteria 3989
678 Ga0496113_0119753 3300048916 Bacteria 2057
679 Ga0496113_1449850 3300048916 Bacteria 531
680 Ga0496114_0000610 3300048917 Bacteria 26463
681 Ga0496114_0137636 3300048917 Bacteria 2112
682 Ga0496114_0186712 3300048917 Bacteria 1812
683 Ga0496114_0315889 3300048917 Bacteria 1380
684 Ga0496115_0006311 3300048918 Bacteria 8677
685 Ga0496115_0093271 3300048918 Bacteria 2462
686 Ga0501071_0937726 3300049587 Bacteria 668
687 Ga0501072_0440503 3300049588 Bacteria 1032
688 Ga0501072_1360016 3300049588 Archaea 550
689 Ga0501076_1191024 3300049592 Bacteria 627
690 Ga0501081_0226752 3300049743 Bacteria 1360
691 nmdc:mga03n38_395015_c1 3300050490 Bacteria 760
692 nmdc:mga00v17_521917_c1 3300050491 Bacteria 769
693 nmdc:mga0yw44_105867_c1 3300050492 Bacteria 1797
694 nmdc:mga0k408_92239_c1 3300050493 Bacteria 1780
695 nmdc:mga06z11_384621_c1 3300050494 Bacteria 843
696 nmdc:mga07m45_209134_c1 3300050496 Unclassified 1135
697 nmdc:mga05p37_101497_c1 3300050507 Bacteria 3542
698 nmdc:mga05p37_133730_c1 3300050507 Bacteria 3042
699 nmdc:mga05p37_1731333_c1 3300050507 Bacteria 607
700 nmdc:mga05p37_306075_c1 3300050507 Unclassified 1886
701 nmdc:mga05p37_3123_c1 3300050507 Bacteria 19250
702 nmdc:mga05p37_40992_c1 3300050507 Bacteria 5685
703 nmdc:mga05p37_431662_c1 3300050507 Bacteria 1530
704 nmdc:mga05p37_820814_c1 3300050507 Bacteria 1014
705 nmdc:mga09592_8523_c1 3300050508 Bacteria 8340
706 nmdc:mga09592_876359_c1 3300050508 Bacteria 756
707 nmdc:mga0qj67_154292_c1 3300050509 Bacteria 1863
708 nmdc:mga0qj67_230303_c1 3300050509 Unclassified 1503
709 nmdc:mga06r32_135291_c1 3300050510 Bacteria 2439
710 nmdc:mga06r32_1461_c2 3300050510 Bacteria 12530
711 nmdc:mga06r32_21918_c1 3300050510 Bacteria 5899
712 nmdc:mga06r32_751481_c1 3300050510 Bacteria 938
713 nmdc:mga08y16_1067757_c1 3300050511 Bacteria 784
714 nmdc:mga08y16_125482_c1 3300050511 Bacteria 2670
715 nmdc:mga08y16_1870670_c1 3300050511 Unclassified 552
716 nmdc:mga08y16_2996_c1 3300050511 Bacteria 17422
717 nmdc:mga08y16_3131_c1 3300050511 Bacteria 17131
718 nmdc:mga08y16_378040_c1 3300050511 Bacteria 1023
719 nmdc:mga08y16_434921_c1 3300050511 Bacteria 1340
720 nmdc:mga08y16_55981_c1 3300050511 Bacteria 4122
721 nmdc:mga0n895_135903_c1 3300050512 Bacteria 2485
722 nmdc:mga0n895_1857227_c1 3300050512 Bacteria 562
723 nmdc:mga0n895_327496_c1 3300050512 Bacteria 1552
724 nmdc:mga0n895_5166_c1 3300050512 Bacteria 10861
725 nmdc:mga0n895_566930_c1 3300050512 Bacteria 1140
726 nmdc:mga0n895_600398_c1 3300050512 Bacteria 1103
727 nmdc:mga0n895_67_c1 3300050512 Bacteria 61603
728 nmdc:mga0n895_87614_c1 3300050512 Bacteria 3111
729 nmdc:mga0n895_93437_c1 3300050512 Bacteria 3012
730 nmdc:mga0rr50_116006_c1 3300050513 Bacteria 2126
731 nmdc:mga0rr50_197820_c1 3300050513 Bacteria 1650
732 nmdc:mga0rr50_216259_c1 3300050513 Bacteria 1581
733 nmdc:mga0rr50_25_c1 3300050513 Bacteria 114931
734 nmdc:mga0rr50_3824_c1 3300050513 Bacteria 8740
735 nmdc:mga0rr50_3843_c1 3300050513 Bacteria 8723
736 nmdc:mga0rr50_49959_c1 3300050513 Bacteria 3097
737 nmdc:mga0rr50_606425_c1 3300050513 Bacteria 933
738 nmdc:mga0rr50_784087_c1 3300050513 Bacteria 813
739 nmdc:mga0rr50_9455_c1 3300050513 Bacteria 6130
740 nmdc:mga08x19_1214_c1 3300050514 Bacteria 16039
741 nmdc:mga08x19_162120_c1 3300050514 Bacteria 1519
742 nmdc:mga08x19_213_c1 3300050514 Bacteria 44077
743 nmdc:mga08x19_266926_c1 3300050514 Bacteria 1184
744 nmdc:mga08x19_30357_c1 3300050514 Bacteria 3395
745 nmdc:mga0a205_13083_c1 3300050515 Bacteria 2021
746 nmdc:mga0a205_1368569_c1 3300050515 Bacteria 555
747 nmdc:mga0a205_169814_c1 3300050515 Bacteria 2077
748 nmdc:mga0a205_238270_c1 3300050515 Bacteria 1701
749 nmdc:mga0a205_242761_c1 3300050515 Bacteria 1682
750 nmdc:mga0a205_40397_c1 3300050515 Bacteria 4491
751 nmdc:mga0a205_444030_c1 3300050515 Bacteria 1158
752 Ga0495601_0128563 3300053077 Bacteria 1649
753 Ga0495601_0302736 3300053077 Bacteria 1041
754 Ga0495595_0121215 3300053084 Bacteria 1274
755 Ga0495619_0092632 3300053085 Bacteria 2047
756 Ga0500641_0005387 3300053096 Bacteria 4536
757 Ga0500645_007096 3300053730 Bacteria 3935
758 Ga0590077_050701 3300059426 Bacteria 931
759 Ga0501082_1878601 3300060353 Unclassified 522

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025920 Ga0207649_11484270 Ga0207649_114842701 118
2 3300032002 Ga0307416_102812200 Ga0307416_1028122002 125
3 3300005327 Ga0070658_10395581 Ga0070658_103955812 126
4 3300005337 Ga0070682_100012320 Ga0070682_1000123201 126
5 3300005544 Ga0070686_100555145 Ga0070686_1005551452 126
6 3300005577 Ga0068857_100310511 Ga0068857_1003105113 126
7 3300011119 Ga0105246_10115262 Ga0105246_101152622 126
8 3300013296 Ga0157374_10478572 Ga0157374_104785722 126
9 3300013297 Ga0157378_10000335 Ga0157378_1000033515 126
10 3300013308 Ga0157375_10000009 Ga0157375_1000000953 126
11 3300025909 Ga0207705_10393801 Ga0207705_103938011 126
12 3300026116 Ga0207674_10048880 Ga0207674_100488805 126
13 3300047446 Ga0495679_032930 Ga0495679_032930_1050_1430 126
14 3300009147 Ga0114129_11787973 Ga0114129_117879732 127
15 3300009177 Ga0105248_11346577 Ga0105248_113465772 127
16 3300009177 Ga0105248_12906642 Ga0105248_129066422 127
17 3300025941 Ga0207711_10853915 Ga0207711_108539152 127
18 3300035118 Ga0373954_0598383 Ga0373954_0598383_87_473 127
19 3300046683 Ga0495658_0049435 Ga0495658_0049435_437_853 127
20 3300005331 Ga0070670_101138390 Ga0070670_1011383902 128
21 3300005340 Ga0070689_101292821 Ga0070689_1012928212 128
22 3300005535 Ga0070684_100782620 Ga0070684_1007826202 128
23 3300005618 Ga0068864_102364573 Ga0068864_1023645732 128
24 3300006844 Ga0075428_100105753 Ga0075428_1001057532 128
25 3300006846 Ga0075430_101017159 Ga0075430_1010171592 128
26 3300025925 Ga0207650_11246728 Ga0207650_112467281 128
27 3300025933 Ga0207706_10988511 Ga0207706_109885112 128
28 3300025936 Ga0207670_10317363 Ga0207670_103173632 128
29 3300035086 Ga0373934_0115399 Ga0373934_0115399_287_679 128
30 3300035111 Ga0373923_0150446 Ga0373923_0150446_605_997 128
31 3300035116 Ga0373945_0058433 Ga0373945_0058433_410_802 128
32 3300035119 Ga0373956_0040081 Ga0373956_0040081_1564_1956 128
33 3300035170 Ga0373943_0100732 Ga0373943_0100732_906_1298 128
34 3300035172 Ga0373955_0134470 Ga0373955_0134470_641_1033 128
35 3300035410 Ga0373924_0036283 Ga0373924_0036283_1288_1680 128
36 3300035692 Ga0373935_0288794 Ga0373935_0288794_128_520 128
37 3300035724 Ga0373933_0133413 Ga0373933_0133413_1008_1400 128
38 3300035725 Ga0373947_0032067 Ga0373947_0032067_1628_2020 128
39 3300036401 Ga0373937_0239975 Ga0373937_0239975_405_797 128
40 3300036401 Ga0373937_1990307 Ga0373937_1990307_86_487 128
41 3300037068 Ga0373925_0014745 Ga0373925_0014745_4281_4673 128
42 3300046461 Ga0495641_0383088 Ga0495641_0383088_225_617 128
43 3300046675 Ga0495657_0820408 Ga0495657_0820408_63_455 128
44 3300005615 Ga0070702_101078281 Ga0070702_1010782811 129
45 3300005840 Ga0068870_10679606 Ga0068870_106796061 129
46 3300006871 Ga0075434_100348387 Ga0075434_1003483872 129
47 3300013296 Ga0157374_10003033 Ga0157374_1000303311 129
48 3300050512 nmdc:mga0n895_327496_c1 nmdc:mga0n895_327496_c1_454_846 129
49 3300005295 Ga0065707_10351777 Ga0065707_103517772 130
50 3300005328 Ga0070676_10206447 Ga0070676_102064472 130
51 3300005330 Ga0070690_100090506 Ga0070690_1000905062 130
52 3300005334 Ga0068869_100035909 Ga0068869_1000359094 130
53 3300005336 Ga0070680_100262195 Ga0070680_1002621951 130
54 3300005336 Ga0070680_100330327 Ga0070680_1003303271 130
55 3300005336 Ga0070680_100974999 Ga0070680_1009749991 130
56 3300005340 Ga0070689_100324644 Ga0070689_1003246442 130
57 3300005340 Ga0070689_100376298 Ga0070689_1003762982 130
58 3300005341 Ga0070691_10017688 Ga0070691_100176882 130
59 3300005353 Ga0070669_100105382 Ga0070669_1001053823 130
60 3300005354 Ga0070675_100026987 Ga0070675_1000269874 130
61 3300005364 Ga0070673_100169786 Ga0070673_1001697861 130
62 3300005364 Ga0070673_101242566 Ga0070673_1012425661 130
63 3300005365 Ga0070688_100123277 Ga0070688_1001232772 130
64 3300005366 Ga0070659_100725167 Ga0070659_1007251671 130
65 3300005438 Ga0070701_10257855 Ga0070701_102578551 130
66 3300005440 Ga0070705_100234131 Ga0070705_1002341312 130
67 3300005441 Ga0070700_100004491 Ga0070700_1000044911 130
68 3300005444 Ga0070694_100635375 Ga0070694_1006353752 130
69 3300005459 Ga0068867_100009585 Ga0068867_1000095858 130
70 3300005467 Ga0070706_101374146 Ga0070706_1013741461 130
71 3300005535 Ga0070684_100332131 Ga0070684_1003321312 130
72 3300005543 Ga0070672_100182634 Ga0070672_1001826342 130
73 3300005543 Ga0070672_100971626 Ga0070672_1009716261 130
74 3300005545 Ga0070695_100045013 Ga0070695_1000450132 130
75 3300005546 Ga0070696_100208053 Ga0070696_1002080532 130
76 3300005548 Ga0070665_100481010 Ga0070665_1004810102 130
77 3300005549 Ga0070704_100348025 Ga0070704_1003480251 130
78 3300005549 Ga0070704_101055739 Ga0070704_1010557391 130
79 3300005564 Ga0070664_100061954 Ga0070664_1000619541 130
80 3300005564 Ga0070664_100225750 Ga0070664_1002257502 130
81 3300005578 Ga0068854_100348883 Ga0068854_1003488832 130
82 3300005615 Ga0070702_100094102 Ga0070702_1000941023 130
83 3300005718 Ga0068866_10222854 Ga0068866_102228541 130
84 3300005719 Ga0068861_100000681 Ga0068861_10000068115 130
85 3300005719 Ga0068861_100014268 Ga0068861_1000142683 130
86 3300005840 Ga0068870_10569804 Ga0068870_105698042 130
87 3300005840 Ga0068870_10931305 Ga0068870_109313052 130
88 3300005841 Ga0068863_100298667 Ga0068863_1002986672 130
89 3300005842 Ga0068858_100212090 Ga0068858_1002120903 130
90 3300005843 Ga0068860_101871641 Ga0068860_1018716411 130
91 3300005844 Ga0068862_100077682 Ga0068862_1000776824 130
92 3300005844 Ga0068862_100161766 Ga0068862_1001617661 130
93 3300005844 Ga0068862_100823686 Ga0068862_1008236862 130
94 3300006038 Ga0075365_10035023 Ga0075365_100350233 130
95 3300006051 Ga0075364_10638724 Ga0075364_106387242 130
96 3300006058 Ga0075432_10047611 Ga0075432_100476112 130
97 3300006237 Ga0097621_100002206 Ga0097621_1000022066 130
98 3300006358 Ga0068871_100004656 Ga0068871_1000046563 130
99 3300006358 Ga0068871_100401987 Ga0068871_1004019872 130
100 3300006844 Ga0075428_100486594 Ga0075428_1004865942 130
101 3300006846 Ga0075430_100123011 Ga0075430_1001230111 130
102 3300006847 Ga0075431_100023894 Ga0075431_1000238943 130
103 3300006847 Ga0075431_100058861 Ga0075431_1000588615 130
104 3300006847 Ga0075431_100128064 Ga0075431_1001280643 130
105 3300006847 Ga0075431_101589350 Ga0075431_1015893501 130
106 3300006852 Ga0075433_10337177 Ga0075433_103371772 130
107 3300006852 Ga0075433_10472315 Ga0075433_104723152 130
108 3300006852 Ga0075433_10909381 Ga0075433_109093812 130
109 3300006871 Ga0075434_100087037 Ga0075434_1000870373 130
110 3300006880 Ga0075429_100028798 Ga0075429_1000287983 130
111 3300006881 Ga0068865_100016109 Ga0068865_1000161097 130
112 3300006881 Ga0068865_101354958 Ga0068865_1013549582 130
113 3300007076 Ga0075435_100401948 Ga0075435_1004019482 130
114 3300009094 Ga0111539_10000151 Ga0111539_1000015144 130
115 3300009094 Ga0111539_10029847 Ga0111539_100298473 130
116 3300009094 Ga0111539_10874617 Ga0111539_108746172 130
117 3300009098 Ga0105245_10081028 Ga0105245_100810283 130
118 3300009098 Ga0105245_12559262 Ga0105245_125592622 130
119 3300009147 Ga0114129_10456820 Ga0114129_104568202 130
120 3300009147 Ga0114129_10720633 Ga0114129_107206332 130
121 3300009147 Ga0114129_11585894 Ga0114129_115858942 130
122 3300009148 Ga0105243_11048494 Ga0105243_110484942 130
123 3300009148 Ga0105243_11139607 Ga0105243_111396071 130
124 3300009176 Ga0105242_10003159 Ga0105242_100031595 130
125 3300009177 Ga0105248_10804486 Ga0105248_108044862 130
126 3300009177 Ga0105248_12454952 Ga0105248_124549522 130
127 3300009553 Ga0105249_11373218 Ga0105249_113732182 130
128 3300010375 Ga0105239_11551149 Ga0105239_115511492 130
129 3300011119 Ga0105246_12539436 Ga0105246_125394361 130
130 3300013296 Ga0157374_11014246 Ga0157374_110142462 130
131 3300013308 Ga0157375_10688735 Ga0157375_106887352 130
132 3300014325 Ga0163163_10146700 Ga0163163_101467004 130
133 3300014325 Ga0163163_11624606 Ga0163163_116246061 130
134 3300014326 Ga0157380_10850559 Ga0157380_108505591 130
135 3300014745 Ga0157377_10011786 Ga0157377_100117864 130
136 3300014969 Ga0157376_10033312 Ga0157376_100333123 130
137 3300014969 Ga0157376_10457036 Ga0157376_104570362 130
138 3300025899 Ga0207642_10341979 Ga0207642_103419792 130
139 3300025907 Ga0207645_10003035 Ga0207645_1000303515 130
140 3300025907 Ga0207645_10163695 Ga0207645_101636952 130
141 3300025908 Ga0207643_10425752 Ga0207643_104257522 130
142 3300025910 Ga0207684_10249510 Ga0207684_102495102 130
143 3300025910 Ga0207684_10704481 Ga0207684_107044812 130
144 3300025911 Ga0207654_11385935 Ga0207654_113859351 130
145 3300025917 Ga0207660_11055818 Ga0207660_110558182 130
146 3300025917 Ga0207660_11081332 Ga0207660_110813322 130
147 3300025917 Ga0207660_11130175 Ga0207660_111301752 130
148 3300025918 Ga0207662_10081080 Ga0207662_100810803 130
149 3300025918 Ga0207662_10319863 Ga0207662_103198631 130
150 3300025926 Ga0207659_10022298 Ga0207659_100222984 130
151 3300025926 Ga0207659_11053739 Ga0207659_110537391 130
152 3300025926 Ga0207659_11466892 Ga0207659_114668922 130
153 3300025927 Ga0207687_10896303 Ga0207687_108963032 130
154 3300025931 Ga0207644_11381650 Ga0207644_113816501 130
155 3300025932 Ga0207690_11027298 Ga0207690_110272982 130
156 3300025934 Ga0207686_10049156 Ga0207686_100491562 130
157 3300025935 Ga0207709_10109876 Ga0207709_101098763 130
158 3300025935 Ga0207709_10301669 Ga0207709_103016692 130
159 3300025935 Ga0207709_10486492 Ga0207709_104864922 130
160 3300025938 Ga0207704_10007163 Ga0207704_100071632 130
161 3300025938 Ga0207704_11072238 Ga0207704_110722382 130
162 3300025940 Ga0207691_10625892 Ga0207691_106258922 130
163 3300025941 Ga0207711_10223361 Ga0207711_102233611 130
164 3300025942 Ga0207689_11444044 Ga0207689_114440441 130
165 3300025945 Ga0207679_10382761 Ga0207679_103827612 130
166 3300025945 Ga0207679_10973605 Ga0207679_109736052 130
167 3300025960 Ga0207651_10153118 Ga0207651_101531183 130
168 3300025961 Ga0207712_11455455 Ga0207712_114554551 130
169 3300025981 Ga0207640_10044262 Ga0207640_100442624 130
170 3300025986 Ga0207658_11854364 Ga0207658_118543641 130
171 3300026023 Ga0207677_12012112 Ga0207677_120121121 130
172 3300026075 Ga0207708_10000915 Ga0207708_1000091520 130
173 3300026088 Ga0207641_10200789 Ga0207641_102007892 130
174 3300026089 Ga0207648_10003983 Ga0207648_1000398318 130
175 3300026089 Ga0207648_10285998 Ga0207648_102859982 130
176 3300026116 Ga0207674_11159976 Ga0207674_111599761 130
177 3300026118 Ga0207675_100006469 Ga0207675_10000646914 130
178 3300026118 Ga0207675_100016792 Ga0207675_1000167923 130
179 3300027907 Ga0207428_10000643 Ga0207428_1000064326 130
180 3300027907 Ga0207428_10041193 Ga0207428_100411932 130
181 3300028379 Ga0268266_10042136 Ga0268266_100421363 130
182 3300028380 Ga0268265_10060930 Ga0268265_100609301 130
183 3300028380 Ga0268265_10277451 Ga0268265_102774513 130
184 3300028380 Ga0268265_10779767 Ga0268265_107797672 130
185 3300028380 Ga0268265_10785673 Ga0268265_107856731 130
186 3300028381 Ga0268264_10802557 Ga0268264_108025572 130
187 3300028381 Ga0268264_12321047 Ga0268264_123210471 130
188 3300031507 Ga0307509_10417558 Ga0307509_104175582 130
189 3300032002 Ga0307416_102930123 Ga0307416_1029301231 130
190 3300035119 Ga0373956_0050242 Ga0373956_0050242_1398_1802 130
191 3300035119 Ga0373956_0461250 Ga0373956_0461250_166_558 130
192 3300035725 Ga0373947_0150201 Ga0373947_0150201_840_1235 130
193 3300036401 Ga0373937_0137948 Ga0373937_0137948_383_775 130
194 3300042436 Ga0439435_0222972 Ga0439435_0222972_111_506 130
195 3300042461 Ga0439460_0245275 Ga0439460_0245275_62_463 130
196 3300046455 Ga0495603_0207111 Ga0495603_0207111_506_901 130
197 3300046681 Ga0495647_0084909 Ga0495647_0084909_226_621 130
198 3300046683 Ga0495658_0517530 Ga0495658_0517530_180_575 130
199 3300046684 Ga0495669_0446805 Ga0495669_0446805_161_589 130
200 3300046690 Ga0495624_0421424 Ga0495624_0421424_385_780 130
201 3300047315 Ga0495581_0293870 Ga0495581_0293870_47_442 130
202 3300048907 Ga0496104_0658909 Ga0496104_0658909_450_851 130
203 3300048911 Ga0496108_0810758 Ga0496108_0810758_301_702 130
204 3300048912 Ga0496109_0065027 Ga0496109_0065027_773_1174 130
205 3300048913 Ga0496110_0204191 Ga0496110_0204191_145_540 130
206 3300048915 Ga0496112_0436407 Ga0496112_0436407_515_913 130
207 3300048916 Ga0496113_0119753 Ga0496113_0119753_220_621 130
208 3300048917 Ga0496114_0315889 Ga0496114_0315889_392_787 130
209 3300049588 Ga0501072_1360016 Ga0501072_1360016_121_522 130
210 3300049592 Ga0501076_1191024 Ga0501076_1191024_85_486 130
211 3300050491 nmdc:mga00v17_521917_c1 nmdc:mga00v17_521917_c1_47_442 130
212 3300050492 nmdc:mga0yw44_105867_c1 nmdc:mga0yw44_105867_c1_907_1302 130
213 3300050507 nmdc:mga05p37_306075_c1 nmdc:mga05p37_306075_c1_200_601 130
214 3300050508 nmdc:mga09592_8523_c1 nmdc:mga09592_8523_c1_1276_1677 130
215 3300050508 nmdc:mga09592_876359_c1 nmdc:mga09592_876359_c1_224_649 130
216 3300050509 nmdc:mga0qj67_154292_c1 nmdc:mga0qj67_154292_c1_1380_1781 130
217 3300050509 nmdc:mga0qj67_230303_c1 nmdc:mga0qj67_230303_c1_803_1198 130
218 3300050510 nmdc:mga06r32_135291_c1 nmdc:mga06r32_135291_c1_576_971 130
219 3300050510 nmdc:mga06r32_21918_c1 nmdc:mga06r32_21918_c1_2505_2906 130
220 3300050510 nmdc:mga06r32_751481_c1 nmdc:mga06r32_751481_c1_190_585 130
221 3300050511 nmdc:mga08y16_125482_c1 nmdc:mga08y16_125482_c1_245_703 130
222 3300050511 nmdc:mga08y16_2996_c1 nmdc:mga08y16_2996_c1_4454_4849 130
223 3300050511 nmdc:mga08y16_3131_c1 nmdc:mga08y16_3131_c1_11045_11446 130
224 3300050511 nmdc:mga08y16_378040_c1 nmdc:mga08y16_378040_c1_170_574 130
225 3300050511 nmdc:mga08y16_434921_c1 nmdc:mga08y16_434921_c1_67_468 130
226 3300050512 nmdc:mga0n895_135903_c1 nmdc:mga0n895_135903_c1_617_1018 130
227 3300050513 nmdc:mga0rr50_216259_c1 nmdc:mga0rr50_216259_c1_758_1156 130
228 3300050513 nmdc:mga0rr50_606425_c1 nmdc:mga0rr50_606425_c1_445_840 130
229 3300050515 nmdc:mga0a205_169814_c1 nmdc:mga0a205_169814_c1_317_718 130
230 3300050515 nmdc:mga0a205_444030_c1 nmdc:mga0a205_444030_c1_126_524 130
231 3300005290 Ga0065712_10823906 Ga0065712_108239061 131
232 3300005295 Ga0065707_10202879 Ga0065707_102028793 131
233 3300005328 Ga0070676_10625261 Ga0070676_106252611 131
234 3300005329 Ga0070683_100317533 Ga0070683_1003175332 131
235 3300005330 Ga0070690_100004924 Ga0070690_1000049244 131
236 3300005334 Ga0068869_100490718 Ga0068869_1004907182 131
237 3300005335 Ga0070666_10003143 Ga0070666_100031436 131
238 3300005338 Ga0068868_100018237 Ga0068868_1000182377 131
239 3300005340 Ga0070689_101797092 Ga0070689_1017970921 131
240 3300005343 Ga0070687_100064604 Ga0070687_1000646042 131
241 3300005343 Ga0070687_100917726 Ga0070687_1009177261 131
242 3300005345 Ga0070692_10157375 Ga0070692_101573752 131
243 3300005353 Ga0070669_100005125 Ga0070669_1000051259 131
244 3300005354 Ga0070675_101754137 Ga0070675_1017541371 131
245 3300005355 Ga0070671_101310663 Ga0070671_1013106631 131
246 3300005356 Ga0070674_100345651 Ga0070674_1003456512 131
247 3300005356 Ga0070674_101917243 Ga0070674_1019172431 131
248 3300005364 Ga0070673_101808543 Ga0070673_1018085431 131
249 3300005366 Ga0070659_101296120 Ga0070659_1012961201 131
250 3300005367 Ga0070667_100980608 Ga0070667_1009806081 131
251 3300005436 Ga0070713_100088982 Ga0070713_1000889822 131
252 3300005437 Ga0070710_11282513 Ga0070710_112825131 131
253 3300005439 Ga0070711_100095835 Ga0070711_1000958352 131
254 3300005440 Ga0070705_100337544 Ga0070705_1003375442 131
255 3300005440 Ga0070705_101052570 Ga0070705_1010525701 131
256 3300005441 Ga0070700_100150393 Ga0070700_1001503932 131
257 3300005441 Ga0070700_100180565 Ga0070700_1001805652 131
258 3300005441 Ga0070700_100221466 Ga0070700_1002214662 131
259 3300005444 Ga0070694_100919842 Ga0070694_1009198422 131
260 3300005445 Ga0070708_100022843 Ga0070708_1000228437 131
261 3300005455 Ga0070663_100020449 Ga0070663_1000204493 131
262 3300005457 Ga0070662_100031938 Ga0070662_1000319381 131
263 3300005457 Ga0070662_100360256 Ga0070662_1003602562 131
264 3300005457 Ga0070662_100722412 Ga0070662_1007224121 131
265 3300005467 Ga0070706_100304070 Ga0070706_1003040703 131
266 3300005467 Ga0070706_100796461 Ga0070706_1007964612 131
267 3300005467 Ga0070706_101075290 Ga0070706_1010752901 131
268 3300005468 Ga0070707_100310473 Ga0070707_1003104733 131
269 3300005471 Ga0070698_100004142 Ga0070698_1000041425 131
270 3300005471 Ga0070698_100026852 Ga0070698_1000268527 131
271 3300005471 Ga0070698_100189432 Ga0070698_1001894322 131
272 3300005471 Ga0070698_100194599 Ga0070698_1001945993 131
273 3300005471 Ga0070698_100217638 Ga0070698_1002176382 131
274 3300005518 Ga0070699_100004957 Ga0070699_1000049579 131
275 3300005518 Ga0070699_100177604 Ga0070699_1001776041 131
276 3300005535 Ga0070684_100762004 Ga0070684_1007620042 131
277 3300005536 Ga0070697_100049890 Ga0070697_1000498902 131
278 3300005536 Ga0070697_100302959 Ga0070697_1003029592 131
279 3300005536 Ga0070697_100481341 Ga0070697_1004813412 131
280 3300005544 Ga0070686_100476676 Ga0070686_1004766762 131
281 3300005544 Ga0070686_100742458 Ga0070686_1007424582 131
282 3300005545 Ga0070695_100145958 Ga0070695_1001459583 131
283 3300005545 Ga0070695_100363170 Ga0070695_1003631702 131
284 3300005546 Ga0070696_100009861 Ga0070696_1000098614 131
285 3300005546 Ga0070696_100137056 Ga0070696_1001370561 131
286 3300005546 Ga0070696_100944289 Ga0070696_1009442891 131
287 3300005548 Ga0070665_100009577 Ga0070665_1000095777 131
288 3300005548 Ga0070665_100741745 Ga0070665_1007417452 131
289 3300005577 Ga0068857_100904170 Ga0068857_1009041702 131
290 3300005577 Ga0068857_102512445 Ga0068857_1025124451 131
291 3300005578 Ga0068854_100724572 Ga0068854_1007245722 131
292 3300005616 Ga0068852_101406783 Ga0068852_1014067831 131
293 3300005617 Ga0068859_100311125 Ga0068859_1003111252 131
294 3300005617 Ga0068859_101502178 Ga0068859_1015021781 131
295 3300005617 Ga0068859_101838467 Ga0068859_1018384672 131
296 3300005618 Ga0068864_100969643 Ga0068864_1009696432 131
297 3300005718 Ga0068866_10035697 Ga0068866_100356973 131
298 3300005718 Ga0068866_10147042 Ga0068866_101470422 131
299 3300005719 Ga0068861_100053505 Ga0068861_1000535052 131
300 3300005719 Ga0068861_100155055 Ga0068861_1001550552 131
301 3300005719 Ga0068861_101031741 Ga0068861_1010317411 131
302 3300005834 Ga0068851_10176965 Ga0068851_101769652 131
303 3300005840 Ga0068870_10609774 Ga0068870_106097741 131
304 3300005841 Ga0068863_100315142 Ga0068863_1003151423 131
305 3300005842 Ga0068858_100008049 Ga0068858_1000080497 131
306 3300005842 Ga0068858_100016232 Ga0068858_1000162325 131
307 3300005842 Ga0068858_100034008 Ga0068858_1000340082 131
308 3300005842 Ga0068858_101474389 Ga0068858_1014743891 131
309 3300005842 Ga0068858_102505917 Ga0068858_1025059171 131
310 3300005843 Ga0068860_100131851 Ga0068860_1001318512 131
311 3300005843 Ga0068860_100157942 Ga0068860_1001579423 131
312 3300005843 Ga0068860_100247650 Ga0068860_1002476502 131
313 3300005843 Ga0068860_100474784 Ga0068860_1004747842 131
314 3300005843 Ga0068860_100865757 Ga0068860_1008657572 131
315 3300005843 Ga0068860_100945359 Ga0068860_1009453592 131
316 3300005843 Ga0068860_102259180 Ga0068860_1022591801 131
317 3300005844 Ga0068862_100022816 Ga0068862_1000228166 131
318 3300005844 Ga0068862_100078119 Ga0068862_1000781193 131
319 3300005844 Ga0068862_100313239 Ga0068862_1003132392 131
320 3300005844 Ga0068862_100801312 Ga0068862_1008013122 131
321 3300005937 Ga0081455_10122650 Ga0081455_101226501 131
322 3300005937 Ga0081455_10138036 Ga0081455_101380362 131
323 3300005937 Ga0081455_10453137 Ga0081455_104531371 131
324 3300005985 Ga0081539_10000108 Ga0081539_1000010891 131
325 3300005985 Ga0081539_10002107 Ga0081539_1000210722 131
326 3300005985 Ga0081539_10025531 Ga0081539_100255312 131
327 3300006042 Ga0075368_10221855 Ga0075368_102218552 131
328 3300006058 Ga0075432_10451903 Ga0075432_104519032 131
329 3300006163 Ga0070715_10011449 Ga0070715_100114493 131
330 3300006163 Ga0070715_10268687 Ga0070715_102686872 131
331 3300006163 Ga0070715_10791538 Ga0070715_107915382 131
332 3300006178 Ga0075367_10551863 Ga0075367_105518632 131
333 3300006195 Ga0075366_10094868 Ga0075366_100948682 131
334 3300006195 Ga0075366_10121652 Ga0075366_101216522 131
335 3300006237 Ga0097621_100002228 Ga0097621_1000022288 131
336 3300006237 Ga0097621_100043370 Ga0097621_1000433704 131
337 3300006237 Ga0097621_100111959 Ga0097621_1001119592 131
338 3300006237 Ga0097621_100244763 Ga0097621_1002447632 131
339 3300006353 Ga0075370_10337171 Ga0075370_103371712 131
340 3300006358 Ga0068871_100000586 Ga0068871_10000058627 131
341 3300006358 Ga0068871_100066178 Ga0068871_1000661783 131
342 3300006358 Ga0068871_100204697 Ga0068871_1002046971 131
343 3300006358 Ga0068871_101025743 Ga0068871_1010257432 131
344 3300006847 Ga0075431_100005294 Ga0075431_1000052944 131
345 3300006852 Ga0075433_10030799 Ga0075433_100307995 131
346 3300006852 Ga0075433_10109154 Ga0075433_101091543 131
347 3300006852 Ga0075433_10810531 Ga0075433_108105311 131
348 3300006852 Ga0075433_11442663 Ga0075433_114426631 131
349 3300006871 Ga0075434_100000538 Ga0075434_10000053812 131
350 3300006871 Ga0075434_100005479 Ga0075434_1000054798 131
351 3300006871 Ga0075434_100188581 Ga0075434_1001885812 131
352 3300006871 Ga0075434_100487152 Ga0075434_1004871523 131
353 3300006871 Ga0075434_101439069 Ga0075434_1014390692 131
354 3300006871 Ga0075434_102235310 Ga0075434_1022353101 131
355 3300006881 Ga0068865_100057007 Ga0068865_1000570073 131
356 3300006881 Ga0068865_101218460 Ga0068865_1012184601 131
357 3300006914 Ga0075436_100000641 Ga0075436_1000006418 131
358 3300006914 Ga0075436_100005174 Ga0075436_1000051744 131
359 3300006914 Ga0075436_100010981 Ga0075436_1000109817 131
360 3300006914 Ga0075436_100214603 Ga0075436_1002146032 131
361 3300006914 Ga0075436_100266632 Ga0075436_1002666322 131
362 3300006931 Ga0097620_100311115 Ga0097620_1003111152 131
363 3300006931 Ga0097620_100585708 Ga0097620_1005857082 131
364 3300006931 Ga0097620_101502223 Ga0097620_1015022231 131
365 3300006931 Ga0097620_101838830 Ga0097620_1018388302 131
366 3300007076 Ga0075435_100000009 Ga0075435_10000000929 131
367 3300007076 Ga0075435_100000567 Ga0075435_1000005677 131
368 3300007076 Ga0075435_100001575 Ga0075435_10000157510 131
369 3300007076 Ga0075435_100005738 Ga0075435_1000057383 131
370 3300007076 Ga0075435_100012126 Ga0075435_1000121267 131
371 3300007076 Ga0075435_100081777 Ga0075435_1000817772 131
372 3300007076 Ga0075435_100395254 Ga0075435_1003952542 131
373 3300009093 Ga0105240_10455643 Ga0105240_104556432 131
374 3300009093 Ga0105240_12068601 Ga0105240_120686012 131
375 3300009094 Ga0111539_10643147 Ga0111539_106431471 131
376 3300009098 Ga0105245_10012218 Ga0105245_100122184 131
377 3300009098 Ga0105245_10028212 Ga0105245_100282122 131
378 3300009101 Ga0105247_10027790 Ga0105247_100277906 131
379 3300009101 Ga0105247_10125128 Ga0105247_101251282 131
380 3300009147 Ga0114129_10009169 Ga0114129_100091698 131
381 3300009147 Ga0114129_10022392 Ga0114129_100223929 131
382 3300009147 Ga0114129_10048648 Ga0114129_100486486 131
383 3300009147 Ga0114129_10122203 Ga0114129_101222034 131
384 3300009147 Ga0114129_10284631 Ga0114129_102846312 131
385 3300009147 Ga0114129_10302378 Ga0114129_103023781 131
386 3300009147 Ga0114129_12651297 Ga0114129_126512971 131
387 3300009148 Ga0105243_10022611 Ga0105243_100226114 131
388 3300009148 Ga0105243_12512079 Ga0105243_125120791 131
389 3300009174 Ga0105241_10128908 Ga0105241_101289083 131
390 3300009174 Ga0105241_11699043 Ga0105241_116990432 131
391 3300009176 Ga0105242_10003881 Ga0105242_100038817 131
392 3300009176 Ga0105242_10141531 Ga0105242_101415312 131
393 3300009177 Ga0105248_10077759 Ga0105248_100777596 131
394 3300009177 Ga0105248_10313262 Ga0105248_103132623 131
395 3300009177 Ga0105248_10361757 Ga0105248_103617572 131
396 3300009177 Ga0105248_10538965 Ga0105248_105389651 131
397 3300009177 Ga0105248_11377764 Ga0105248_113777641 131
398 3300009177 Ga0105248_12456203 Ga0105248_124562032 131
399 3300009545 Ga0105237_10179827 Ga0105237_101798272 131
400 3300009551 Ga0105238_12842607 Ga0105238_128426071 131
401 3300009553 Ga0105249_10109645 Ga0105249_101096452 131
402 3300009553 Ga0105249_10374136 Ga0105249_103741361 131
403 3300009553 Ga0105249_12359685 Ga0105249_123596852 131
404 3300009553 Ga0105249_12494558 Ga0105249_124945582 131
405 3300011119 Ga0105246_10398268 Ga0105246_103982682 131
406 3300013296 Ga0157374_10192778 Ga0157374_101927783 131
407 3300013296 Ga0157374_10559245 Ga0157374_105592452 131
408 3300013297 Ga0157378_10000904 Ga0157378_1000090423 131
409 3300013297 Ga0157378_10009297 Ga0157378_100092972 131
410 3300013297 Ga0157378_10419507 Ga0157378_104195072 131
411 3300013297 Ga0157378_11695148 Ga0157378_116951482 131
412 3300013297 Ga0157378_12273019 Ga0157378_122730191 131
413 3300013306 Ga0163162_10051414 Ga0163162_100514143 131
414 3300014325 Ga0163163_10040445 Ga0163163_100404456 131
415 3300014325 Ga0163163_10999765 Ga0163163_109997652 131
416 3300014326 Ga0157380_10071637 Ga0157380_100716373 131
417 3300014326 Ga0157380_10216754 Ga0157380_102167542 131
418 3300014326 Ga0157380_10713424 Ga0157380_107134242 131
419 3300014326 Ga0157380_10717814 Ga0157380_107178142 131
420 3300014968 Ga0157379_10017793 Ga0157379_100177935 131
421 3300014968 Ga0157379_10027746 Ga0157379_100277466 131
422 3300014968 Ga0157379_10071716 Ga0157379_100717163 131
423 3300014968 Ga0157379_10274943 Ga0157379_102749432 131
424 3300014968 Ga0157379_10418490 Ga0157379_104184902 131
425 3300014969 Ga0157376_10484621 Ga0157376_104846212 131
426 3300017792 Ga0163161_11602166 Ga0163161_116021662 131
427 3300025315 Ga0207697_10017848 Ga0207697_100178482 131
428 3300025893 Ga0207682_10378677 Ga0207682_103786772 131
429 3300025893 Ga0207682_10394205 Ga0207682_103942052 131
430 3300025899 Ga0207642_10236748 Ga0207642_102367482 131
431 3300025900 Ga0207710_10008364 Ga0207710_100083644 131
432 3300025900 Ga0207710_10068574 Ga0207710_100685742 131
433 3300025903 Ga0207680_10031313 Ga0207680_100313133 131
434 3300025903 Ga0207680_10062012 Ga0207680_100620122 131
435 3300025905 Ga0207685_10252148 Ga0207685_102521482 131
436 3300025907 Ga0207645_10364248 Ga0207645_103642482 131
437 3300025907 Ga0207645_10588729 Ga0207645_105887292 131
438 3300025908 Ga0207643_10162025 Ga0207643_101620252 131
439 3300025910 Ga0207684_10254606 Ga0207684_102546062 131
440 3300025910 Ga0207684_10577242 Ga0207684_105772422 131
441 3300025911 Ga0207654_10627184 Ga0207654_106271842 131
442 3300025913 Ga0207695_10345304 Ga0207695_103453041 131
443 3300025913 Ga0207695_11150803 Ga0207695_111508032 131
444 3300025914 Ga0207671_10121874 Ga0207671_101218743 131
445 3300025918 Ga0207662_10048272 Ga0207662_100482722 131
446 3300025922 Ga0207646_10211568 Ga0207646_102115682 131
447 3300025923 Ga0207681_10025533 Ga0207681_100255333 131
448 3300025925 Ga0207650_11315215 Ga0207650_113152151 131
449 3300025927 Ga0207687_10000530 Ga0207687_1000053025 131
450 3300025927 Ga0207687_10188860 Ga0207687_101888601 131
451 3300025927 Ga0207687_10643128 Ga0207687_106431282 131
452 3300025928 Ga0207700_11069741 Ga0207700_110697412 131
453 3300025932 Ga0207690_11289617 Ga0207690_112896172 131
454 3300025933 Ga0207706_10018270 Ga0207706_100182708 131
455 3300025933 Ga0207706_10100721 Ga0207706_101007213 131
456 3300025934 Ga0207686_10049898 Ga0207686_100498984 131
457 3300025934 Ga0207686_10772932 Ga0207686_107729322 131
458 3300025935 Ga0207709_10040099 Ga0207709_100400991 131
459 3300025935 Ga0207709_11505467 Ga0207709_115054671 131
460 3300025936 Ga0207670_10630202 Ga0207670_106302022 131
461 3300025936 Ga0207670_10837083 Ga0207670_108370831 131
462 3300025937 Ga0207669_10121822 Ga0207669_101218222 131
463 3300025938 Ga0207704_10508492 Ga0207704_105084921 131
464 3300025940 Ga0207691_10386140 Ga0207691_103861401 131
465 3300025940 Ga0207691_10574388 Ga0207691_105743881 131
466 3300025941 Ga0207711_10010783 Ga0207711_100107836 131
467 3300025941 Ga0207711_10166711 Ga0207711_101667112 131
468 3300025941 Ga0207711_10199765 Ga0207711_101997653 131
469 3300025942 Ga0207689_10372620 Ga0207689_103726201 131
470 3300025945 Ga0207679_10098032 Ga0207679_100980322 131
471 3300025945 Ga0207679_10562586 Ga0207679_105625861 131
472 3300025945 Ga0207679_11970956 Ga0207679_119709561 131
473 3300025945 Ga0207679_12187379 Ga0207679_121873791 131
474 3300025949 Ga0207667_10575891 Ga0207667_105758912 131
475 3300025960 Ga0207651_10704728 Ga0207651_107047282 131
476 3300025960 Ga0207651_10725224 Ga0207651_107252242 131
477 3300025960 Ga0207651_11883328 Ga0207651_118833282 131
478 3300025961 Ga0207712_10217069 Ga0207712_102170692 131
479 3300025961 Ga0207712_11167266 Ga0207712_111672661 131
480 3300025961 Ga0207712_12024963 Ga0207712_120249631 131
481 3300025981 Ga0207640_10505539 Ga0207640_105055392 131
482 3300025981 Ga0207640_10736330 Ga0207640_107363302 131
483 3300025986 Ga0207658_10573092 Ga0207658_105730922 131
484 3300026023 Ga0207677_10425132 Ga0207677_104251322 131
485 3300026035 Ga0207703_10019292 Ga0207703_100192922 131
486 3300026035 Ga0207703_10029802 Ga0207703_100298027 131
487 3300026035 Ga0207703_10063621 Ga0207703_100636212 131
488 3300026041 Ga0207639_11326447 Ga0207639_113264471 131
489 3300026067 Ga0207678_10112203 Ga0207678_101122031 131
490 3300026075 Ga0207708_10145781 Ga0207708_101457812 131
491 3300026075 Ga0207708_10311221 Ga0207708_103112212 131
492 3300026075 Ga0207708_10489544 Ga0207708_104895442 131
493 3300026088 Ga0207641_10380226 Ga0207641_103802262 131
494 3300026089 Ga0207648_10722726 Ga0207648_107227261 131
495 3300026089 Ga0207648_11559852 Ga0207648_115598521 131
496 3300026118 Ga0207675_100042052 Ga0207675_1000420522 131
497 3300026118 Ga0207675_100136023 Ga0207675_1001360232 131
498 3300026118 Ga0207675_100657184 Ga0207675_1006571842 131
499 3300026118 Ga0207675_102081948 Ga0207675_1020819482 131
500 3300026121 Ga0207683_11399240 Ga0207683_113992401 131
501 3300026142 Ga0207698_10834905 Ga0207698_108349052 131
502 3300028379 Ga0268266_10053356 Ga0268266_100533565 131
503 3300028379 Ga0268266_12339295 Ga0268266_123392951 131
504 3300028380 Ga0268265_10088493 Ga0268265_100884933 131
505 3300028380 Ga0268265_10174329 Ga0268265_101743291 131
506 3300028380 Ga0268265_10253867 Ga0268265_102538672 131
507 3300028380 Ga0268265_10658754 Ga0268265_106587542 131
508 3300028380 Ga0268265_11302278 Ga0268265_113022781 131
509 3300028380 Ga0268265_11982088 Ga0268265_119820881 131
510 3300028380 Ga0268265_12532161 Ga0268265_125321611 131
511 3300028381 Ga0268264_10082725 Ga0268264_100827253 131
512 3300028381 Ga0268264_10179094 Ga0268264_101790941 131
513 3300028381 Ga0268264_10226300 Ga0268264_102263003 131
514 3300028381 Ga0268264_10354267 Ga0268264_103542672 131
515 3300028381 Ga0268264_10408577 Ga0268264_104085772 131
516 3300028381 Ga0268264_10853112 Ga0268264_108531122 131
517 3300028381 Ga0268264_12673372 Ga0268264_126733721 131
518 3300030521 Ga0307511_10005949 Ga0307511_100059496 131
519 3300031911 Ga0307412_10219076 Ga0307412_102190761 131
520 3300032004 Ga0307414_11663409 Ga0307414_116634092 131
521 3300034816 Ga0373930_0001309 Ga0373930_0001309_343_741 131
522 3300034817 Ga0373948_0001672 Ga0373948_0001672_1786_2184 131
523 3300034818 Ga0373950_0011332 Ga0373950_0011332_790_1188 131
524 3300034819 Ga0373958_0030053 Ga0373958_0030053_646_1044 131
525 3300034957 Ga0373938_0048910 Ga0373938_0048910_93_491 131
526 3300035084 Ga0373928_0004086 Ga0373928_0004086_2167_2565 131
527 3300035084 Ga0373928_0021459 Ga0373928_0021459_542_943 131
528 3300035085 Ga0373929_0001021 Ga0373929_0001021_3154_3552 131
529 3300035088 Ga0373940_0023884 Ga0373940_0023884_978_1376 131
530 3300035090 Ga0373949_0001236 Ga0373949_0001236_5970_6368 131
531 3300035090 Ga0373949_0002813 Ga0373949_0002813_3719_4126 131
532 3300035091 Ga0373951_0000826 Ga0373951_0000826_527_925 131
533 3300035091 Ga0373951_0161414 Ga0373951_0161414_176_577 131
534 3300035092 Ga0373952_0002002 Ga0373952_0002002_244_642 131
535 3300035112 Ga0373932_0002098 Ga0373932_0002098_3843_4241 131
536 3300035114 Ga0373939_0000603 Ga0373939_0000603_2231_2629 131
537 3300035114 Ga0373939_0241832 Ga0373939_0241832_140_541 131
538 3300035114 Ga0373939_0291909 Ga0373939_0291909_225_632 131
539 3300035115 Ga0373941_0000169 Ga0373941_0000169_5000_5398 131
540 3300035115 Ga0373941_0061438 Ga0373941_0061438_798_1199 131
541 3300035121 Ga0373960_0001719 Ga0373960_0001719_1432_1830 131
542 3300035170 Ga0373943_0776085 Ga0373943_0776085_56_454 131
543 3300035171 Ga0373946_0177356 Ga0373946_0177356_392_790 131
544 3300035207 Ga0373942_0002266 Ga0373942_0002266_2588_2986 131
545 3300035241 Ga0373961_0000682 Ga0373961_0000682_8451_8849 131
546 3300035242 Ga0373962_0000733 Ga0373962_0000733_115_513 131
547 3300035691 Ga0373931_0039343 Ga0373931_0039343_932_1330 131
548 3300035691 Ga0373931_0184085 Ga0373931_0184085_289_690 131
549 3300035692 Ga0373935_0434848 Ga0373935_0434848_256_657 131
550 3300035724 Ga0373933_0357985 Ga0373933_0357985_289_687 131
551 3300036401 Ga0373937_1053062 Ga0373937_1053062_132_530 131
552 3300037068 Ga0373925_0037974 Ga0373925_0037974_949_1347 131
553 3300037068 Ga0373925_1284105 Ga0373925_1284105_189_590 131
554 3300045051 Ga0451576_0222034 Ga0451576_0222034_437_844 131
555 3300046461 Ga0495641_0192905 Ga0495641_0192905_353_751 131
556 3300046463 Ga0495653_0279680 Ga0495653_0279680_429_827 131
557 3300046472 Ga0495580_0186101 Ga0495580_0186101_409_810 131
558 3300046475 Ga0495639_0023059 Ga0495639_0023059_1469_1870 131
559 3300046475 Ga0495639_0249753 Ga0495639_0249753_72_470 131
560 3300046499 Ga0495594_0171845 Ga0495594_0171845_150_548 131
561 3300046522 Ga0495643_0038122 Ga0495643_0038122_927_1325 131
562 3300046528 Ga0495642_0109788 Ga0495642_0109788_685_1083 131
563 3300046535 Ga0495586_0305938 Ga0495586_0305938_227_625 131
564 3300046559 Ga0495667_0519788 Ga0495667_0519788_232_630 131
565 3300046642 Ga0495634_0840089 Ga0495634_0840089_33_440 131
566 3300046663 Ga0495635_0096267 Ga0495635_0096267_928_1326 131
567 3300046681 Ga0495647_0079829 Ga0495647_0079829_420_827 131
568 3300046684 Ga0495669_0018866 Ga0495669_0018866_143_541 131
569 3300046684 Ga0495669_0471746 Ga0495669_0471746_55_462 131
570 3300046689 Ga0495613_0385305 Ga0495613_0385305_28_426 131
571 3300047315 Ga0495581_0195122 Ga0495581_0195122_744_1145 131
572 3300047315 Ga0495581_0552094 Ga0495581_0552094_208_606 131
573 3300047318 Ga0495636_0075972 Ga0495636_0075972_123_521 131
574 3300047319 Ga0495674_0545055 Ga0495674_0545055_302_697 131
575 3300047471 Ga0495684_0258565 Ga0495684_0258565_610_1008 131
576 3300047673 Ga0495593_0380687 Ga0495593_0380687_78_476 131
577 3300048903 Ga0496100_0202665 Ga0496100_0202665_131_529 131
578 3300048905 Ga0496102_0372060 Ga0496102_0372060_253_651 131
579 3300048907 Ga0496104_0104582 Ga0496104_0104582_563_961 131
580 3300048907 Ga0496104_0221115 Ga0496104_0221115_929_1327 131
581 3300048909 Ga0496106_0514083 Ga0496106_0514083_455_853 131
582 3300048909 Ga0496106_1372589 Ga0496106_1372589_60_458 131
583 3300048911 Ga0496108_0629602 Ga0496108_0629602_236_634 131
584 3300048914 Ga0496111_0619611 Ga0496111_0619611_287_685 131
585 3300048915 Ga0496112_0080200 Ga0496112_0080200_1123_1521 131
586 3300048916 Ga0496113_0029012 Ga0496113_0029012_1329_1727 131
587 3300048916 Ga0496113_1449850 Ga0496113_1449850_87_485 131
588 3300048917 Ga0496114_0000610 Ga0496114_0000610_6366_6764 131
589 3300048917 Ga0496114_0137636 Ga0496114_0137636_1014_1412 131
590 3300048917 Ga0496114_0186712 Ga0496114_0186712_272_670 131
591 3300048918 Ga0496115_0006311 Ga0496115_0006311_5683_6081 131
592 3300048918 Ga0496115_0093271 Ga0496115_0093271_1850_2248 131
593 3300049587 Ga0501071_0937726 Ga0501071_0937726_175_573 131
594 3300049588 Ga0501072_0440503 Ga0501072_0440503_186_587 131
595 3300050490 nmdc:mga03n38_395015_c1 nmdc:mga03n38_395015_c1_112_510 131
596 3300050493 nmdc:mga0k408_92239_c1 nmdc:mga0k408_92239_c1_1173_1571 131
597 3300050494 nmdc:mga06z11_384621_c1 nmdc:mga06z11_384621_c1_363_761 131
598 3300050496 nmdc:mga07m45_209134_c1 nmdc:mga07m45_209134_c1_375_773 131
599 3300050507 nmdc:mga05p37_101497_c1 nmdc:mga05p37_101497_c1_26_424 131
600 3300050507 nmdc:mga05p37_133730_c1 nmdc:mga05p37_133730_c1_404_802 131
601 3300050507 nmdc:mga05p37_3123_c1 nmdc:mga05p37_3123_c1_1536_1934 131
602 3300050507 nmdc:mga05p37_40992_c1 nmdc:mga05p37_40992_c1_1615_2046 131
603 3300050507 nmdc:mga05p37_431662_c1 nmdc:mga05p37_431662_c1_377_784 131
604 3300050510 nmdc:mga06r32_1461_c2 nmdc:mga06r32_1461_c2_5089_5487 131
605 3300050511 nmdc:mga08y16_1870670_c1 nmdc:mga08y16_1870670_c1_101_499 131
606 3300050512 nmdc:mga0n895_1857227_c1 nmdc:mga0n895_1857227_c1_153_551 131
607 3300050512 nmdc:mga0n895_5166_c1 nmdc:mga0n895_5166_c1_7644_8042 131
608 3300050512 nmdc:mga0n895_566930_c1 nmdc:mga0n895_566930_c1_655_1053 131
609 3300050512 nmdc:mga0n895_600398_c1 nmdc:mga0n895_600398_c1_242_673 131
610 3300050512 nmdc:mga0n895_67_c1 nmdc:mga0n895_67_c1_16801_17199 131
611 3300050512 nmdc:mga0n895_87614_c1 nmdc:mga0n895_87614_c1_812_1210 131
612 3300050512 nmdc:mga0n895_93437_c1 nmdc:mga0n895_93437_c1_86_493 131
613 3300050513 nmdc:mga0rr50_116006_c1 nmdc:mga0rr50_116006_c1_1496_1903 131
614 3300050513 nmdc:mga0rr50_197820_c1 nmdc:mga0rr50_197820_c1_625_1023 131
615 3300050513 nmdc:mga0rr50_25_c1 nmdc:mga0rr50_25_c1_74392_74790 131
616 3300050513 nmdc:mga0rr50_3824_c1 nmdc:mga0rr50_3824_c1_1089_1487 131
617 3300050513 nmdc:mga0rr50_3843_c1 nmdc:mga0rr50_3843_c1_3892_4290 131
618 3300050513 nmdc:mga0rr50_49959_c1 nmdc:mga0rr50_49959_c1_38_436 131
619 3300050513 nmdc:mga0rr50_784087_c1 nmdc:mga0rr50_784087_c1_217_615 131
620 3300050513 nmdc:mga0rr50_9455_c1 nmdc:mga0rr50_9455_c1_4403_4801 131
621 3300050514 nmdc:mga08x19_1214_c1 nmdc:mga08x19_1214_c1_5963_6361 131
622 3300050514 nmdc:mga08x19_162120_c1 nmdc:mga08x19_162120_c1_594_992 131
623 3300050514 nmdc:mga08x19_213_c1 nmdc:mga08x19_213_c1_38994_39392 131
624 3300050514 nmdc:mga08x19_266926_c1 nmdc:mga08x19_266926_c1_581_988 131
625 3300050514 nmdc:mga08x19_30357_c1 nmdc:mga08x19_30357_c1_176_574 131
626 3300050515 nmdc:mga0a205_13083_c1 nmdc:mga0a205_13083_c1_302_700 131
627 3300050515 nmdc:mga0a205_1368569_c1 nmdc:mga0a205_1368569_c1_89_487 131
628 3300050515 nmdc:mga0a205_242761_c1 nmdc:mga0a205_242761_c1_1205_1666 131
629 3300050515 nmdc:mga0a205_40397_c1 nmdc:mga0a205_40397_c1_3116_3514 131
630 3300053077 Ga0495601_0128563 Ga0495601_0128563_313_714 131
631 3300053077 Ga0495601_0302736 Ga0495601_0302736_612_1010 131
632 3300053084 Ga0495595_0121215 Ga0495595_0121215_212_610 131
633 3300053085 Ga0495619_0092632 Ga0495619_0092632_767_1165 131
634 3300053096 Ga0500641_0005387 Ga0500641_0005387_3400_3798 131
635 3300053730 Ga0500645_007096 Ga0500645_007096_1467_1865 131
636 3300059426 Ga0590077_050701 Ga0590077_050701_238_636 131
637 3300060353 Ga0501082_1878601 Ga0501082_1878601_79_477 131
638 3300005328 Ga0070676_10812490 Ga0070676_108124901 132
639 3300005334 Ga0068869_100432584 Ga0068869_1004325842 132
640 3300005356 Ga0070674_100801129 Ga0070674_1008011291 132
641 3300005459 Ga0068867_101490588 Ga0068867_1014905881 132
642 3300005548 Ga0070665_100002769 Ga0070665_10000276915 132
643 3300005617 Ga0068859_100402503 Ga0068859_1004025031 132
644 3300005617 Ga0068859_100797851 Ga0068859_1007978511 132
645 3300005618 Ga0068864_100594986 Ga0068864_1005949862 132
646 3300005718 Ga0068866_10909040 Ga0068866_109090402 132
647 3300005841 Ga0068863_100400714 Ga0068863_1004007141 132
648 3300005844 Ga0068862_102602913 Ga0068862_1026029131 132
649 3300005985 Ga0081539_10100914 Ga0081539_101009142 132
650 3300006237 Ga0097621_100089092 Ga0097621_1000890923 132
651 3300006358 Ga0068871_100035460 Ga0068871_1000354603 132
652 3300006881 Ga0068865_100029317 Ga0068865_1000293176 132
653 3300006931 Ga0097620_100402499 Ga0097620_1004024991 132
654 3300006931 Ga0097620_100797920 Ga0097620_1007979201 132
655 3300009093 Ga0105240_11374147 Ga0105240_113741472 132
656 3300009098 Ga0105245_10064778 Ga0105245_100647785 132
657 3300009147 Ga0114129_10571423 Ga0114129_105714232 132
658 3300009176 Ga0105242_10012282 Ga0105242_100122826 132
659 3300009176 Ga0105242_10650236 Ga0105242_106502362 132
660 3300009177 Ga0105248_10384963 Ga0105248_103849633 132
661 3300013306 Ga0163162_10638166 Ga0163162_106381662 132
662 3300013308 Ga0157375_10135568 Ga0157375_101355682 132
663 3300014968 Ga0157379_11800698 Ga0157379_118006982 132
664 3300014969 Ga0157376_10196208 Ga0157376_101962083 132
665 3300025934 Ga0207686_10003774 Ga0207686_100037742 132
666 3300025937 Ga0207669_10005616 Ga0207669_100056168 132
667 3300025939 Ga0207665_10374661 Ga0207665_103746612 132
668 3300025941 Ga0207711_10257533 Ga0207711_102575332 132
669 3300025942 Ga0207689_10273505 Ga0207689_102735052 132
670 3300026035 Ga0207703_10706967 Ga0207703_107069672 132
671 3300026088 Ga0207641_10112714 Ga0207641_101127142 132
672 3300026089 Ga0207648_10261089 Ga0207648_102610892 132
673 3300026089 Ga0207648_11522619 Ga0207648_115226191 132
674 3300028379 Ga0268266_11734800 Ga0268266_117348001 132
675 3300046472 Ga0495580_0825017 Ga0495580_0825017_50_454 132
676 3300048912 Ga0496109_1897727 Ga0496109_1897727_13_429 132
677 3300050507 nmdc:mga05p37_820814_c1 nmdc:mga05p37_820814_c1_548_949 132
678 3300005341 Ga0070691_10931129 Ga0070691_109311291 133
679 3300005343 Ga0070687_100302919 Ga0070687_1003029191 133
680 3300005444 Ga0070694_100020284 Ga0070694_1000202842 133
681 3300005468 Ga0070707_100559334 Ga0070707_1005593342 133
682 3300005518 Ga0070699_101301745 Ga0070699_1013017451 133
683 3300005545 Ga0070695_100249548 Ga0070695_1002495482 133
684 3300005546 Ga0070696_100097790 Ga0070696_1000977902 133
685 3300005549 Ga0070704_100011386 Ga0070704_1000113865 133
686 3300006852 Ga0075433_10412322 Ga0075433_104123222 133
687 3300009094 Ga0111539_10152490 Ga0111539_101524903 133
688 3300009148 Ga0105243_11224570 Ga0105243_112245702 133
689 3300013296 Ga0157374_11332749 Ga0157374_113327491 133
690 3300013308 Ga0157375_10296139 Ga0157375_102961392 133
691 3300014968 Ga0157379_11458544 Ga0157379_114585442 133
692 3300025918 Ga0207662_10212321 Ga0207662_102123212 133
693 3300025922 Ga0207646_10551472 Ga0207646_105514721 133
694 3300027907 Ga0207428_10130639 Ga0207428_101306392 133
695 3300046499 Ga0495594_0415948 Ga0495594_0415948_134_538 133
696 3300050507 nmdc:mga05p37_1731333_c1 nmdc:mga05p37_1731333_c1_31_438 133
697 3300050511 nmdc:mga08y16_55981_c1 nmdc:mga08y16_55981_c1_2742_3146 133
698 3300050515 nmdc:mga0a205_238270_c1 nmdc:mga0a205_238270_c1_713_1126 133
699 3300005334 Ga0068869_100050073 Ga0068869_1000500732 134
700 3300005340 Ga0070689_100006826 Ga0070689_1000068264 134
701 3300005353 Ga0070669_101141321 Ga0070669_1011413211 134
702 3300005354 Ga0070675_100070231 Ga0070675_1000702314 134
703 3300005365 Ga0070688_100120949 Ga0070688_1001209491 134
704 3300005365 Ga0070688_100374414 Ga0070688_1003744142 134
705 3300005438 Ga0070701_10145340 Ga0070701_101453401 134
706 3300005456 Ga0070678_100707635 Ga0070678_1007076352 134
707 3300005536 Ga0070697_100584732 Ga0070697_1005847321 134
708 3300005615 Ga0070702_100207918 Ga0070702_1002079182 134
709 3300005617 Ga0068859_100012194 Ga0068859_1000121948 134
710 3300005840 Ga0068870_11246658 Ga0068870_112466581 134
711 3300005842 Ga0068858_100020654 Ga0068858_1000206542 134
712 3300005843 Ga0068860_100013161 Ga0068860_10001316110 134
713 3300006931 Ga0097620_100012195 Ga0097620_1000121953 134
714 3300009147 Ga0114129_11863464 Ga0114129_118634641 134
715 3300009176 Ga0105242_11218254 Ga0105242_112182542 134
716 3300009177 Ga0105248_10817268 Ga0105248_108172682 134
717 3300013297 Ga0157378_10107371 Ga0157378_101073712 134
718 3300014326 Ga0157380_11776746 Ga0157380_117767462 134
719 3300025903 Ga0207680_10967130 Ga0207680_109671301 134
720 3300025905 Ga0207685_10116573 Ga0207685_101165731 134
721 3300025916 Ga0207663_10067128 Ga0207663_100671282 134
722 3300025923 Ga0207681_11717681 Ga0207681_117176811 134
723 3300025926 Ga0207659_10005200 Ga0207659_100052008 134
724 3300025934 Ga0207686_10772866 Ga0207686_107728661 134
725 3300025936 Ga0207670_10005643 Ga0207670_100056433 134
726 3300025937 Ga0207669_10051285 Ga0207669_100512853 134
727 3300025940 Ga0207691_10227032 Ga0207691_102270321 134
728 3300025941 Ga0207711_10406721 Ga0207711_104067212 134
729 3300025942 Ga0207689_10065065 Ga0207689_100650653 134
730 3300025945 Ga0207679_10444637 Ga0207679_104446372 134
731 3300026078 Ga0207702_11519357 Ga0207702_115193571 134
732 3300026088 Ga0207641_11344845 Ga0207641_113448451 134
733 3300028381 Ga0268264_10007159 Ga0268264_100071592 134
734 3300046499 Ga0495594_0448716 Ga0495594_0448716_107_511 134
735 3300049743 Ga0501081_0226752 Ga0501081_0226752_772_1182 134
736 3300050511 nmdc:mga08y16_1067757_c1 nmdc:mga08y16_1067757_c1_343_753 134
737 3300005289 Ga0065704_10078187 Ga0065704_100781876 135
738 3300005295 Ga0065707_10084528 Ga0065707_100845289 135
739 3300005340 Ga0070689_100999882 Ga0070689_1009998821 135
740 3300005441 Ga0070700_100231514 Ga0070700_1002315142 135
741 3300005456 Ga0070678_100125812 Ga0070678_1001258121 135
742 3300005467 Ga0070706_101264779 Ga0070706_1012647792 135
743 3300005535 Ga0070684_102020383 Ga0070684_1020203831 135
744 3300005539 Ga0068853_102182565 Ga0068853_1021825651 135
745 3300005545 Ga0070695_100652399 Ga0070695_1006523992 135
746 3300005841 Ga0068863_100235429 Ga0068863_1002354292 135
747 3300006237 Ga0097621_100209702 Ga0097621_1002097022 135
748 3300006881 Ga0068865_100014420 Ga0068865_1000144205 135
749 3300012485 Ga0157325_1028212 Ga0157325_10282122 135
750 3300012500 Ga0157314_1019886 Ga0157314_10198861 135
751 3300013100 Ga0157373_11018196 Ga0157373_110181962 135
752 3300014969 Ga0157376_10797893 Ga0157376_107978932 135
753 3300025936 Ga0207670_10896550 Ga0207670_108965502 135
754 3300025960 Ga0207651_11434911 Ga0207651_114349111 135
755 3300026075 Ga0207708_10064599 Ga0207708_100645992 135
756 3300035242 Ga0373962_0038267 Ga0373962_0038267_592_999 135
757 3300035691 Ga0373931_0012937 Ga0373931_0012937_2474_2881 135
758 3300044673 Ga0453683_0474445 Ga0453683_0474445_298_705 135
759 3300045051 Ga0451576_0103290 Ga0451576_0103290_1134_1541 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00392

GntR

Bacterial regulatory proteins, gntR family

34

97

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u0y-assembly1.cif.gz_A crystal structure of the dna-binding domains of yvoa in complex with palindromic operator dna 0.9602 9 80
2wv0-assembly3.cif.gz_E crystal structure of the gntr-hutc family member yvoa from bacillus subtilis 0.9589 9 80
2wv0-assembly5.cif.gz_I crystal structure of the gntr-hutc family member yvoa from bacillus subtilis 0.9579 9 80
4wwc-assembly1.cif.gz_A crystal structure of full length yvoa in complex with palindromic operator dna 0.9413 6 80
2wv0-assembly4.cif.gz_G-2 crystal structure of the gntr-hutc family member yvoa from bacillus subtilis 0.9375 7 80
ID Description Score Start End Superfamily
2wv0D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9784 14 80 1.10.10.10
2wv0E01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9698 14 80 1.10.10.10
2wv0I01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.962 14 80 1.10.10.10
4hamA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9593 9 80 1.10.10.10
4u0vA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9524 6 80 1.10.10.10
ID Description Score Start End GO Terms
AF-X1PDA0-F1-model_v4 HTH gntR-type domain-containing protein 0.9889 6 82 GO:0003677
GO:0003700
AF-A0A061AGQ9-F1-model_v4 Transcription regulator HTH, GntR 0.9746 4 80 GO:0003677
GO:0003700
AF-A0A838IV63-F1-model_v4 GntR family transcriptional regulator 0.9731 6 81 GO:0003677
GO:0003700
GO:0045892
AF-A0A4V6BI82-F1-model_v4 GntR family transcriptional regulator 0.972 4 84 GO:0003677
GO:0003700
GO:0005737
AF-A0A353NHR9-F1-model_v4 HTH gntR-type domain-containing protein 0.9706 9 82 GO:0003677
GO:0003700
GO:0009058
GO:0030170

Feature Viewer

pLDDT pTM Quality
87.03 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map