F479474

General Info

Members Datasets Scaffolds Average Seq Length
759 321 1518 107

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100621735|Ga0068858_1006217351
Length 129
Sequence MKSFGCACNPQPIHCIILIQIMRRDIFQAIADPTRRAIIALIAVQAMTPNALAEHFDTSRQAVSKHLQILTECELVTQEQKGREIYYSLEIEKMKEIDKWLEQYRKIWETRLNQLDDLLATIKKQEKEK

Samples

Sample ID Description Type Environment
1 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
120 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
122 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
123 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
125 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
196 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
197 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
198 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
199 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
200 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
201 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
202 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
203 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
204 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
205 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
206 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
207 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
208 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
215 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
217 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
218 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
219 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
225 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
226 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
227 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
228 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
229 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
230 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
231 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
232 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
233 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
234 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
235 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
236 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
237 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
238 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
239 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
240 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
241 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
242 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
243 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
244 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
245 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
246 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
247 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
248 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
249 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
250 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
251 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
252 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
253 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
254 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
255 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
256 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
257 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
258 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
259 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
260 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
261 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
262 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
263 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
264 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
265 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
266 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
267 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
268 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
269 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
270 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
273 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
274 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
275 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
276 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
281 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
282 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
283 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
284 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
285 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
286 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
287 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
288 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
289 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
290 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
291 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
292 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
293 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
294 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
295 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
296 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
297 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
298 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
299 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
300 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
301 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
302 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
303 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
304 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
305 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
306 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
307 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
308 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
309 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
310 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
311 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
312 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
313 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
314 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
315 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
316 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
317 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
318 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
319 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
320 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
321 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.43
Nodule 0
Rhizoplane 0.79
Rhizosphere 86.69
Stem 0
Stem Tuber 0
Unclassified 2.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068858_100621735 3300005842 Bacteria 1049
2 SwRhRL2b_contig_1761633 2162886007 Bacteria 195701
3 JGI24743J22301_10037794 3300001991 Bacteria 963
4 JGI25162J39368_1000881 3300002737 Bacteria 19655
5 JGI25152J39213_1050914 3300002773 Bacteria 540
6 JGI25153J46596_10011436 3300003215 Bacteria 3922
7 rootH1_10040117 3300003316 Bacteria 2024
8 rootH2_10009258 3300003320 Bacteria 6636
9 rootH2_10075751 3300003320 Bacteria 2014
10 rootH2_10148392 3300003320 Bacteria 5085
11 rootL2_10228164 3300003322 Bacteria 1451
12 rootH1_10041130 3300003323 Bacteria 1110
13 rootH1_10121882 3300003323 Bacteria 11580
14 JGI25160J50197_1002465 3300003354 Bacteria 8610
15 Ga0055535_1002560 3300003761 Bacteria 6142
16 Ga0055542_1015957 3300003762 Bacteria 1194
17 Ga0055526_1007155 3300003771 Bacteria 5876
18 Ga0055526_1013227 3300003771 Bacteria 3510
19 Ga0055528_1000314 3300003790 Bacteria 40742
20 Ga0055530_10000619 3300003791 Bacteria 30885
21 Ga0055531_10048271 3300003794 Bacteria 1150
22 Ga0055543_1014328 3300004625 Bacteria 1547
23 Ga0065165_1000182 3300005262 Bacteria 110108
24 Ga0065704_10000195 3300005289 Bacteria 195830
25 Ga0065704_10074748 3300005289 Bacteria 6041
26 Ga0065704_10077797 3300005289 Bacteria 4616
27 Ga0065704_10409115 3300005289 Bacteria 733
28 Ga0065712_10101133 3300005290 Bacteria 2007
29 Ga0065707_10023401 3300005295 Unclassified 1221
30 Ga0070658_10004280 3300005327 Bacteria 11663
31 Ga0070658_10020569 3300005327 Bacteria 5290
32 Ga0070658_10070911 3300005327 Bacteria 2853
33 Ga0070658_10503165 3300005327 Bacteria 1047
34 Ga0070658_11923110 3300005327 Bacteria 511
35 Ga0070676_10000015 3300005328 Bacteria 52703
36 Ga0070676_10025476 3300005328 Bacteria 3343
37 Ga0070676_10180861 3300005328 Bacteria 1371
38 Ga0070670_100070797 3300005331 Bacteria 2994
39 Ga0070670_101463292 3300005331 Bacteria 627
40 Ga0070670_101972507 3300005331 Bacteria 538
41 Ga0070677_10234154 3300005333 Bacteria 904
42 Ga0068869_100079027 3300005334 Bacteria 2451
43 Ga0068869_100079473 3300005334 Bacteria 2444
44 Ga0068869_100132816 3300005334 Bacteria 1915
45 Ga0068869_100312382 3300005334 Bacteria 1272
46 Ga0068869_100434166 3300005334 Bacteria 1086
47 Ga0068869_100820125 3300005334 Bacteria 801
48 Ga0070666_10000042 3300005335 Bacteria 112296
49 Ga0070666_10026174 3300005335 Bacteria 3808
50 Ga0070666_10581194 3300005335 Bacteria 816
51 Ga0070666_11103400 3300005335 Bacteria 590
52 Ga0070680_100003917 3300005336 Bacteria 11128
53 Ga0070680_100035400 3300005336 Bacteria 4030
54 Ga0068868_100012254 3300005338 Bacteria 6263
55 Ga0068868_100060336 3300005338 Bacteria 3003
56 Ga0068868_100120710 3300005338 Bacteria 2138
57 Ga0068868_100367921 3300005338 Bacteria 1235
58 Ga0068868_101268854 3300005338 Bacteria 683
59 Ga0070660_100028681 3300005339 Bacteria 4166
60 Ga0070660_100044533 3300005339 Bacteria 3395
61 Ga0070660_100169934 3300005339 Bacteria 1760
62 Ga0070660_100432358 3300005339 Bacteria 1091
63 Ga0070660_100588345 3300005339 Bacteria 930
64 Ga0070660_101461093 3300005339 Bacteria 581
65 Ga0070689_100747958 3300005340 Bacteria 857
66 Ga0070691_10110364 3300005341 Bacteria 1375
67 Ga0070687_100131270 3300005343 Bacteria 1447
68 Ga0070661_101832669 3300005344 Bacteria 515
69 Ga0070692_10516515 3300005345 Bacteria 777
70 Ga0070669_100029435 3300005353 Bacteria 3958
71 Ga0070675_100208280 3300005354 Bacteria 1699
72 Ga0070675_100709224 3300005354 Bacteria 917
73 Ga0070675_100969052 3300005354 Bacteria 780
74 Ga0070671_100062516 3300005355 Bacteria 3100
75 Ga0070671_100213561 3300005355 Bacteria 1636
76 Ga0070671_101423470 3300005355 Bacteria 613
77 Ga0070674_101515989 3300005356 Bacteria 603
78 Ga0070674_101552583 3300005356 Bacteria 596
79 Ga0070673_100008611 3300005364 Bacteria 6794
80 Ga0070673_100399007 3300005364 Bacteria 1229
81 Ga0070673_100578329 3300005364 Bacteria 1023
82 Ga0070688_100087821 3300005365 Bacteria 2026
83 Ga0070688_100281550 3300005365 Bacteria 1195
84 Ga0070659_100077889 3300005366 Bacteria 2644
85 Ga0070659_100228350 3300005366 Bacteria 1538
86 Ga0070659_100521248 3300005366 Bacteria 1015
87 Ga0070659_100672469 3300005366 Bacteria 894
88 Ga0070667_100287451 3300005367 Bacteria 1478
89 Ga0070667_100502390 3300005367 Bacteria 1112
90 Ga0070667_100636892 3300005367 Bacteria 984
91 Ga0070667_100674097 3300005367 Bacteria 956
92 Ga0070667_100830050 3300005367 Bacteria 859
93 Ga0070667_101093882 3300005367 Bacteria 745
94 Ga0070667_101094853 3300005367 Bacteria 745
95 Ga0070667_102231714 3300005367 Bacteria 516
96 Ga0070714_100946217 3300005435 Bacteria 837
97 Ga0070701_10088579 3300005438 Bacteria 1691
98 Ga0070701_10164206 3300005438 Bacteria 1289
99 Ga0070701_10194353 3300005438 Bacteria 1196
100 Ga0070700_100047956 3300005441 Bacteria 2646
101 Ga0070700_100059909 3300005441 Bacteria 2398
102 Ga0070708_100520848 3300005445 Unclassified 1121
103 Ga0070678_100007585 3300005456 Bacteria 6443
104 Ga0070678_100436965 3300005456 Bacteria 1144
105 Ga0070678_101047122 3300005456 Bacteria 752
106 Ga0070678_101199434 3300005456 Bacteria 704
107 Ga0070662_100000020 3300005457 Bacteria 99425
108 Ga0070662_100127121 3300005457 Bacteria 1961
109 Ga0070681_10066604 3300005458 Bacteria 3570
110 Ga0070681_10178869 3300005458 Bacteria 2043
111 Ga0070681_10329484 3300005458 Bacteria 1436
112 Ga0070681_10789987 3300005458 Bacteria 866
113 Ga0068867_100005742 3300005459 Bacteria 8803
114 Ga0068867_100015064 3300005459 Bacteria 5483
115 Ga0068867_100034465 3300005459 Bacteria 3669
116 Ga0068867_100270581 3300005459 Bacteria 1389
117 Ga0068867_101069628 3300005459 Bacteria 735
118 Ga0068867_102256935 3300005459 Bacteria 517
119 Ga0070685_10375181 3300005466 Bacteria 979
120 Ga0070685_10731758 3300005466 Bacteria 724
121 Ga0070685_11462197 3300005466 Bacteria 526
122 Ga0070698_100000282 3300005471 Bacteria 51827
123 Ga0070698_100045076 3300005471 Bacteria 4514
124 Ga0070698_100075760 3300005471 Bacteria 3368
125 Ga0070679_100121395 3300005530 Bacteria 2598
126 Ga0070679_101000312 3300005530 Bacteria 780
127 Ga0070684_101435525 3300005535 Unclassified 650
128 Ga0070697_100051518 3300005536 Unclassified 3344
129 Ga0068853_100024000 3300005539 Bacteria 5111
130 Ga0068853_100025264 3300005539 Bacteria 4984
131 Ga0068853_100056937 3300005539 Bacteria 3372
132 Ga0068853_100071038 3300005539 Bacteria 3031
133 Ga0068853_100627999 3300005539 Bacteria 1021
134 Ga0068853_100661437 3300005539 Bacteria 995
135 Ga0068853_100935982 3300005539 Bacteria 833
136 Ga0068853_101555170 3300005539 Bacteria 641
137 Ga0068853_101860645 3300005539 Bacteria 584
138 Ga0070672_100218129 3300005543 Bacteria 1599
139 Ga0070672_100379391 3300005543 Bacteria 1209
140 Ga0070672_100511937 3300005543 Bacteria 1039
141 Ga0070672_101942610 3300005543 Bacteria 530
142 Ga0070686_100061045 3300005544 Bacteria 2434
143 Ga0070695_100813774 3300005545 Bacteria 749
144 Ga0070665_100000125 3300005548 Bacteria 146809
145 Ga0070704_100517376 3300005549 Bacteria 1038
146 Ga0068855_100068805 3300005563 Bacteria 4121
147 Ga0068855_100102831 3300005563 Bacteria 3288
148 Ga0068855_100127897 3300005563 Bacteria 2903
149 Ga0068855_100354440 3300005563 Bacteria 1616
150 Ga0068855_100443475 3300005563 Bacteria 1417
151 Ga0068855_100527701 3300005563 Bacteria 1280
152 Ga0068855_100820970 3300005563 Bacteria 987
153 Ga0068855_100840388 3300005563 Bacteria 974
154 Ga0068855_100951509 3300005563 Bacteria 905
155 Ga0068855_101322690 3300005563 Bacteria 745
156 Ga0070664_100001016 3300005564 Bacteria 22026
157 Ga0070664_100723412 3300005564 Bacteria 928
158 Ga0070664_100810250 3300005564 Bacteria 876
159 Ga0070664_101233430 3300005564 Bacteria 706
160 Ga0068857_100507361 3300005577 Bacteria 1132
161 Ga0068857_100517758 3300005577 Bacteria 1121
162 Ga0068857_100822873 3300005577 Bacteria 887
163 Ga0068857_102373572 3300005577 Bacteria 521
164 Ga0068854_100028379 3300005578 Bacteria 3867
165 Ga0068854_100343443 3300005578 Bacteria 1220
166 Ga0068854_100502831 3300005578 Bacteria 1021
167 Ga0068856_100187239 3300005614 Bacteria 2084
168 Ga0068856_101713242 3300005614 Bacteria 641
169 Ga0070702_100010581 3300005615 Bacteria 4551
170 Ga0070702_100310442 3300005615 Bacteria 1095
171 Ga0068852_100002994 3300005616 Bacteria 11740
172 Ga0068852_100078108 3300005616 Bacteria 2928
173 Ga0068852_100558452 3300005616 Bacteria 1146
174 Ga0068852_101208348 3300005616 Bacteria 777
175 Ga0068852_101924310 3300005616 Bacteria 614
176 Ga0068852_102428643 3300005616 Bacteria 545
177 Ga0068859_100000128 3300005617 Bacteria 72119
178 Ga0068859_100000768 3300005617 Bacteria 32376
179 Ga0068859_100118149 3300005617 Bacteria 2717
180 Ga0068859_100162120 3300005617 Bacteria 2315
181 Ga0068859_100340743 3300005617 Bacteria 1593
182 Ga0068859_100353678 3300005617 Bacteria 1564
183 Ga0068859_101191439 3300005617 Bacteria 839
184 Ga0068864_100026441 3300005618 Bacteria 4894
185 Ga0068864_100079795 3300005618 Bacteria 2866
186 Ga0068864_100366918 3300005618 Bacteria 1362
187 Ga0068866_10036252 3300005718 Bacteria 2415
188 Ga0068861_100453396 3300005719 Bacteria 1150
189 Ga0068861_100483931 3300005719 Bacteria 1115
190 Ga0068861_100829985 3300005719 Bacteria 870
191 Ga0068861_101316228 3300005719 Bacteria 703
192 Ga0068870_10085772 3300005840 Bacteria 1751
193 Ga0068870_10110453 3300005840 Bacteria 1569
194 Ga0068870_10828419 3300005840 Unclassified 649
195 Ga0068863_100016956 3300005841 Bacteria 6986
196 Ga0068863_100194564 3300005841 Bacteria 1949
197 Ga0068863_100654900 3300005841 Bacteria 1042
198 Ga0068858_100057422 3300005842 Bacteria 3597
199 Ga0068858_100162391 3300005842 Bacteria 2103
200 Ga0068858_100520777 3300005842 Bacteria 1150
201 Ga0068858_101200109 3300005842 Bacteria 746
202 Ga0068858_102029529 3300005842 Bacteria 569
203 Ga0068860_100000059 3300005843 Bacteria 196400
204 Ga0068860_100009276 3300005843 Bacteria 9780
205 Ga0068860_100181649 3300005843 Bacteria 2033
206 Ga0068860_100472368 3300005843 Bacteria 1249
207 Ga0068860_101496403 3300005843 Bacteria 697
208 Ga0068860_102529530 3300005843 Bacteria 533
209 Ga0068862_100009951 3300005844 Bacteria 7855
210 Ga0068862_101404166 3300005844 Unclassified 701
211 Ga0068862_101901888 3300005844 Bacteria 605
212 Ga0068862_102080960 3300005844 Bacteria 579
213 Ga0081539_10144985 3300005985 Bacteria 1149
214 Ga0075366_10233851 3300006195 Bacteria 1120
215 Ga0075366_10382866 3300006195 Bacteria 865
216 Ga0097621_100000714 3300006237 Bacteria 23301
217 Ga0097621_100016633 3300006237 Bacteria 5565
218 Ga0097621_100426646 3300006237 Bacteria 1191
219 Ga0097621_102401101 3300006237 Bacteria 504
220 Ga0068871_100000046 3300006358 Bacteria 66964
221 Ga0068871_100032967 3300006358 Bacteria 4096
222 Ga0068871_100083877 3300006358 Bacteria 2643
223 Ga0068871_100674003 3300006358 Bacteria 946
224 Ga0068871_102233885 3300006358 Unclassified 521
225 Ga0068865_100000041 3300006881 Bacteria 72569
226 Ga0068865_100016853 3300006881 Bacteria 4686
227 Ga0097620_100000128 3300006931 Bacteria 72119
228 Ga0097620_100000768 3300006931 Bacteria 32376
229 Ga0097620_100118146 3300006931 Bacteria 2717
230 Ga0097620_100162125 3300006931 Bacteria 2315
231 Ga0097620_100353680 3300006931 Bacteria 1564
232 Ga0097620_101191459 3300006931 Bacteria 839
233 Ga0105250_10578428 3300009092 Bacteria 518
234 Ga0105240_10000692 3300009093 Bacteria 61955
235 Ga0105240_10091827 3300009093 Bacteria 3708
236 Ga0105240_10142389 3300009093 Bacteria 2865
237 Ga0105240_10151322 3300009093 Bacteria 2763
238 Ga0105240_10228824 3300009093 Bacteria 2162
239 Ga0105240_10275776 3300009093 Bacteria 1934
240 Ga0105240_10377563 3300009093 Bacteria 1601
241 Ga0105240_11192892 3300009093 Bacteria 806
242 Ga0105245_12352170 3300009098 Bacteria 586
243 Ga0105245_12489654 3300009098 Bacteria 571
244 Ga0105247_10012983 3300009101 Bacteria 4995
245 Ga0105243_10833104 3300009148 Bacteria 912
246 Ga0105241_10000217 3300009174 Bacteria 43160
247 Ga0105241_10000853 3300009174 Bacteria 23134
248 Ga0105241_10014129 3300009174 Bacteria 5850
249 Ga0105241_10230152 3300009174 Bacteria 1562
250 Ga0105241_10704680 3300009174 Unclassified 922
251 Ga0105241_11081115 3300009174 Bacteria 754
252 Ga0105242_10012349 3300009176 Bacteria 6573
253 Ga0105242_10860977 3300009176 Unclassified 903
254 Ga0105248_10018721 3300009177 Bacteria 7656
255 Ga0105248_13043361 3300009177 Bacteria 534
256 Ga0105248_13390872 3300009177 Bacteria 506
257 Ga0105237_10001818 3300009545 Bacteria 27514
258 Ga0105237_10005378 3300009545 Bacteria 14473
259 Ga0105237_10022652 3300009545 Bacteria 6443
260 Ga0105237_10064143 3300009545 Bacteria 3670
261 Ga0105237_10100775 3300009545 Bacteria 2880
262 Ga0105237_10100974 3300009545 Bacteria 2877
263 Ga0105237_10174509 3300009545 Bacteria 2150
264 Ga0105237_11804019 3300009545 Bacteria 619
265 Ga0105237_12764956 3300009545 Bacteria 502
266 Ga0105238_10002068 3300009551 Bacteria 20258
267 Ga0105238_10049554 3300009551 Unclassified 4228
268 Ga0105249_10001650 3300009553 Bacteria 19547
269 Ga0105249_10004971 3300009553 Bacteria 11467
270 Ga0105249_10127295 3300009553 Bacteria 2427
271 Ga0105249_10354681 3300009553 Bacteria 1487
272 Ga0105239_10003770 3300010375 Bacteria 18441
273 Ga0105239_10004595 3300010375 Bacteria 16444
274 Ga0105239_10014883 3300010375 Bacteria 8624
275 Ga0105239_10020326 3300010375 Bacteria 7324
276 Ga0105239_10131045 3300010375 Bacteria 2789
277 Ga0105239_10230797 3300010375 Bacteria 2076
278 Ga0105239_10323232 3300010375 Bacteria 1740
279 Ga0105239_10368999 3300010375 Bacteria 1622
280 Ga0105239_10369001 3300010375 Bacteria 1622
281 Ga0105239_10863001 3300010375 Bacteria 1038
282 Ga0105239_10878842 3300010375 Bacteria 1028
283 Ga0105239_12443028 3300010375 Unclassified 609
284 Ga0105246_10030380 3300011119 Bacteria 3568
285 Ga0157318_1010462 3300012482 Bacteria 687
286 Ga0157373_10018201 3300013100 Bacteria 5116
287 Ga0157373_10115049 3300013100 Bacteria 1891
288 Ga0157373_10451993 3300013100 Bacteria 925
289 Ga0157373_10734773 3300013100 Bacteria 725
290 Ga0157371_10001084 3300013102 Bacteria 29465
291 Ga0157371_10005892 3300013102 Bacteria 10236
292 Ga0157371_10117844 3300013102 Bacteria 1887
293 Ga0157371_10200008 3300013102 Bacteria 1432
294 Ga0157371_10226730 3300013102 Bacteria 1342
295 Ga0157371_10655107 3300013102 Bacteria 784
296 Ga0157370_10004729 3300013104 Bacteria 15520
297 Ga0157370_10005230 3300013104 Bacteria 14608
298 Ga0157370_10007942 3300013104 Bacteria 11492
299 Ga0157370_10741662 3300013104 Bacteria 895
300 Ga0157370_10856618 3300013104 Bacteria 826
301 Ga0157370_11746082 3300013104 Bacteria 558
302 Ga0157369_10710310 3300013105 Bacteria 1035
303 Ga0157374_10024480 3300013296 Bacteria 5414
304 Ga0157374_10120999 3300013296 Bacteria 2526
305 Ga0157374_10180122 3300013296 Bacteria 2064
306 Ga0157374_10361113 3300013296 Bacteria 1444
307 Ga0157374_10411884 3300013296 Bacteria 1349
308 Ga0157374_10764166 3300013296 Bacteria 981
309 Ga0157374_11519916 3300013296 Bacteria 693
310 Ga0157378_10002500 3300013297 Bacteria 16359
311 Ga0157378_10010592 3300013297 Bacteria 8058
312 Ga0157378_10039612 3300013297 Bacteria 4180
313 Ga0157378_10100133 3300013297 Bacteria 2645
314 Ga0157378_10192612 3300013297 Bacteria 1924
315 Ga0157378_10271550 3300013297 Bacteria 1631
316 Ga0157378_10438265 3300013297 Bacteria 1294
317 Ga0157378_10522041 3300013297 Bacteria 1189
318 Ga0157378_11064786 3300013297 Bacteria 845
319 Ga0157378_12967902 3300013297 Bacteria 526
320 Ga0163162_10000005 3300013306 Bacteria 447195
321 Ga0163162_10004176 3300013306 Bacteria 13879
322 Ga0163162_10025120 3300013306 Bacteria 5888
323 Ga0163162_10118800 3300013306 Bacteria 2746
324 Ga0163162_10162723 3300013306 Bacteria 2354
325 Ga0163162_10790887 3300013306 Bacteria 1066
326 Ga0163162_11089836 3300013306 Bacteria 905
327 Ga0163162_12934557 3300013306 Bacteria 548
328 Ga0157372_10067142 3300013307 Bacteria 4030
329 Ga0157372_10147956 3300013307 Bacteria 2709
330 Ga0157372_10279148 3300013307 Bacteria 1942
331 Ga0157372_10357598 3300013307 Bacteria 1701
332 Ga0157372_10946520 3300013307 Bacteria 998
333 Ga0157372_11516755 3300013307 Bacteria 772
334 Ga0157372_11860707 3300013307 Bacteria 692
335 Ga0157375_10056217 3300013308 Bacteria 3884
336 Ga0157375_10076765 3300013308 Bacteria 3369
337 Ga0157375_10136908 3300013308 Bacteria 2574
338 Ga0157375_10190225 3300013308 Bacteria 2207
339 Ga0157375_10327155 3300013308 Bacteria 1698
340 Ga0157375_10639859 3300013308 Bacteria 1220
341 Ga0157375_12856259 3300013308 Bacteria 577
342 Ga0157375_13298652 3300013308 Bacteria 538
343 Ga0163163_10044636 3300014325 Bacteria 4349
344 Ga0163163_10209269 3300014325 Bacteria 1999
345 Ga0163163_10522091 3300014325 Bacteria 1250
346 Ga0163163_10933780 3300014325 Bacteria 931
347 Ga0163163_11027084 3300014325 Bacteria 888
348 Ga0157380_10760117 3300014326 Bacteria 982
349 Ga0157380_12632947 3300014326 Bacteria 569
350 Ga0182008_10000108 3300014497 Bacteria 63463
351 Ga0157377_10002130 3300014745 Bacteria 8706
352 Ga0157377_10013404 3300014745 Bacteria 4148
353 Ga0157377_10107275 3300014745 Bacteria 1674
354 Ga0157377_10456364 3300014745 Bacteria 883
355 Ga0157379_10927927 3300014968 Bacteria 827
356 Ga0157379_12485608 3300014968 Bacteria 518
357 Ga0157376_10328573 3300014969 Bacteria 1456
358 Ga0157376_10386112 3300014969 Bacteria 1350
359 Ga0157376_11477504 3300014969 Bacteria 712
360 Ga0157376_12559847 3300014969 Bacteria 550
361 Ga0182006_1000109 3300015261 Bacteria 89541
362 Ga0182007_10037805 3300015262 Bacteria 1620
363 Ga0163161_10001003 3300017792 Bacteria 21495
364 Ga0163161_10036486 3300017792 Bacteria 3520
365 Ga0163161_10168620 3300017792 Bacteria 1673
366 Ga0163161_10203301 3300017792 Bacteria 1527
367 Ga0163161_10463349 3300017792 Bacteria 1026
368 Ga0163161_12065873 3300017792 Bacteria 507
369 Ga0213872_10029500 3300021361 Bacteria 2515
370 Ga0213876_10000722 3300021384 Bacteria 23019
371 Ga0209437_100528 3300025233 Bacteria 26547
372 Ga0209258_100029 3300025242 Bacteria 490648
373 Ga0209646_1016800 3300025246 Bacteria 1083
374 Ga0209026_1000890 3300025250 Bacteria 15461
375 Ga0209148_1000163 3300025254 Bacteria 137449
376 Ga0209129_1009318 3300025258 Bacteria 2605
377 Ga0209455_1003239 3300025272 Bacteria 5870
378 Ga0209673_1000016 3300025273 Bacteria 506202
379 Ga0209564_1005465 3300025295 Bacteria 7244
380 Ga0209758_1006613 3300025297 Bacteria 8214
381 Ga0209050_1000124 3300025298 Bacteria 194022
382 Ga0207426_1000157 3300025302 Bacteria 178442
383 Ga0207426_1000925 3300025302 Bacteria 29342
384 Ga0209051_1023842 3300025303 Bacteria 2534
385 Ga0209257_1001535 3300025304 Bacteria 26927
386 Ga0207697_10354971 3300025315 Bacteria 651
387 Ga0207682_10349708 3300025893 Unclassified 696
388 Ga0207682_10399046 3300025893 Bacteria 650
389 Ga0207642_10019317 3300025899 Bacteria 2637
390 Ga0207642_10289659 3300025899 Bacteria 945
391 Ga0207710_10043471 3300025900 Bacteria 1998
392 Ga0207688_10005502 3300025901 Bacteria 6888
393 Ga0207688_10747440 3300025901 Bacteria 619
394 Ga0207680_10000448 3300025903 Bacteria 19470
395 Ga0207647_10000117 3300025904 Bacteria 61849
396 Ga0207647_10045721 3300025904 Bacteria 2730
397 Ga0207647_10086213 3300025904 Archaea 1877
398 Ga0207647_10158900 3300025904 Bacteria 1319
399 Ga0207685_10314334 3300025905 Bacteria 779
400 Ga0207645_10009683 3300025907 Bacteria 6656
401 Ga0207645_10013933 3300025907 Bacteria 5392
402 Ga0207645_10088067 3300025907 Bacteria 1995
403 Ga0207643_10045067 3300025908 Bacteria 2490
404 Ga0207643_10138292 3300025908 Bacteria 1453
405 Ga0207705_10000623 3300025909 Bacteria 29594
406 Ga0207705_10078920 3300025909 Bacteria 2397
407 Ga0207705_10085635 3300025909 Bacteria 2302
408 Ga0207705_10179389 3300025909 Bacteria 1598
409 Ga0207705_11286318 3300025909 Bacteria 559
410 Ga0207654_10000524 3300025911 Bacteria 21970
411 Ga0207654_10008858 3300025911 Bacteria 5104
412 Ga0207654_10011575 3300025911 Bacteria 4502
413 Ga0207707_10343059 3300025912 Bacteria 1288
414 Ga0207707_11427569 3300025912 Bacteria 551
415 Ga0207695_10000020 3300025913 Bacteria 723025
416 Ga0207695_10008260 3300025913 Bacteria 13066
417 Ga0207695_10048139 3300025913 Bacteria 4505
418 Ga0207695_10068845 3300025913 Bacteria 3625
419 Ga0207695_10895876 3300025913 Bacteria 767
420 Ga0207671_10002893 3300025914 Bacteria 17762
421 Ga0207671_10005501 3300025914 Bacteria 11657
422 Ga0207671_10008195 3300025914 Bacteria 8906
423 Ga0207671_10022597 3300025914 Bacteria 4752
424 Ga0207671_10027556 3300025914 Bacteria 4248
425 Ga0207671_10119370 3300025914 Bacteria 2014
426 Ga0207671_10132417 3300025914 Bacteria 1915
427 Ga0207671_10244524 3300025914 Bacteria 1410
428 Ga0207671_11239614 3300025914 Bacteria 582
429 Ga0207663_10540253 3300025916 Bacteria 910
430 Ga0207660_10035604 3300025917 Bacteria 3457
431 Ga0207660_10367560 3300025917 Bacteria 1155
432 Ga0207662_10035006 3300025918 Bacteria 2932
433 Ga0207662_10041489 3300025918 Bacteria 2709
434 Ga0207657_10012327 3300025919 Bacteria 8448
435 Ga0207657_10268913 3300025919 Bacteria 1355
436 Ga0207657_10535440 3300025919 Bacteria 916
437 Ga0207657_10800976 3300025919 Bacteria 728
438 Ga0207657_10912900 3300025919 Bacteria 676
439 Ga0207652_11877545 3300025921 Bacteria 504
440 Ga0207646_10120519 3300025922 Bacteria 2357
441 Ga0207646_11096909 3300025922 Bacteria 701
442 Ga0207681_10367529 3300025923 Bacteria 1155
443 Ga0207681_10585725 3300025923 Bacteria 921
444 Ga0207681_11587396 3300025923 Bacteria 548
445 Ga0207694_10035339 3300025924 Bacteria 3833
446 Ga0207694_10072542 3300025924 Bacteria 2692
447 Ga0207659_10239400 3300025926 Bacteria 1467
448 Ga0207659_10534496 3300025926 Bacteria 995
449 Ga0207687_11720539 3300025927 Bacteria 537
450 Ga0207664_10954863 3300025929 Bacteria 769
451 Ga0207644_10072589 3300025931 Bacteria 2521
452 Ga0207644_10186173 3300025931 Bacteria 1630
453 Ga0207644_10600633 3300025931 Bacteria 914
454 Ga0207690_10220436 3300025932 Bacteria 1451
455 Ga0207690_10320013 3300025932 Bacteria 1219
456 Ga0207690_10401022 3300025932 Bacteria 1094
457 Ga0207690_10619021 3300025932 Bacteria 885
458 Ga0207706_10000044 3300025933 Bacteria 123576
459 Ga0207706_10020437 3300025933 Bacteria 5953
460 Ga0207686_10082882 3300025934 Bacteria 2098
461 Ga0207686_10309192 3300025934 Bacteria 1176
462 Ga0207709_10205784 3300025935 Bacteria 1409
463 Ga0207670_11886993 3300025936 Bacteria 508
464 Ga0207669_10354074 3300025937 Unclassified 1135
465 Ga0207669_11404192 3300025937 Bacteria 594
466 Ga0207704_10000061 3300025938 Bacteria 76480
467 Ga0207704_10359608 3300025938 Bacteria 1136
468 Ga0207665_10693511 3300025939 Bacteria 800
469 Ga0207691_10007611 3300025940 Bacteria 10425
470 Ga0207691_10009816 3300025940 Bacteria 9191
471 Ga0207691_10195375 3300025940 Bacteria 1763
472 Ga0207691_10240574 3300025940 Bacteria 1565
473 Ga0207711_10058541 3300025941 Plasmid 3316
474 Ga0207711_11112052 3300025941 Bacteria 731
475 Ga0207711_11791947 3300025941 Unclassified 557
476 Ga0207689_10064946 3300025942 Bacteria 3002
477 Ga0207689_10095465 3300025942 Bacteria 2442
478 Ga0207689_10164130 3300025942 Bacteria 1830
479 Ga0207689_10350892 3300025942 Bacteria 1226
480 Ga0207689_10356690 3300025942 Bacteria 1216
481 Ga0207661_10656543 3300025944 Bacteria 964
482 Ga0207679_10267921 3300025945 Bacteria 1459
483 Ga0207679_10670249 3300025945 Bacteria 939
484 Ga0207679_11258831 3300025945 Bacteria 679
485 Ga0207667_10081641 3300025949 Bacteria 3349
486 Ga0207667_10129790 3300025949 Bacteria 2596
487 Ga0207667_10187634 3300025949 Bacteria 2122
488 Ga0207667_10798120 3300025949 Bacteria 941
489 Ga0207667_11339039 3300025949 Bacteria 691
490 Ga0207651_10004446 3300025960 Bacteria 7068
491 Ga0207651_10689755 3300025960 Bacteria 899
492 Ga0207712_10065033 3300025961 Bacteria 2602
493 Ga0207712_10114889 3300025961 Bacteria 2025
494 Ga0207712_10170480 3300025961 Bacteria 1701
495 Ga0207712_10196649 3300025961 Bacteria 1595
496 Ga0207712_10449328 3300025961 Bacteria 1093
497 Ga0207712_12000853 3300025961 Bacteria 519
498 Ga0207668_11703580 3300025972 Bacteria 569
499 Ga0207668_11836933 3300025972 Bacteria 547
500 Ga0207668_11994339 3300025972 Bacteria 523
501 Ga0207640_10072546 3300025981 Bacteria 2323
502 Ga0207640_10628518 3300025981 Bacteria 912
503 Ga0207658_10067979 3300025986 Bacteria 2686
504 Ga0207658_10137113 3300025986 Bacteria 1975
505 Ga0207658_10154262 3300025986 Bacteria 1875
506 Ga0207658_10303417 3300025986 Bacteria 1376
507 Ga0207658_10390442 3300025986 Bacteria 1221
508 Ga0207658_11345465 3300025986 Bacteria 653
509 Ga0207658_11621991 3300025986 Bacteria 591
510 Ga0207658_11873631 3300025986 Bacteria 547
511 Ga0207677_10037202 3300026023 Bacteria 3179
512 Ga0207677_10057504 3300026023 Bacteria 2671
513 Ga0207677_10077911 3300026023 Bacteria 2365
514 Ga0207677_10553218 3300026023 Bacteria 1003
515 Ga0207677_11779838 3300026023 Bacteria 572
516 Ga0207703_10006254 3300026035 Bacteria 9523
517 Ga0207703_10331355 3300026035 Bacteria 1396
518 Ga0207703_10484819 3300026035 Bacteria 1159
519 Ga0207703_10786046 3300026035 Bacteria 908
520 Ga0207703_10926305 3300026035 Bacteria 835
521 Ga0207703_11666769 3300026035 Bacteria 613
522 Ga0207703_11719022 3300026035 Bacteria 603
523 Ga0207703_11837569 3300026035 Bacteria 582
524 Ga0207703_12207335 3300026035 Bacteria 526
525 Ga0207639_10010963 3300026041 Bacteria 6282
526 Ga0207639_10012012 3300026041 Bacteria 6025
527 Ga0207639_10115885 3300026041 Bacteria 2192
528 Ga0207639_10130457 3300026041 Bacteria 2080
529 Ga0207639_10166030 3300026041 Bacteria 1865
530 Ga0207639_10329602 3300026041 Bacteria 1358
531 Ga0207639_10331843 3300026041 Bacteria 1354
532 Ga0207678_10201899 3300026067 Unclassified 1700
533 Ga0207678_11809054 3300026067 Bacteria 535
534 Ga0207708_10017604 3300026075 Bacteria 5380
535 Ga0207708_10079070 3300026075 Bacteria 2526
536 Ga0207708_11173679 3300026075 Bacteria 671
537 Ga0207708_11552873 3300026075 Bacteria 582
538 Ga0207708_11909248 3300026075 Bacteria 520
539 Ga0207702_11095342 3300026078 Bacteria 790
540 Ga0207702_12052422 3300026078 Bacteria 562
541 Ga0207641_10005736 3300026088 Bacteria 10545
542 Ga0207641_10233935 3300026088 Bacteria 1709
543 Ga0207641_10541959 3300026088 Bacteria 1134
544 Ga0207641_12612183 3300026088 Bacteria 503
545 Ga0207648_10002338 3300026089 Bacteria 20455
546 Ga0207648_10052614 3300026089 Bacteria 3561
547 Ga0207648_10286460 3300026089 Bacteria 1474
548 Ga0207648_11950885 3300026089 Bacteria 548
549 Ga0207676_10004483 3300026095 Bacteria 9870
550 Ga0207676_10352943 3300026095 Bacteria 1360
551 Ga0207676_11291134 3300026095 Bacteria 725
552 Ga0207674_10023607 3300026116 Bacteria 6584
553 Ga0207674_10156717 3300026116 Bacteria 2232
554 Ga0207674_10353023 3300026116 Bacteria 1422
555 Ga0207674_10497460 3300026116 Bacteria 1178
556 Ga0207674_11042722 3300026116 Bacteria 787
557 Ga0207675_100339515 3300026118 Bacteria 1470
558 Ga0207675_100937586 3300026118 Bacteria 883
559 Ga0207675_101417037 3300026118 Bacteria 715
560 Ga0207675_101789605 3300026118 Bacteria 634
561 Ga0207683_10031283 3300026121 Bacteria 4619
562 Ga0207683_10215435 3300026121 Bacteria 1749
563 Ga0207683_10240671 3300026121 Bacteria 1651
564 Ga0207683_10613569 3300026121 Bacteria 1007
565 Ga0207698_10121920 3300026142 Bacteria 2208
566 Ga0207698_10728534 3300026142 Bacteria 989
567 Ga0207698_10820847 3300026142 Bacteria 933
568 Ga0207698_10834298 3300026142 Bacteria 926
569 Ga0207698_10910885 3300026142 Bacteria 887
570 Ga0207698_12099353 3300026142 Bacteria 579
571 Ga0268266_10000132 3300028379 Bacteria 145563
572 Ga0268266_10637558 3300028379 Bacteria 1025
573 Ga0268265_10013493 3300028380 Bacteria 5553
574 Ga0268265_10286163 3300028380 Bacteria 1477
575 Ga0268265_11442638 3300028380 Bacteria 691
576 Ga0268264_10000015 3300028381 Bacteria 508501
577 Ga0268264_10383701 3300028381 Bacteria 1346
578 Ga0268264_10601952 3300028381 Bacteria 1083
579 Ga0268264_10945203 3300028381 Bacteria 867
580 Ga0268264_11342442 3300028381 Bacteria 725
581 Ga0265334_10159572 3300028573 Bacteria 793
582 Ga0265323_10000512 3300028653 Bacteria 21698
583 Ga0307517_10007381 3300028786 Bacteria 16035
584 Ga0307515_10000061 3300028794 Bacteria 251841
585 Ga0307515_10064321 3300028794 Bacteria 5130
586 Ga0307515_10629754 3300028794 Bacteria 684
587 Ga0265338_10084234 3300028800 Bacteria 2655
588 Ga0265338_10517135 3300028800 Unclassified 839
589 Ga0316181_1087376 3300030744 Bacteria 1152
590 Ga0265330_10104767 3300031235 Bacteria 1210
591 Ga0265327_10000055 3300031251 Bacteria 247188
592 Ga0265327_10064368 3300031251 Bacteria 1858
593 Ga0265327_10070414 3300031251 Bacteria 1753
594 Ga0265316_10001184 3300031344 Bacteria 28228
595 Ga0307509_10178754 3300031507 Bacteria 1991
596 Ga0307509_10228133 3300031507 Bacteria 1668
597 Ga0307509_10420174 3300031507 Bacteria 1038
598 Ga0307509_10492518 3300031507 Bacteria 912
599 Ga0307514_10433042 3300031649 Bacteria 655
600 Ga0265314_10046768 3300031711 Bacteria 3051
601 Ga0307410_11479517 3300031852 Bacteria 598
602 Ga0307406_10038111 3300031901 Bacteria 2974
603 Ga0307406_10611011 3300031901 Bacteria 900
604 Ga0307412_11208901 3300031911 Bacteria 677
605 Ga0307412_12098833 3300031911 Bacteria 525
606 Ga0307409_101429972 3300031995 Bacteria 718
607 Ga0307416_100224981 3300032002 Bacteria 1803
608 Ga0307416_101593428 3300032002 Bacteria 758
609 Ga0307414_10084723 3300032004 Bacteria 2332
610 Ga0307414_10286507 3300032004 Bacteria 1387
611 Ga0307411_11966865 3300032005 Bacteria 545
612 Ga0307510_10013796 3300033180 Bacteria 9579
613 Ga0373936_0230431 3300035113 Bacteria 824
614 Ga0373939_0215478 3300035114 Bacteria 733
615 Ga0373941_0232872 3300035115 Bacteria 712
616 Ga0373942_0025117 3300035207 Bacteria 1533
617 Ga0395899_0000021 3300037312 Bacteria 391702
618 Ga0395899_0009228 3300037312 Bacteria 7576
619 Ga0395899_0026616 3300037312 Bacteria 4364
620 Ga0395899_0115190 3300037312 Bacteria 1929
621 Ga0395900_0000494 3300037418 Bacteria 55588
622 Ga0395900_0003517 3300037418 Bacteria 16914
623 Ga0395900_0004982 3300037418 Bacteria 13961
624 Ga0395900_0279390 3300037418 Bacteria 1662
625 Ga0395898_0004102 3300037466 Bacteria 15974
626 Ga0395898_0080656 3300037466 Bacteria 3138
627 Ga0395905_0000757 3300037471 Bacteria 42574
628 Ga0395905_0004960 3300037471 Bacteria 13717
629 Ga0395905_0017163 3300037471 Bacteria 6876
630 Ga0395905_0030285 3300037471 Bacteria 5100
631 Ga0395905_0485689 3300037471 Bacteria 1135
632 Ga0395901_0002107 3300038443 Bacteria 20401
633 Ga0395901_0003012 3300038443 Bacteria 16991
634 Ga0395901_0021304 3300038443 Bacteria 6639
635 Ga0395901_0054362 3300038443 Bacteria 4161
636 Ga0436365_1664331 3300039437 Bacteria 31697
637 Ga0436361_0635236 3300039447 Bacteria 6435
638 Ga0439439_0214470 3300041406 Bacteria 563
639 Ga0439466_0139579 3300041411 Bacteria 744
640 Ga0451793_0462005 3300041452 Bacteria 611
641 Ga0451802_1188741 3300041460 Bacteria 575
642 Ga0451804_0543671 3300041463 Bacteria 605
643 Ga0451807_1973634 3300041486 Bacteria 555
644 Ga0451833_0971787 3300041491 Bacteria 683
645 Ga0451837_0256521 3300041494 Bacteria 523
646 Ga0451841_1049833 3300041498 Bacteria 505
647 Ga0451845_0572086 3300041501 Bacteria 569
648 Ga0451851_0947342 3300041507 Bacteria 671
649 Ga0451851_1259567 3300041507 Bacteria 618
650 Ga0451853_0174956 3300041512 Bacteria 1073
651 Ga0439442_026011 3300042002 Bacteria 1218
652 Ga0439432_128270 3300042006 Bacteria 749
653 Ga0439449_0126557 3300042007 Bacteria 949
654 Ga0439457_044691 3300042014 Bacteria 989
655 Ga0450897_050347 3300042128 Bacteria 502
656 Ga0450898_005402 3300042134 Bacteria 1930
657 Ga0450899_009235 3300042135 Bacteria 1085
658 Ga0451577_0023194 3300042876 Bacteria 5662
659 Ga0451577_0027814 3300042876 Bacteria 5118
660 Ga0451577_0202605 3300042876 Bacteria 1791
661 Ga0466972_0301302 3300044658 Bacteria 749
662 Ga0466972_0554611 3300044658 Bacteria 542
663 Ga0453684_0002051 3300044712 Bacteria 51267
664 Ga0453684_0055025 3300044712 Bacteria 5176
665 Ga0453684_0517563 3300044712 Bacteria 1319
666 Ga0466970_0128696 3300044765 Bacteria 1390
667 Ga0466959_0018495 3300045049 Bacteria 5117
668 Ga0466959_0077269 3300045049 Bacteria 2403
669 Ga0466959_0288998 3300045049 Bacteria 1124
670 Ga0451576_0015476 3300045051 Bacteria 8449
671 Ga0451576_0189687 3300045051 Bacteria 2147
672 Ga0451576_1787248 3300045051 Bacteria 636
673 Ga0451576_2609771 3300045051 Bacteria 515
674 Ga0466958_0386462 3300045836 Bacteria 903
675 Ga0495638_0000008 3300046460 Bacteria 565643
676 Ga0495638_0414301 3300046460 Bacteria 696
677 Ga0495651_0468027 3300046462 Bacteria 812
678 Ga0495650_0019537 3300046471 Bacteria 3330
679 Ga0495606_0058371 3300046507 Bacteria 2480
680 Ga0495606_0482368 3300046507 Bacteria 629
681 Ga0495618_0850045 3300046514 Bacteria 529
682 Ga0495644_0096453 3300046523 Bacteria 1117
683 Ga0495652_0901129 3300046529 Bacteria 583
684 Ga0495622_0211461 3300046557 Bacteria 862
685 Ga0495668_0001373 3300046616 Bacteria 23852
686 Ga0495634_0502991 3300046642 Bacteria 710
687 Ga0495611_0120339 3300046648 Bacteria 1224
688 Ga0495625_0118844 3300046660 Bacteria 1801
689 Ga0495661_0612527 3300046665 Bacteria 511
690 Ga0495658_0945769 3300046683 Bacteria 551
691 Ga0495581_0903691 3300047315 Bacteria 504
692 Ga0495674_1254327 3300047319 Bacteria 558
693 Ga0495672_0008239 3300047320 Bacteria 7726
694 Ga0495685_090765 3300047447 Bacteria 1013
695 Ga0495686_0001370 3300047472 Bacteria 27175
696 Ga0496108_0707060 3300048911 Bacteria 874
697 Ga0496115_0926906 3300048918 Bacteria 670
698 Ga0496122_0006972 3300048925 Bacteria 12720
699 Ga0496123_0028687 3300048926 Bacteria 4113
700 Ga0496125_0028469 3300048928 Bacteria 5046
701 Ga0501034_0138376 3300049571 Bacteria 2415
702 Ga0501038_0090718 3300049574 Bacteria 2561
703 Ga0501039_0375002 3300049575 Bacteria 1118
704 Ga0501043_0311516 3300049579 Bacteria 1201
705 Ga0501073_0820270 3300049589 Bacteria 641
706 Ga0501198_105283 3300049649 Bacteria 577
707 Ga0501214_042452 3300049659 Bacteria 666
708 Ga0501217_164696 3300049661 Bacteria 671
709 Ga0501223_028400 3300049663 Bacteria 1089
710 Ga0501224_042369 3300049664 Bacteria 689
711 Ga0501233_148642 3300049668 Bacteria 652
712 Ga0501238_033146 3300049671 Bacteria 750
713 Ga0501250_060581 3300049680 Bacteria 603
714 Ga0501257_022697 3300049686 Bacteria 1486
715 Ga0501221_128947 3300049704 Bacteria 653
716 Ga0501234_052612 3300049707 Bacteria 680
717 Ga0501044_0205041 3300049823 Bacteria 1929
718 nmdc:mga0k408_116299_c1 3300050493 Bacteria 1582
719 nmdc:mga07m45_168367_c1 3300050496 Bacteria 1273
720 nmdc:mga08y16_945191_c1 3300050511 Bacteria 845
721 nmdc:mga08y16_97154_c1 3300050511 Bacteria 3067
722 Ga0500635_0000568 3300053080 Bacteria 9856
723 Ga0500578_0000024 3300053086 Bacteria 151503
724 Ga0500578_0295929 3300053086 Bacteria 961
725 Ga0500644_0000169 3300053088 Bacteria 41659
726 Ga0500644_0084978 3300053088 Bacteria 1172
727 Ga0500581_213282 3300053089 Bacteria 845
728 Ga0500581_237668 3300053089 Bacteria 776
729 Ga0500647_0179297 3300053091 Bacteria 973
730 Ga0500583_0506470 3300053092 Bacteria 566
731 Ga0500650_0176658 3300053098 Bacteria 980
732 Ga0500562_000078 3300053108 Bacteria 44915
733 Ga0500592_068298 3300053116 Bacteria 585
734 Ga0500607_025589 3300053121 Bacteria 3283
735 Ga0500608_095814 3300053122 Bacteria 1381
736 Ga0500618_000004 3300053125 Bacteria 293180
737 Ga0500642_0146371 3300053130 Bacteria 1109
738 Ga0500568_0028977 3300053139 Bacteria 2303
739 Ga0500568_0240949 3300053139 Bacteria 659
740 Ga0500577_0046752 3300053142 Bacteria 1605
741 Ga0500590_092581 3300053148 Bacteria 1465
742 Ga0500616_0000003 3300053153 Bacteria 1220687
743 Ga0500616_0004260 3300053153 Bacteria 10285
744 Ga0500616_0012071 3300053153 Bacteria 5070
745 Ga0500616_0102737 3300053153 Bacteria 1394
746 Ga0500616_0146391 3300053153 Bacteria 1098
747 Ga0500616_0219205 3300053153 Bacteria 831
748 Ga0500622_0000870 3300053156 Bacteria 25713
749 Ga0500622_0001076 3300053156 Bacteria 22701
750 Ga0500622_0243796 3300053156 Bacteria 792
751 Ga0500633_0003460 3300053160 Bacteria 3451
752 Ga0500634_0050744 3300053161 Bacteria 2234
753 Ga0500645_020997 3300053730 Bacteria 2017
754 Ga0500645_143683 3300053730 Bacteria 659
755 Ga0500552_034013 3300053733 Bacteria 800
756 Ga0466962_0058515 3300061719 Unclassified 1839
757 2898715615 2898713307 Bacteria 4110805
758 2910249359 2910245624 Bacteria 6935613
759 2919438741 2919437846 Bacteria 6199444
760 Ga0068858_100621735
761 SwRhRL2b_contig_1761633
762 JGI24743J22301_10037794
763 JGI25162J39368_1000881
764 JGI25152J39213_1050914
765 JGI25153J46596_10011436
766 rootH1_10040117
767 rootH2_10009258
768 rootH2_10075751
769 rootH2_10148392
770 rootL2_10228164
771 rootH1_10041130
772 rootH1_10121882
773 JGI25160J50197_1002465
774 Ga0055535_1002560
775 Ga0055542_1015957
776 Ga0055526_1007155
777 Ga0055526_1013227
778 Ga0055528_1000314
779 Ga0055530_10000619
780 Ga0055531_10048271
781 Ga0055543_1014328
782 Ga0065165_1000182
783 Ga0065704_10000195
784 Ga0065704_10074748
785 Ga0065704_10077797
786 Ga0065704_10409115
787 Ga0065712_10101133
788 Ga0065707_10023401
789 Ga0070658_10004280
790 Ga0070658_10020569
791 Ga0070658_10070911
792 Ga0070658_10503165
793 Ga0070658_11923110
794 Ga0070676_10000015
795 Ga0070676_10025476
796 Ga0070676_10180861
797 Ga0070670_100070797
798 Ga0070670_101463292
799 Ga0070670_101972507
800 Ga0070677_10234154
801 Ga0068869_100079027
802 Ga0068869_100079473
803 Ga0068869_100132816
804 Ga0068869_100312382
805 Ga0068869_100434166
806 Ga0068869_100820125
807 Ga0070666_10000042
808 Ga0070666_10026174
809 Ga0070666_10581194
810 Ga0070666_11103400
811 Ga0070680_100003917
812 Ga0070680_100035400
813 Ga0068868_100012254
814 Ga0068868_100060336
815 Ga0068868_100120710
816 Ga0068868_100367921
817 Ga0068868_101268854
818 Ga0070660_100028681
819 Ga0070660_100044533
820 Ga0070660_100169934
821 Ga0070660_100432358
822 Ga0070660_100588345
823 Ga0070660_101461093
824 Ga0070689_100747958
825 Ga0070691_10110364
826 Ga0070687_100131270
827 Ga0070661_101832669
828 Ga0070692_10516515
829 Ga0070669_100029435
830 Ga0070675_100208280
831 Ga0070675_100709224
832 Ga0070675_100969052
833 Ga0070671_100062516
834 Ga0070671_100213561
835 Ga0070671_101423470
836 Ga0070674_101515989
837 Ga0070674_101552583
838 Ga0070673_100008611
839 Ga0070673_100399007
840 Ga0070673_100578329
841 Ga0070688_100087821
842 Ga0070688_100281550
843 Ga0070659_100077889
844 Ga0070659_100228350
845 Ga0070659_100521248
846 Ga0070659_100672469
847 Ga0070667_100287451
848 Ga0070667_100502390
849 Ga0070667_100636892
850 Ga0070667_100674097
851 Ga0070667_100830050
852 Ga0070667_101093882
853 Ga0070667_101094853
854 Ga0070667_102231714
855 Ga0070714_100946217
856 Ga0070701_10088579
857 Ga0070701_10164206
858 Ga0070701_10194353
859 Ga0070700_100047956
860 Ga0070700_100059909
861 Ga0070708_100520848
862 Ga0070678_100007585
863 Ga0070678_100436965
864 Ga0070678_101047122
865 Ga0070678_101199434
866 Ga0070662_100000020
867 Ga0070662_100127121
868 Ga0070681_10066604
869 Ga0070681_10178869
870 Ga0070681_10329484
871 Ga0070681_10789987
872 Ga0068867_100005742
873 Ga0068867_100015064
874 Ga0068867_100034465
875 Ga0068867_100270581
876 Ga0068867_101069628
877 Ga0068867_102256935
878 Ga0070685_10375181
879 Ga0070685_10731758
880 Ga0070685_11462197
881 Ga0070698_100000282
882 Ga0070698_100045076
883 Ga0070698_100075760
884 Ga0070679_100121395
885 Ga0070679_101000312
886 Ga0070684_101435525
887 Ga0070697_100051518
888 Ga0068853_100024000
889 Ga0068853_100025264
890 Ga0068853_100056937
891 Ga0068853_100071038
892 Ga0068853_100627999
893 Ga0068853_100661437
894 Ga0068853_100935982
895 Ga0068853_101555170
896 Ga0068853_101860645
897 Ga0070672_100218129
898 Ga0070672_100379391
899 Ga0070672_100511937
900 Ga0070672_101942610
901 Ga0070686_100061045
902 Ga0070695_100813774
903 Ga0070665_100000125
904 Ga0070704_100517376
905 Ga0068855_100068805
906 Ga0068855_100102831
907 Ga0068855_100127897
908 Ga0068855_100354440
909 Ga0068855_100443475
910 Ga0068855_100527701
911 Ga0068855_100820970
912 Ga0068855_100840388
913 Ga0068855_100951509
914 Ga0068855_101322690
915 Ga0070664_100001016
916 Ga0070664_100723412
917 Ga0070664_100810250
918 Ga0070664_101233430
919 Ga0068857_100507361
920 Ga0068857_100517758
921 Ga0068857_100822873
922 Ga0068857_102373572
923 Ga0068854_100028379
924 Ga0068854_100343443
925 Ga0068854_100502831
926 Ga0068856_100187239
927 Ga0068856_101713242
928 Ga0070702_100010581
929 Ga0070702_100310442
930 Ga0068852_100002994
931 Ga0068852_100078108
932 Ga0068852_100558452
933 Ga0068852_101208348
934 Ga0068852_101924310
935 Ga0068852_102428643
936 Ga0068859_100000128
937 Ga0068859_100000768
938 Ga0068859_100118149
939 Ga0068859_100162120
940 Ga0068859_100340743
941 Ga0068859_100353678
942 Ga0068859_101191439
943 Ga0068864_100026441
944 Ga0068864_100079795
945 Ga0068864_100366918
946 Ga0068866_10036252
947 Ga0068861_100453396
948 Ga0068861_100483931
949 Ga0068861_100829985
950 Ga0068861_101316228
951 Ga0068870_10085772
952 Ga0068870_10110453
953 Ga0068870_10828419
954 Ga0068863_100016956
955 Ga0068863_100194564
956 Ga0068863_100654900
957 Ga0068858_100057422
958 Ga0068858_100162391
959 Ga0068858_100520777
960 Ga0068858_101200109
961 Ga0068858_102029529
962 Ga0068860_100000059
963 Ga0068860_100009276
964 Ga0068860_100181649
965 Ga0068860_100472368
966 Ga0068860_101496403
967 Ga0068860_102529530
968 Ga0068862_100009951
969 Ga0068862_101404166
970 Ga0068862_101901888
971 Ga0068862_102080960
972 Ga0081539_10144985
973 Ga0075366_10233851
974 Ga0075366_10382866
975 Ga0097621_100000714
976 Ga0097621_100016633
977 Ga0097621_100426646
978 Ga0097621_102401101
979 Ga0068871_100000046
980 Ga0068871_100032967
981 Ga0068871_100083877
982 Ga0068871_100674003
983 Ga0068871_102233885
984 Ga0068865_100000041
985 Ga0068865_100016853
986 Ga0097620_100000128
987 Ga0097620_100000768
988 Ga0097620_100118146
989 Ga0097620_100162125
990 Ga0097620_100353680
991 Ga0097620_101191459
992 Ga0105250_10578428
993 Ga0105240_10000692
994 Ga0105240_10091827
995 Ga0105240_10142389
996 Ga0105240_10151322
997 Ga0105240_10228824
998 Ga0105240_10275776
999 Ga0105240_10377563
1000 Ga0105240_11192892
1001 Ga0105245_12352170
1002 Ga0105245_12489654
1003 Ga0105247_10012983
1004 Ga0105243_10833104
1005 Ga0105241_10000217
1006 Ga0105241_10000853
1007 Ga0105241_10014129
1008 Ga0105241_10230152
1009 Ga0105241_10704680
1010 Ga0105241_11081115
1011 Ga0105242_10012349
1012 Ga0105242_10860977
1013 Ga0105248_10018721
1014 Ga0105248_13043361
1015 Ga0105248_13390872
1016 Ga0105237_10001818
1017 Ga0105237_10005378
1018 Ga0105237_10022652
1019 Ga0105237_10064143
1020 Ga0105237_10100775
1021 Ga0105237_10100974
1022 Ga0105237_10174509
1023 Ga0105237_11804019
1024 Ga0105237_12764956
1025 Ga0105238_10002068
1026 Ga0105238_10049554
1027 Ga0105249_10001650
1028 Ga0105249_10004971
1029 Ga0105249_10127295
1030 Ga0105249_10354681
1031 Ga0105239_10003770
1032 Ga0105239_10004595
1033 Ga0105239_10014883
1034 Ga0105239_10020326
1035 Ga0105239_10131045
1036 Ga0105239_10230797
1037 Ga0105239_10323232
1038 Ga0105239_10368999
1039 Ga0105239_10369001
1040 Ga0105239_10863001
1041 Ga0105239_10878842
1042 Ga0105239_12443028
1043 Ga0105246_10030380
1044 Ga0157318_1010462
1045 Ga0157373_10018201
1046 Ga0157373_10115049
1047 Ga0157373_10451993
1048 Ga0157373_10734773
1049 Ga0157371_10001084
1050 Ga0157371_10005892
1051 Ga0157371_10117844
1052 Ga0157371_10200008
1053 Ga0157371_10226730
1054 Ga0157371_10655107
1055 Ga0157370_10004729
1056 Ga0157370_10005230
1057 Ga0157370_10007942
1058 Ga0157370_10741662
1059 Ga0157370_10856618
1060 Ga0157370_11746082
1061 Ga0157369_10710310
1062 Ga0157374_10024480
1063 Ga0157374_10120999
1064 Ga0157374_10180122
1065 Ga0157374_10361113
1066 Ga0157374_10411884
1067 Ga0157374_10764166
1068 Ga0157374_11519916
1069 Ga0157378_10002500
1070 Ga0157378_10010592
1071 Ga0157378_10039612
1072 Ga0157378_10100133
1073 Ga0157378_10192612
1074 Ga0157378_10271550
1075 Ga0157378_10438265
1076 Ga0157378_10522041
1077 Ga0157378_11064786
1078 Ga0157378_12967902
1079 Ga0163162_10000005
1080 Ga0163162_10004176
1081 Ga0163162_10025120
1082 Ga0163162_10118800
1083 Ga0163162_10162723
1084 Ga0163162_10790887
1085 Ga0163162_11089836
1086 Ga0163162_12934557
1087 Ga0157372_10067142
1088 Ga0157372_10147956
1089 Ga0157372_10279148
1090 Ga0157372_10357598
1091 Ga0157372_10946520
1092 Ga0157372_11516755
1093 Ga0157372_11860707
1094 Ga0157375_10056217
1095 Ga0157375_10076765
1096 Ga0157375_10136908
1097 Ga0157375_10190225
1098 Ga0157375_10327155
1099 Ga0157375_10639859
1100 Ga0157375_12856259
1101 Ga0157375_13298652
1102 Ga0163163_10044636
1103 Ga0163163_10209269
1104 Ga0163163_10522091
1105 Ga0163163_10933780
1106 Ga0163163_11027084
1107 Ga0157380_10760117
1108 Ga0157380_12632947
1109 Ga0182008_10000108
1110 Ga0157377_10002130
1111 Ga0157377_10013404
1112 Ga0157377_10107275
1113 Ga0157377_10456364
1114 Ga0157379_10927927
1115 Ga0157379_12485608
1116 Ga0157376_10328573
1117 Ga0157376_10386112
1118 Ga0157376_11477504
1119 Ga0157376_12559847
1120 Ga0182006_1000109
1121 Ga0182007_10037805
1122 Ga0163161_10001003
1123 Ga0163161_10036486
1124 Ga0163161_10168620
1125 Ga0163161_10203301
1126 Ga0163161_10463349
1127 Ga0163161_12065873
1128 Ga0213872_10029500
1129 Ga0213876_10000722
1130 Ga0209437_100528
1131 Ga0209258_100029
1132 Ga0209646_1016800
1133 Ga0209026_1000890
1134 Ga0209148_1000163
1135 Ga0209129_1009318
1136 Ga0209455_1003239
1137 Ga0209673_1000016
1138 Ga0209564_1005465
1139 Ga0209758_1006613
1140 Ga0209050_1000124
1141 Ga0207426_1000157
1142 Ga0207426_1000925
1143 Ga0209051_1023842
1144 Ga0209257_1001535
1145 Ga0207697_10354971
1146 Ga0207682_10349708
1147 Ga0207682_10399046
1148 Ga0207642_10019317
1149 Ga0207642_10289659
1150 Ga0207710_10043471
1151 Ga0207688_10005502
1152 Ga0207688_10747440
1153 Ga0207680_10000448
1154 Ga0207647_10000117
1155 Ga0207647_10045721
1156 Ga0207647_10086213
1157 Ga0207647_10158900
1158 Ga0207685_10314334
1159 Ga0207645_10009683
1160 Ga0207645_10013933
1161 Ga0207645_10088067
1162 Ga0207643_10045067
1163 Ga0207643_10138292
1164 Ga0207705_10000623
1165 Ga0207705_10078920
1166 Ga0207705_10085635
1167 Ga0207705_10179389
1168 Ga0207705_11286318
1169 Ga0207654_10000524
1170 Ga0207654_10008858
1171 Ga0207654_10011575
1172 Ga0207707_10343059
1173 Ga0207707_11427569
1174 Ga0207695_10000020
1175 Ga0207695_10008260
1176 Ga0207695_10048139
1177 Ga0207695_10068845
1178 Ga0207695_10895876
1179 Ga0207671_10002893
1180 Ga0207671_10005501
1181 Ga0207671_10008195
1182 Ga0207671_10022597
1183 Ga0207671_10027556
1184 Ga0207671_10119370
1185 Ga0207671_10132417
1186 Ga0207671_10244524
1187 Ga0207671_11239614
1188 Ga0207663_10540253
1189 Ga0207660_10035604
1190 Ga0207660_10367560
1191 Ga0207662_10035006
1192 Ga0207662_10041489
1193 Ga0207657_10012327
1194 Ga0207657_10268913
1195 Ga0207657_10535440
1196 Ga0207657_10800976
1197 Ga0207657_10912900
1198 Ga0207652_11877545
1199 Ga0207646_10120519
1200 Ga0207646_11096909
1201 Ga0207681_10367529
1202 Ga0207681_10585725
1203 Ga0207681_11587396
1204 Ga0207694_10035339
1205 Ga0207694_10072542
1206 Ga0207659_10239400
1207 Ga0207659_10534496
1208 Ga0207687_11720539
1209 Ga0207664_10954863
1210 Ga0207644_10072589
1211 Ga0207644_10186173
1212 Ga0207644_10600633
1213 Ga0207690_10220436
1214 Ga0207690_10320013
1215 Ga0207690_10401022
1216 Ga0207690_10619021
1217 Ga0207706_10000044
1218 Ga0207706_10020437
1219 Ga0207686_10082882
1220 Ga0207686_10309192
1221 Ga0207709_10205784
1222 Ga0207670_11886993
1223 Ga0207669_10354074
1224 Ga0207669_11404192
1225 Ga0207704_10000061
1226 Ga0207704_10359608
1227 Ga0207665_10693511
1228 Ga0207691_10007611
1229 Ga0207691_10009816
1230 Ga0207691_10195375
1231 Ga0207691_10240574
1232 Ga0207711_10058541
1233 Ga0207711_11112052
1234 Ga0207711_11791947
1235 Ga0207689_10064946
1236 Ga0207689_10095465
1237 Ga0207689_10164130
1238 Ga0207689_10350892
1239 Ga0207689_10356690
1240 Ga0207661_10656543
1241 Ga0207679_10267921
1242 Ga0207679_10670249
1243 Ga0207679_11258831
1244 Ga0207667_10081641
1245 Ga0207667_10129790
1246 Ga0207667_10187634
1247 Ga0207667_10798120
1248 Ga0207667_11339039
1249 Ga0207651_10004446
1250 Ga0207651_10689755
1251 Ga0207712_10065033
1252 Ga0207712_10114889
1253 Ga0207712_10170480
1254 Ga0207712_10196649
1255 Ga0207712_10449328
1256 Ga0207712_12000853
1257 Ga0207668_11703580
1258 Ga0207668_11836933
1259 Ga0207668_11994339
1260 Ga0207640_10072546
1261 Ga0207640_10628518
1262 Ga0207658_10067979
1263 Ga0207658_10137113
1264 Ga0207658_10154262
1265 Ga0207658_10303417
1266 Ga0207658_10390442
1267 Ga0207658_11345465
1268 Ga0207658_11621991
1269 Ga0207658_11873631
1270 Ga0207677_10037202
1271 Ga0207677_10057504
1272 Ga0207677_10077911
1273 Ga0207677_10553218
1274 Ga0207677_11779838
1275 Ga0207703_10006254
1276 Ga0207703_10331355
1277 Ga0207703_10484819
1278 Ga0207703_10786046
1279 Ga0207703_10926305
1280 Ga0207703_11666769
1281 Ga0207703_11719022
1282 Ga0207703_11837569
1283 Ga0207703_12207335
1284 Ga0207639_10010963
1285 Ga0207639_10012012
1286 Ga0207639_10115885
1287 Ga0207639_10130457
1288 Ga0207639_10166030
1289 Ga0207639_10329602
1290 Ga0207639_10331843
1291 Ga0207678_10201899
1292 Ga0207678_11809054
1293 Ga0207708_10017604
1294 Ga0207708_10079070
1295 Ga0207708_11173679
1296 Ga0207708_11552873
1297 Ga0207708_11909248
1298 Ga0207702_11095342
1299 Ga0207702_12052422
1300 Ga0207641_10005736
1301 Ga0207641_10233935
1302 Ga0207641_10541959
1303 Ga0207641_12612183
1304 Ga0207648_10002338
1305 Ga0207648_10052614
1306 Ga0207648_10286460
1307 Ga0207648_11950885
1308 Ga0207676_10004483
1309 Ga0207676_10352943
1310 Ga0207676_11291134
1311 Ga0207674_10023607
1312 Ga0207674_10156717
1313 Ga0207674_10353023
1314 Ga0207674_10497460
1315 Ga0207674_11042722
1316 Ga0207675_100339515
1317 Ga0207675_100937586
1318 Ga0207675_101417037
1319 Ga0207675_101789605
1320 Ga0207683_10031283
1321 Ga0207683_10215435
1322 Ga0207683_10240671
1323 Ga0207683_10613569
1324 Ga0207698_10121920
1325 Ga0207698_10728534
1326 Ga0207698_10820847
1327 Ga0207698_10834298
1328 Ga0207698_10910885
1329 Ga0207698_12099353
1330 Ga0268266_10000132
1331 Ga0268266_10637558
1332 Ga0268265_10013493
1333 Ga0268265_10286163
1334 Ga0268265_11442638
1335 Ga0268264_10000015
1336 Ga0268264_10383701
1337 Ga0268264_10601952
1338 Ga0268264_10945203
1339 Ga0268264_11342442
1340 Ga0265334_10159572
1341 Ga0265323_10000512
1342 Ga0307517_10007381
1343 Ga0307515_10000061
1344 Ga0307515_10064321
1345 Ga0307515_10629754
1346 Ga0265338_10084234
1347 Ga0265338_10517135
1348 Ga0316181_1087376
1349 Ga0265330_10104767
1350 Ga0265327_10000055
1351 Ga0265327_10064368
1352 Ga0265327_10070414
1353 Ga0265316_10001184
1354 Ga0307509_10178754
1355 Ga0307509_10228133
1356 Ga0307509_10420174
1357 Ga0307509_10492518
1358 Ga0307514_10433042
1359 Ga0265314_10046768
1360 Ga0307410_11479517
1361 Ga0307406_10038111
1362 Ga0307406_10611011
1363 Ga0307412_11208901
1364 Ga0307412_12098833
1365 Ga0307409_101429972
1366 Ga0307416_100224981
1367 Ga0307416_101593428
1368 Ga0307414_10084723
1369 Ga0307414_10286507
1370 Ga0307411_11966865
1371 Ga0307510_10013796
1372 Ga0373936_0230431
1373 Ga0373939_0215478
1374 Ga0373941_0232872
1375 Ga0373942_0025117
1376 Ga0395899_0000021
1377 Ga0395899_0009228
1378 Ga0395899_0026616
1379 Ga0395899_0115190
1380 Ga0395900_0000494
1381 Ga0395900_0003517
1382 Ga0395900_0004982
1383 Ga0395900_0279390
1384 Ga0395898_0004102
1385 Ga0395898_0080656
1386 Ga0395905_0000757
1387 Ga0395905_0004960
1388 Ga0395905_0017163
1389 Ga0395905_0030285
1390 Ga0395905_0485689
1391 Ga0395901_0002107
1392 Ga0395901_0003012
1393 Ga0395901_0021304
1394 Ga0395901_0054362
1395 Ga0436365_1664331
1396 Ga0436361_0635236
1397 Ga0439439_0214470
1398 Ga0439466_0139579
1399 Ga0451793_0462005
1400 Ga0451802_1188741
1401 Ga0451804_0543671
1402 Ga0451807_1973634
1403 Ga0451833_0971787
1404 Ga0451837_0256521
1405 Ga0451841_1049833
1406 Ga0451845_0572086
1407 Ga0451851_0947342
1408 Ga0451851_1259567
1409 Ga0451853_0174956
1410 Ga0439442_026011
1411 Ga0439432_128270
1412 Ga0439449_0126557
1413 Ga0439457_044691
1414 Ga0450897_050347
1415 Ga0450898_005402
1416 Ga0450899_009235
1417 Ga0451577_0023194
1418 Ga0451577_0027814
1419 Ga0451577_0202605
1420 Ga0466972_0301302
1421 Ga0466972_0554611
1422 Ga0453684_0002051
1423 Ga0453684_0055025
1424 Ga0453684_0517563
1425 Ga0466970_0128696
1426 Ga0466959_0018495
1427 Ga0466959_0077269
1428 Ga0466959_0288998
1429 Ga0451576_0015476
1430 Ga0451576_0189687
1431 Ga0451576_1787248
1432 Ga0451576_2609771
1433 Ga0466958_0386462
1434 Ga0495638_0000008
1435 Ga0495638_0414301
1436 Ga0495651_0468027
1437 Ga0495650_0019537
1438 Ga0495606_0058371
1439 Ga0495606_0482368
1440 Ga0495618_0850045
1441 Ga0495644_0096453
1442 Ga0495652_0901129
1443 Ga0495622_0211461
1444 Ga0495668_0001373
1445 Ga0495634_0502991
1446 Ga0495611_0120339
1447 Ga0495625_0118844
1448 Ga0495661_0612527
1449 Ga0495658_0945769
1450 Ga0495581_0903691
1451 Ga0495674_1254327
1452 Ga0495672_0008239
1453 Ga0495685_090765
1454 Ga0495686_0001370
1455 Ga0496108_0707060
1456 Ga0496115_0926906
1457 Ga0496122_0006972
1458 Ga0496123_0028687
1459 Ga0496125_0028469
1460 Ga0501034_0138376
1461 Ga0501038_0090718
1462 Ga0501039_0375002
1463 Ga0501043_0311516
1464 Ga0501073_0820270
1465 Ga0501198_105283
1466 Ga0501214_042452
1467 Ga0501217_164696
1468 Ga0501223_028400
1469 Ga0501224_042369
1470 Ga0501233_148642
1471 Ga0501238_033146
1472 Ga0501250_060581
1473 Ga0501257_022697
1474 Ga0501221_128947
1475 Ga0501234_052612
1476 Ga0501044_0205041
1477 nmdc:mga0k408_116299_c1
1478 nmdc:mga07m45_168367_c1
1479 nmdc:mga08y16_945191_c1
1480 nmdc:mga08y16_97154_c1
1481 Ga0500635_0000568
1482 Ga0500578_0000024
1483 Ga0500578_0295929
1484 Ga0500644_0000169
1485 Ga0500644_0084978
1486 Ga0500581_213282
1487 Ga0500581_237668
1488 Ga0500647_0179297
1489 Ga0500583_0506470
1490 Ga0500650_0176658
1491 Ga0500562_000078
1492 Ga0500592_068298
1493 Ga0500607_025589
1494 Ga0500608_095814
1495 Ga0500618_000004
1496 Ga0500642_0146371
1497 Ga0500568_0028977
1498 Ga0500568_0240949
1499 Ga0500577_0046752
1500 Ga0500590_092581
1501 Ga0500616_0000003
1502 Ga0500616_0004260
1503 Ga0500616_0012071
1504 Ga0500616_0102737
1505 Ga0500616_0146391
1506 Ga0500616_0219205
1507 Ga0500622_0000870
1508 Ga0500622_0001076
1509 Ga0500622_0243796
1510 Ga0500633_0003460
1511 Ga0500634_0050744
1512 Ga0500645_020997
1513 Ga0500645_143683
1514 Ga0500552_034013
1515 Ga0466962_0058515
1516 2898715615
1517 2910249359
1518 2919438741

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

32

78

0.98

PF12840

HTH_20

Helix-turn-helix domain

30

79

0.96

PF12802

MarR_2

MarR family

32

83

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j0e-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9358 6 79
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9319 8 88
6j05-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.924 8 82
6j05-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9156 8 82
6j0e-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9151 6 79
ID Description Score Start End Superfamily
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9838 8 83 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9573 13 69 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9428 8 84 1.10.10.10
af_P71941_17_120_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.941 8 80 1.10.10.10
af_B4FTK6_47_112_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9257 13 70 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A524QVP0-F1-model_v4 ArsR family transcriptional regulator 0.9872 8 79 GO:0003700
AF-Q9A415-F1-model_v4 Transcriptional regulator, ArsR family 0.979 7 88 GO:0003700
AF-A0A6N4EDV7-F1-model_v4 deleted 0.9788 1 78
AF-A0A147DX53-F1-model_v4 deleted 0.9762 7 85
AF-A0A089HR62-F1-model_v4 ArsR family transcriptional regulator 0.9748 8 86 GO:0003677
GO:0003700

Map