F479484

General Info

Members Datasets Scaffolds Average Seq Length
759 507 1518 285

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10305035|Ga0207665_103050351
Length 332
Sequence MPSDEASVPRLSAQAGLSCPGSAERHGVPHRVRDTREEIAITSAIGVTSGMAQDPQTPPALFDRALLHARQRRAQAQGAVSFLLDRVAEDMSDRLAAVMREFHTAADLWTPGEGLAVLRARLPSIRRIELDTSGAEKLPFAPESLDLVLSALALQFVNDLPGVLAQIRRALKPDGLLLAAMIGGDSLTELRQAFAAAEAECEGGVSPRVAPFADLRDVGALLQRAGFALPVTDVDRVVVRYANAFALMQDIRRMGAANVLIERRRTPSRRSTLLRMAEVYAERFADADGRIRATFDIIWLSGWAPHASQQQPLKPGSAKASLAEAVKKAGKE

Samples

Sample ID Description Type Environment
1 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
86 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
87 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
88 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
89 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
93 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
144 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
145 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
150 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
151 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
157 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
159 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
179 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
180 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
181 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
201 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
202 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
203 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
204 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
207 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
208 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
211 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
212 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
213 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
214 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
215 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
216 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
217 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
218 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
223 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
224 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
225 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
226 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
229 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
230 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
231 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
234 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
235 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
236 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
237 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
238 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
239 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
240 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
241 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
242 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
243 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
244 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
245 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
246 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
247 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
248 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
249 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
250 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
251 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
252 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
253 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
254 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
255 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
256 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
257 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
258 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
259 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
276 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
277 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
278 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
279 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
280 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
281 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
282 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
283 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
284 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
285 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
292 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
293 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
294 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
295 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
296 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
297 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
298 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
299 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
300 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
301 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
302 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
303 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
304 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
305 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
306 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
307 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
308 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
309 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
310 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
311 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
312 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
313 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
314 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
315 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
316 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
317 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
318 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
319 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
320 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
321 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
322 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
323 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
324 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
325 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
326 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
327 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
328 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
329 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
330 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
331 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
332 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
333 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
334 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
335 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
336 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
337 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
338 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
339 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
340 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
341 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
342 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
343 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
344 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
345 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
346 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
347 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
348 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
349 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
350 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
351 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
352 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
353 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
354 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
355 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
356 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
357 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
358 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
359 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
360 2643221651 Afipia sp. Root123D2 Isolate Unclassified
361 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
362 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
363 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
364 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
365 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
366 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
367 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
368 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
369 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
370 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
371 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
372 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
373 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
374 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
375 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
376 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
377 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
378 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
379 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
380 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
381 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
382 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
383 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
384 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
385 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
386 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
387 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
388 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
389 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
390 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
391 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
392 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
393 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
394 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
395 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
396 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
397 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
398 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
399 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
400 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
401 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
402 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
403 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
404 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
405 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
406 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
407 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
408 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
409 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
410 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
411 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
412 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
413 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
414 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
415 2922368715
416 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
417 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
418 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
419 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
420 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
421 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
422 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
423 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
424 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
425 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
426 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
427 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
428 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
429 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
430 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
431 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
432 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
433 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
434 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
435 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
436 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
437 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
438 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
439 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
440 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
441 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
442 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
443 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
444 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
445 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
446 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
447 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
448 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
449 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
450 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
451 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
452 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
453 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
454 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
455 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
456 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
457 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
458 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
459 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
460 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
461 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
462 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
463 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
464 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
465 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
466 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
467 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
468 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
469 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
470 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
471 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
472 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
473 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
474 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
475 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
476 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
477 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
478 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
479 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
480 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
481 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
482 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
483 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
484 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
485 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
486 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
487 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
488 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
489 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
490 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
491 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
492 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
493 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
494 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
495 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
496 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
497 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
498 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
499 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
500 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
501 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
502 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
503 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
504 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
505 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
506 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
507 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.7
Metatranscriptomes 0.13
Isolates 22.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.7
Nodule 17.92
Rhizoplane 7.11
Rhizosphere 51.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207665_10305035 3300025939 Bacteria 1191
2 JGI25165J46597_1009332 3300003214 Bacteria 1483
3 JGI25153J46596_10003051 3300003215 Bacteria 9461
4 JGI25153J46596_10004570 3300003215 Bacteria 7426
5 JGI25153J46596_10006145 3300003215 Bacteria 6155
6 JGI25153J46596_10011665 3300003215 Bacteria 3863
7 JGI25153J46596_10037172 3300003215 Bacteria 1552
8 JGI25160J50197_1001574 3300003354 Bacteria 11262
9 JGI25160J50197_1001779 3300003354 Bacteria 10433
10 JGI25404J52841_10004554 3300003659 Bacteria 2818
11 Ga0055531_10005617 3300003794 Bacteria 7297
12 Ga0065165_1005041 3300005262 Bacteria 7710
13 Ga0070658_10026144 3300005327 Bacteria 4682
14 Ga0070676_10065637 3300005328 Bacteria 2167
15 Ga0070690_100046706 3300005330 Bacteria 2753
16 Ga0068869_100098356 3300005334 Bacteria 2210
17 Ga0068869_100187122 3300005334 Bacteria 1626
18 Ga0070666_10267489 3300005335 Bacteria 1213
19 Ga0070680_100171374 3300005336 Bacteria 1826
20 Ga0070682_100129177 3300005337 Bacteria 1708
21 Ga0068868_100023606 3300005338 Bacteria 4656
22 Ga0070660_100023921 3300005339 Bacteria 4530
23 Ga0070661_100270881 3300005344 Bacteria 1315
24 Ga0070668_100034627 3300005347 Bacteria 3849
25 Ga0070668_100133435 3300005347 Bacteria 1994
26 Ga0070671_100207274 3300005355 Bacteria 1663
27 Ga0070673_100413478 3300005364 Bacteria 1208
28 Ga0070688_100381699 3300005365 Bacteria 1039
29 Ga0070659_100022001 3300005366 Bacteria 4865
30 Ga0070659_100399672 3300005366 Bacteria 1160
31 Ga0070667_100064979 3300005367 Bacteria 3097
32 Ga0070667_100466714 3300005367 Bacteria 1155
33 Ga0070709_10001043 3300005434 Bacteria 15348
34 Ga0070709_10002120 3300005434 Bacteria 10732
35 Ga0070714_100040555 3300005435 Bacteria 3924
36 Ga0070713_100014537 3300005436 Bacteria 5852
37 Ga0070713_100017000 3300005436 Bacteria 5486
38 Ga0070713_100030913 3300005436 Bacteria 4258
39 Ga0070713_100122498 3300005436 Bacteria 2283
40 Ga0070710_10001640 3300005437 Bacteria 10584
41 Ga0070710_10038234 3300005437 Bacteria 2635
42 Ga0070711_100040459 3300005439 Bacteria 3144
43 Ga0070663_100109435 3300005455 Bacteria 2074
44 Ga0070663_100281085 3300005455 Bacteria 1326
45 Ga0070663_100333944 3300005455 Bacteria 1222
46 Ga0068867_100510338 3300005459 Bacteria 1035
47 Ga0070685_10347712 3300005466 Bacteria 1013
48 Ga0070679_100296853 3300005530 Bacteria 1567
49 Ga0070684_100027981 3300005535 Bacteria 4765
50 Ga0068853_100224076 3300005539 Bacteria 1718
51 Ga0070672_100012411 3300005543 Bacteria 5979
52 Ga0070672_100130698 3300005543 Bacteria 2063
53 Ga0070693_100252828 3300005547 Bacteria 1169
54 Ga0070665_100063043 3300005548 Bacteria 3717
55 Ga0070665_100140122 3300005548 Bacteria 2422
56 Ga0070665_100315868 3300005548 Bacteria 1566
57 Ga0070665_100329221 3300005548 Bacteria 1532
58 Ga0068855_100025627 3300005563 Bacteria 7054
59 Ga0068855_100212587 3300005563 Bacteria 2172
60 Ga0070664_100150931 3300005564 Bacteria 2051
61 Ga0070664_100359423 3300005564 Bacteria 1326
62 Ga0068857_100108211 3300005577 Bacteria 2498
63 Ga0068854_100152216 3300005578 Bacteria 1785
64 Ga0068854_100372222 3300005578 Bacteria 1175
65 Ga0070702_100069289 3300005615 Bacteria 2078
66 Ga0068852_100151120 3300005616 Bacteria 2159
67 Ga0068852_100293463 3300005616 Bacteria 1572
68 Ga0068859_100104583 3300005617 Bacteria 2890
69 Ga0068859_100311133 3300005617 Bacteria 1669
70 Ga0068864_100069630 3300005618 Bacteria 3060
71 Ga0068861_100058920 3300005719 Bacteria 2938
72 Ga0068861_100144444 3300005719 Bacteria 1946
73 Ga0068863_100302870 3300005841 Bacteria 1551
74 Ga0068858_100099371 3300005842 Bacteria 2713
75 Ga0068858_100109449 3300005842 Bacteria 2579
76 Ga0068860_100211678 3300005843 Bacteria 1880
77 Ga0068862_100153267 3300005844 Bacteria 2052
78 Ga0068862_100168984 3300005844 Bacteria 1957
79 Ga0081455_10005919 3300005937 Bacteria 13272
80 Ga0081455_10061026 3300005937 Bacteria 3175
81 Ga0081540_1008966 3300005983 Bacteria 6923
82 Ga0081540_1009964 3300005983 Bacteria 6481
83 Ga0081540_1014575 3300005983 Bacteria 5027
84 Ga0081539_10042554 3300005985 Bacteria 2644
85 Ga0070717_10001143 3300006028 Bacteria 17925
86 Ga0070717_10047973 3300006028 Bacteria 3502
87 Ga0070717_10289195 3300006028 Bacteria 1455
88 Ga0075365_10068554 3300006038 Bacteria 2383
89 Ga0075365_10283760 3300006038 Bacteria 1165
90 Ga0075364_10046309 3300006051 Bacteria 2831
91 Ga0070715_10002760 3300006163 Bacteria 5455
92 Ga0070716_100007223 3300006173 Bacteria 5464
93 Ga0070716_100042884 3300006173 Bacteria 2527
94 Ga0070712_100006152 3300006175 Bacteria 7426
95 Ga0070712_100182258 3300006175 Bacteria 1637
96 Ga0075366_10002600 3300006195 Bacteria 9280
97 Ga0097621_100329117 3300006237 Bacteria 1355
98 Ga0068871_100104701 3300006358 Bacteria 2373
99 Ga0097620_100104575 3300006931 Bacteria 2890
100 Ga0097620_100311137 3300006931 Bacteria 1669
101 Ga0099824_1012187 3300006942 Bacteria 9468
102 Ga0105240_10005129 3300009093 Bacteria 19597
103 Ga0105240_10035009 3300009093 Bacteria 6475
104 Ga0105245_10222206 3300009098 Bacteria 1823
105 Ga0105245_10298809 3300009098 Bacteria 1579
106 Ga0105247_10220530 3300009101 Bacteria 1283
107 Ga0105243_10134417 3300009148 Bacteria 2102
108 Ga0105241_10014074 3300009174 Bacteria 5862
109 Ga0105241_10047814 3300009174 Bacteria 3254
110 Ga0105237_10013514 3300009545 Bacteria 8556
111 Ga0105238_10694036 3300009551 Bacteria 1030
112 Ga0105249_10164886 3300009553 Bacteria 2144
113 Ga0105239_10024829 3300010375 Bacteria 6603
114 Ga0105239_10179264 3300010375 Bacteria 2370
115 Ga0105239_10488087 3300010375 Bacteria 1400
116 Ga0105239_10690001 3300010375 Bacteria 1167
117 Ga0105246_10179142 3300011119 Bacteria 1630
118 Ga0105246_10378322 3300011119 Bacteria 1169
119 Ga0157370_10093494 3300013104 Bacteria 2822
120 Ga0157369_10013512 3300013105 Bacteria 9228
121 Ga0157374_10364765 3300013296 Bacteria 1437
122 Ga0163162_10291947 3300013306 Bacteria 1762
123 Ga0163162_10300490 3300013306 Bacteria 1737
124 Ga0157375_10025269 3300013308 Bacteria 5515
125 Ga0157375_10165233 3300013308 Bacteria 2358
126 Ga0163163_10052116 3300014325 Bacteria 4036
127 Ga0163163_10133233 3300014325 Bacteria 2525
128 Ga0157377_10133500 3300014745 Bacteria 1519
129 Ga0157377_10176179 3300014745 Bacteria 1341
130 Ga0157377_10400498 3300014745 Bacteria 935
131 Ga0157376_10145982 3300014969 Bacteria 2128
132 Ga0157376_10150868 3300014969 Bacteria 2096
133 Ga0163161_10036195 3300017792 Bacteria 3535
134 Ga0206353_10623774 3300020082 Bacteria 1131
135 Ga0214544_1000087 3300021320 Bacteria 119600
136 Ga0214542_1000018 3300021321 Bacteria 202226
137 Ga0214545_1000009 3300021324 Bacteria 202915
138 Ga0214543_1000037 3300021327 Bacteria 182113
139 Ga0209563_104871 3300025230 Bacteria 2509
140 Ga0209677_105069 3300025253 Bacteria 3562
141 Ga0209148_1002285 3300025254 Bacteria 6905
142 Ga0209233_1005177 3300025261 Bacteria 4355
143 Ga0209233_1013010 3300025261 Bacteria 2391
144 Ga0209455_1003892 3300025272 Bacteria 5091
145 Ga0209455_1006163 3300025272 Bacteria 3585
146 Ga0209673_1028217 3300025273 Bacteria 1811
147 Ga0209564_1003384 3300025295 Bacteria 10997
148 Ga0209564_1007864 3300025295 Bacteria 5397
149 Ga0209758_1000030 3300025297 Bacteria 509217
150 Ga0209758_1000884 3300025297 Bacteria 41143
151 Ga0209758_1000949 3300025297 Bacteria 39098
152 Ga0209758_1006161 3300025297 Bacteria 8784
153 Ga0209758_1007096 3300025297 Bacteria 7756
154 Ga0209758_1010276 3300025297 Bacteria 5631
155 Ga0209758_1011559 3300025297 Bacteria 5089
156 Ga0209758_1017944 3300025297 Bacteria 3494
157 Ga0209758_1022776 3300025297 Bacteria 2857
158 Ga0209256_1016593 3300025299 Bacteria 2499
159 Ga0207426_1001522 3300025302 Bacteria 18884
160 Ga0207426_1015480 3300025302 Bacteria 2762
161 Ga0209257_1003355 3300025304 Bacteria 13856
162 Ga0207692_10004318 3300025898 Bacteria 5622
163 Ga0207692_10016120 3300025898 Bacteria 3301
164 Ga0207647_10019817 3300025904 Bacteria 4517
165 Ga0207699_10000360 3300025906 Bacteria 24053
166 Ga0207699_10013541 3300025906 Bacteria 4178
167 Ga0207645_10107781 3300025907 Bacteria 1802
168 Ga0207705_10142379 3300025909 Bacteria 1791
169 Ga0207654_10013203 3300025911 Bacteria 4245
170 Ga0207654_10204600 3300025911 Bacteria 1302
171 Ga0207654_10255164 3300025911 Bacteria 1177
172 Ga0207707_10111344 3300025912 Bacteria 2393
173 Ga0207695_10000059 3300025913 Bacteria 363920
174 Ga0207695_10245684 3300025913 Bacteria 1690
175 Ga0207671_10094291 3300025914 Bacteria 2259
176 Ga0207671_10235667 3300025914 Bacteria 1437
177 Ga0207671_10360461 3300025914 Bacteria 1154
178 Ga0207693_10000073 3300025915 Bacteria 89380
179 Ga0207693_10059536 3300025915 Bacteria 2992
180 Ga0207663_10000861 3300025916 Bacteria 13793
181 Ga0207660_10020024 3300025917 Bacteria 4484
182 Ga0207657_10004881 3300025919 Bacteria 14112
183 Ga0207652_10181195 3300025921 Bacteria 1893
184 Ga0207646_10473353 3300025922 Bacteria 1130
185 Ga0207687_10105091 3300025927 Bacteria 2086
186 Ga0207687_10167300 3300025927 Bacteria 1693
187 Ga0207700_10034750 3300025928 Bacteria 3622
188 Ga0207700_10052688 3300025928 Bacteria 3044
189 Ga0207700_10102804 3300025928 Bacteria 2283
190 Ga0207664_10023264 3300025929 Bacteria 4640
191 Ga0207664_10027950 3300025929 Bacteria 4282
192 Ga0207664_10209929 3300025929 Bacteria 1684
193 Ga0207664_10344058 3300025929 Bacteria 1319
194 Ga0207644_10492611 3300025931 Bacteria 1010
195 Ga0207690_10074693 3300025932 Bacteria 2349
196 Ga0207709_10104454 3300025935 Bacteria 1880
197 Ga0207669_10029822 3300025937 Bacteria 3022
198 Ga0207704_10163511 3300025938 Bacteria 1587
199 Ga0207665_10000629 3300025939 Bacteria 23661
200 Ga0207665_10045899 3300025939 Bacteria 2926
201 Ga0207691_10187098 3300025940 Bacteria 1807
202 Ga0207689_10061122 3300025942 Bacteria 3098
203 Ga0207661_10551095 3300025944 Bacteria 1056
204 Ga0207679_10204384 3300025945 Bacteria 1652
205 Ga0207667_10019657 3300025949 Bacteria 7531
206 Ga0207667_10079342 3300025949 Bacteria 3402
207 Ga0207667_10275853 3300025949 Bacteria 1719
208 Ga0207667_10302771 3300025949 Bacteria 1633
209 Ga0207651_10382497 3300025960 Bacteria 1193
210 Ga0207712_10230685 3300025961 Bacteria 1486
211 Ga0207668_10015065 3300025972 Bacteria 4798
212 Ga0207668_10090760 3300025972 Bacteria 2243
213 Ga0207640_10045306 3300025981 Bacteria 2824
214 Ga0207658_10139899 3300025986 Bacteria 1957
215 Ga0207658_10378790 3300025986 Bacteria 1239
216 Ga0207677_10028452 3300026023 Bacteria 3535
217 Ga0207677_10435579 3300026023 Bacteria 1120
218 Ga0207639_10261493 3300026041 Bacteria 1514
219 Ga0207678_10029495 3300026067 Bacteria 4788
220 Ga0207678_10041959 3300026067 Bacteria 3966
221 Ga0207678_10261671 3300026067 Bacteria 1482
222 Ga0207678_10370875 3300026067 Bacteria 1236
223 Ga0207702_10140091 3300026078 Bacteria 2187
224 Ga0207702_10232705 3300026078 Bacteria 1723
225 Ga0207641_10213959 3300026088 Bacteria 1784
226 Ga0207641_10319570 3300026088 Bacteria 1472
227 Ga0207648_10063416 3300026089 Bacteria 3221
228 Ga0207648_10179191 3300026089 Bacteria 1875
229 Ga0207648_10462270 3300026089 Bacteria 1157
230 Ga0207648_10634240 3300026089 Bacteria 987
231 Ga0207676_10032534 3300026095 Bacteria 3931
232 Ga0207676_10135482 3300026095 Bacteria 2100
233 Ga0207675_100024363 3300026118 Bacteria 5628
234 Ga0207675_100060324 3300026118 Bacteria 3541
235 Ga0207683_10289750 3300026121 Bacteria 1497
236 Ga0207698_10325690 3300026142 Bacteria 1441
237 Ga0209389_1000161 3300027296 Bacteria 55526
238 Ga0209589_1000103 3300027357 Bacteria 86516
239 Ga0209489_100304 3300027361 Bacteria 86516
240 Ga0268266_10011749 3300028379 Bacteria 7594
241 Ga0268266_10020841 3300028379 Bacteria 5590
242 Ga0268266_10027183 3300028379 Bacteria 4866
243 Ga0268266_10239769 3300028379 Bacteria 1673
244 Ga0268266_10371567 3300028379 Bacteria 1347
245 Ga0268265_10020343 3300028380 Bacteria 4631
246 Ga0268265_10137061 3300028380 Bacteria 2043
247 Ga0268264_10219845 3300028381 Bacteria 1748
248 Ga0307515_10012007 3300028794 Bacteria 16357
249 Ga0265330_10055090 3300031235 Bacteria 1737
250 Ga0265332_10030006 3300031238 Bacteria 2375
251 Ga0265340_10001209 3300031247 Bacteria 14775
252 Ga0307409_100402749 3300031995 Bacteria 1307
253 Ga0307415_100123096 3300032126 Bacteria 1949
254 Ga0307510_10035286 3300033180 Bacteria 5588
255 Ga0307510_10089059 3300033180 Bacteria 2941
256 Ga0373934_0003939 3300035086 Bacteria 5458
257 Ga0373936_0010427 3300035113 Bacteria 3506
258 Ga0373936_0020794 3300035113 Bacteria 2551
259 Ga0373953_0000259 3300035117 Bacteria 14369
260 Ga0373954_0000249 3300035118 Bacteria 19692
261 Ga0373956_0018532 3300035119 Bacteria 2948
262 Ga0373957_0003088 3300035120 Bacteria 4855
263 Ga0373943_0003923 3300035170 Bacteria 6772
264 Ga0373946_0005379 3300035171 Bacteria 4615
265 Ga0373955_0009036 3300035172 Bacteria 4652
266 Ga0373924_0003664 3300035410 Bacteria 5298
267 Ga0373931_0021849 3300035691 Bacteria 3214
268 Ga0373931_0145012 3300035691 Bacteria 1379
269 Ga0373935_0000434 3300035692 Bacteria 21781
270 Ga0373935_0112742 3300035692 Bacteria 1807
271 Ga0373927_0003717 3300035695 Bacteria 10844
272 Ga0373927_0018294 3300035695 Bacteria 4605
273 Ga0373927_0163883 3300035695 Bacteria 1457
274 Ga0373933_0001831 3300035724 Bacteria 12311
275 Ga0373933_0346076 3300035724 Bacteria 965
276 Ga0373947_0003045 3300035725 Bacteria 9971
277 Ga0373947_0212569 3300035725 Bacteria 1269
278 Ga0373937_0171393 3300036401 Bacteria 2036
279 Ga0373925_0006130 3300037068 Bacteria 8881
280 Ga0373925_0458817 3300037068 Bacteria 1044
281 Ga0395900_0000696 3300037418 Bacteria 44867
282 Ga0395900_0350891 3300037418 Bacteria 1449
283 Ga0395898_0035004 3300037466 Bacteria 4998
284 Ga0395898_0107104 3300037466 Bacteria 2680
285 Ga0395905_0036154 3300037471 Bacteria 4638
286 Ga0395905_0654254 3300037471 Bacteria 953
287 Ga0395901_0048644 3300038443 Bacteria 4404
288 Ga0436365_0801382 3300039437 Bacteria 1196
289 Ga0436361_0327284 3300039447 Bacteria 2481
290 Ga0451797_1195647 3300041453 Bacteria 1069
291 Ga0466969_0030684 3300044656 Bacteria 2739
292 Ga0466972_0001053 3300044658 Bacteria 13231
293 Ga0466972_0037257 3300044658 Bacteria 2377
294 Ga0466966_0000137 3300044684 Bacteria 46695
295 Ga0466961_0000039 3300044693 Bacteria 79787
296 Ga0466963_0001672 3300044694 Bacteria 12090
297 Ga0466968_0005199 3300044735 Bacteria 4872
298 Ga0466970_0074283 3300044765 Bacteria 1830
299 Ga0466957_0090202 3300044842 Bacteria 1920
300 Ga0466960_0003772 3300044901 Bacteria 5865
301 Ga0466960_0043701 3300044901 Bacteria 2133
302 Ga0466959_0001594 3300045049 Bacteria 13987
303 Ga0466959_0249432 3300045049 Bacteria 1225
304 Ga0466967_0068542 3300045976 Bacteria 3168
305 Ga0466967_0212731 3300045976 Bacteria 1834
306 Ga0466967_0614173 3300045976 Bacteria 1074
307 Ga0495592_0011025 3300046454 Bacteria 6820
308 Ga0495592_0011508 3300046454 Bacteria 6696
309 Ga0495592_0172975 3300046454 Bacteria 1477
310 Ga0495592_0255347 3300046454 Bacteria 1157
311 Ga0495603_0000189 3300046455 Bacteria 32189
312 Ga0495603_0021216 3300046455 Bacteria 3932
313 Ga0495603_0127912 3300046455 Bacteria 1480
314 Ga0495603_0146563 3300046455 Bacteria 1372
315 Ga0495629_0000268 3300046459 Bacteria 45291
316 Ga0495629_0001490 3300046459 Bacteria 18421
317 Ga0495629_0031949 3300046459 Bacteria 3727
318 Ga0495638_0013239 3300046460 Bacteria 5625
319 Ga0495638_0019032 3300046460 Bacteria 4547
320 Ga0495638_0069119 3300046460 Bacteria 2164
321 Ga0495638_0077661 3300046460 Bacteria 2021
322 Ga0495641_0002442 3300046461 Bacteria 14667
323 Ga0495651_0011203 3300046462 Bacteria 6891
324 Ga0495653_0000300 3300046463 Bacteria 40108
325 Ga0495580_0006330 3300046472 Bacteria 9662
326 Ga0495582_0000144 3300046473 Bacteria 38436
327 Ga0495605_0184778 3300046474 Bacteria 915
328 Ga0495639_0000067 3300046475 Bacteria 47932
329 Ga0495662_0000005 3300046476 Bacteria 81157
330 Ga0495664_0052227 3300046477 Bacteria 2428
331 Ga0495584_0144600 3300046491 Bacteria 1208
332 Ga0495594_0000102 3300046499 Bacteria 39784
333 Ga0495594_0044547 3300046499 Bacteria 2434
334 Ga0495607_0111811 3300046501 Bacteria 1447
335 Ga0495607_0173690 3300046501 Bacteria 1086
336 Ga0495583_0043017 3300046506 Bacteria 2106
337 Ga0495606_0000858 3300046507 Bacteria 45651
338 Ga0495608_0000255 3300046511 Bacteria 38655
339 Ga0495608_0040269 3300046511 Bacteria 3131
340 Ga0495610_0062316 3300046512 Bacteria 1769
341 Ga0495610_0074333 3300046512 Bacteria 1577
342 Ga0495618_0039068 3300046514 Bacteria 2984
343 Ga0495620_0025893 3300046515 Bacteria 2767
344 Ga0495628_0036326 3300046516 Bacteria 3955
345 Ga0495628_0040804 3300046516 Bacteria 3707
346 Ga0495630_0014512 3300046517 Bacteria 5740
347 Ga0495643_0111638 3300046522 Bacteria 1389
348 Ga0495644_0026625 3300046523 Bacteria 2193
349 Ga0495648_0000382 3300046524 Bacteria 48626
350 Ga0495648_0050531 3300046524 Bacteria 2539
351 Ga0495648_0074678 3300046524 Bacteria 1952
352 Ga0495666_0104893 3300046526 Bacteria 1330
353 Ga0495652_0007246 3300046529 Bacteria 10238
354 Ga0495652_0048270 3300046529 Bacteria 3649
355 Ga0495652_0106931 3300046529 Bacteria 2258
356 Ga0495665_0000935 3300046531 Bacteria 15397
357 Ga0495640_0005833 3300046533 Bacteria 9779
358 Ga0495640_0012005 3300046533 Bacteria 6638
359 Ga0495640_0048180 3300046533 Bacteria 2946
360 Ga0495586_0328668 3300046535 Bacteria 877
361 Ga0495587_0008775 3300046536 Bacteria 6485
362 Ga0495587_0013918 3300046536 Bacteria 5051
363 Ga0495597_0107671 3300046542 Bacteria 1171
364 Ga0495597_0121699 3300046542 Bacteria 1087
365 Ga0495645_0027614 3300046543 Bacteria 4124
366 Ga0495645_0072463 3300046543 Bacteria 2482
367 Ga0495622_0000649 3300046557 Bacteria 19833
368 Ga0495622_0008376 3300046557 Bacteria 4787
369 Ga0495667_0000121 3300046559 Bacteria 56223
370 Ga0495667_0013372 3300046559 Bacteria 5555
371 Ga0495656_0086448 3300046615 Bacteria 1426
372 Ga0495668_0207077 3300046616 Bacteria 1074
373 Ga0495634_0001407 3300046642 Bacteria 21535
374 Ga0495634_0051027 3300046642 Bacteria 2776
375 Ga0495625_0188236 3300046660 Bacteria 1369
376 Ga0495635_0000072 3300046663 Bacteria 62736
377 Ga0495635_0002392 3300046663 Bacteria 12785
378 Ga0495635_0037151 3300046663 Bacteria 3372
379 Ga0495635_0050480 3300046663 Bacteria 2867
380 Ga0495661_0029665 3300046665 Bacteria 3489
381 Ga0495588_0002782 3300046674 Bacteria 7516
382 Ga0495588_0010392 3300046674 Bacteria 4329
383 Ga0495588_0046101 3300046674 Bacteria 2236
384 Ga0495588_0109722 3300046674 Bacteria 1453
385 Ga0495657_0004271 3300046675 Bacteria 11423
386 Ga0495657_0111504 3300046675 Bacteria 1732
387 Ga0495599_0007431 3300046678 Bacteria 6644
388 Ga0495599_0174472 3300046678 Bacteria 1326
389 Ga0495623_0010400 3300046679 Bacteria 6021
390 Ga0495646_0007628 3300046680 Bacteria 6875
391 Ga0495646_0061399 3300046680 Bacteria 2238
392 Ga0495647_0002197 3300046681 Bacteria 6102
393 Ga0495658_0000439 3300046683 Bacteria 23198
394 Ga0495669_0017393 3300046684 Bacteria 3086
395 Ga0495669_0063308 3300046684 Bacteria 1678
396 Ga0495613_0001828 3300046689 Bacteria 16171
397 Ga0495613_0055857 3300046689 Bacteria 2900
398 Ga0495613_0154119 3300046689 Bacteria 1637
399 Ga0495613_0262260 3300046689 Bacteria 1203
400 Ga0495624_0000460 3300046690 Bacteria 31973
401 Ga0495600_0001929 3300046809 Bacteria 11644
402 Ga0495600_0014429 3300046809 Bacteria 4980
403 Ga0495660_0115625 3300046810 Bacteria 1364
404 Ga0495581_0000084 3300047315 Bacteria 38216
405 Ga0495581_0127057 3300047315 Bacteria 1485
406 Ga0495604_0002223 3300047317 Bacteria 15540
407 Ga0495604_0010947 3300047317 Bacteria 7201
408 Ga0495604_0061619 3300047317 Bacteria 2868
409 Ga0495674_0004128 3300047319 Bacteria 14021
410 Ga0495674_0019201 3300047319 Bacteria 6350
411 Ga0495674_0192303 3300047319 Bacteria 1695
412 Ga0495672_0021500 3300047320 Bacteria 4207
413 Ga0495672_0097821 3300047320 Bacteria 1597
414 Ga0495676_0006985 3300047321 Bacteria 10361
415 Ga0495680_0001208 3300047322 Bacteria 28311
416 Ga0495680_0005809 3300047322 Bacteria 11550
417 Ga0495687_130376 3300047443 Bacteria 891
418 Ga0495675_0010221 3300047444 Bacteria 5856
419 Ga0495675_0070404 3300047444 Bacteria 2208
420 Ga0495673_0066228 3300047469 Bacteria 1532
421 Ga0495684_0000594 3300047471 Bacteria 29100
422 Ga0495684_0036127 3300047471 Bacteria 3789
423 Ga0495686_0093532 3300047472 Bacteria 1823
424 Ga0495593_0000038 3300047673 Bacteria 53141
425 Ga0495593_0000109 3300047673 Bacteria 38355
426 Ga0495593_0021842 3300047673 Bacteria 3571
427 Ga0495602_0025029 3300048088 Bacteria 5783
428 Ga0495602_0234433 3300048088 Bacteria 1376
429 Ga0496100_0014354 3300048903 Bacteria 4598
430 Ga0496100_0083660 3300048903 Bacteria 2161
431 Ga0496100_0151677 3300048903 Bacteria 1654
432 Ga0496101_0004551 3300048904 Bacteria 8756
433 Ga0496101_0005097 3300048904 Bacteria 8353
434 Ga0496101_0162068 3300048904 Bacteria 1715
435 Ga0496102_0030130 3300048905 Bacteria 4856
436 Ga0496102_0067141 3300048905 Bacteria 3289
437 Ga0496102_0150978 3300048905 Bacteria 2183
438 Ga0496102_0222523 3300048905 Bacteria 1779
439 Ga0496102_0246787 3300048905 Bacteria 1683
440 Ga0496102_0363315 3300048905 Bacteria 1363
441 Ga0496103_0164558 3300048906 Bacteria 1423
442 Ga0496103_0271318 3300048906 Bacteria 1091
443 Ga0496104_0010015 3300048907 Bacteria 8460
444 Ga0496104_0025881 3300048907 Bacteria 5411
445 Ga0496104_0116175 3300048907 Bacteria 2568
446 Ga0496105_0016080 3300048908 Bacteria 5968
447 Ga0496105_0106523 3300048908 Bacteria 2314
448 Ga0496106_0005291 3300048909 Bacteria 9565
449 Ga0496106_0047592 3300048909 Bacteria 3228
450 Ga0496106_0067572 3300048909 Bacteria 2725
451 Ga0496106_0315860 3300048909 Bacteria 1254
452 Ga0496106_0419485 3300048909 Bacteria 1075
453 Ga0496107_0023956 3300048910 Bacteria 4315
454 Ga0496107_0159094 3300048910 Bacteria 1673
455 Ga0496108_0036900 3300048911 Bacteria 4068
456 Ga0496108_0675490 3300048911 Bacteria 897
457 Ga0496109_0230011 3300048912 Bacteria 1744
458 Ga0496109_0380920 3300048912 Bacteria 1333
459 Ga0496110_0010473 3300048913 Bacteria 7543
460 Ga0496110_0026129 3300048913 Bacteria 4993
461 Ga0496110_0083738 3300048913 Bacteria 2846
462 Ga0496110_0137677 3300048913 Bacteria 2207
463 Ga0496110_0189228 3300048913 Bacteria 1869
464 Ga0496110_0281664 3300048913 Bacteria 1514
465 Ga0496110_0636985 3300048913 Bacteria 965
466 Ga0496111_0051658 3300048914 Bacteria 2967
467 Ga0496111_0534285 3300048914 Bacteria 862
468 Ga0496112_0000065 3300048915 Bacteria 70119
469 Ga0496112_0212900 3300048915 Bacteria 1889
470 Ga0496112_0285337 3300048915 Bacteria 1597
471 Ga0496112_0309949 3300048915 Bacteria 1523
472 Ga0496112_0394288 3300048915 Bacteria 1324
473 Ga0496112_0598785 3300048915 Bacteria 1034
474 Ga0496113_0006834 3300048916 Bacteria 7276
475 Ga0496113_0116439 3300048916 Bacteria 2085
476 Ga0496113_0178563 3300048916 Bacteria 1683
477 Ga0496113_0375907 3300048916 Bacteria 1140
478 Ga0496114_0016363 3300048917 Bacteria 5974
479 Ga0496115_0018231 3300048918 Bacteria 5385
480 Ga0496115_0033662 3300048918 Bacteria 4047
481 Ga0496116_0009854 3300048919 Bacteria 8085
482 Ga0496116_0011726 3300048919 Bacteria 7222
483 Ga0496116_0205825 3300048919 Bacteria 1025
484 Ga0496117_0086289 3300048920 Bacteria 2040
485 Ga0496117_0117523 3300048920 Bacteria 1641
486 Ga0496117_0134676 3300048920 Bacteria 1491
487 Ga0496118_0021615 3300048921 Bacteria 5656
488 Ga0496118_0063550 3300048921 Bacteria 2715
489 Ga0496118_0094591 3300048921 Bacteria 2043
490 Ga0496119_0007073 3300048922 Bacteria 10207
491 Ga0496119_0022737 3300048922 Bacteria 4477
492 Ga0496119_0079633 3300048922 Bacteria 1892
493 Ga0496120_0016701 3300048923 Bacteria 4788
494 Ga0496120_0023248 3300048923 Bacteria 3882
495 Ga0496121_0002554 3300048924 Bacteria 27574
496 Ga0496121_0033524 3300048924 Bacteria 4645
497 Ga0496121_0090747 3300048924 Bacteria 2387
498 Ga0496121_0139985 3300048924 Bacteria 1797
499 Ga0496121_0178700 3300048924 Bacteria 1534
500 Ga0496121_0189252 3300048924 Bacteria 1477
501 Ga0496123_0020379 3300048926 Bacteria 5188
502 Ga0496124_0174964 3300048927 Bacteria 1658
503 Ga0496125_0000904 3300048928 Bacteria 46904
504 Ga0496125_0004420 3300048928 Bacteria 16237
505 Ga0496125_0046908 3300048928 Bacteria 3619
506 Ga0496125_0093476 3300048928 Bacteria 2244
507 Ga0496126_0059273 3300048929 Bacteria 3447
508 Ga0496126_0070519 3300048929 Bacteria 3113
509 Ga0496126_0076086 3300048929 Bacteria 2978
510 Ga0496126_0088464 3300048929 Bacteria 2728
511 Ga0496126_0237057 3300048929 Bacteria 1526
512 Ga0496126_0304006 3300048929 Bacteria 1315
513 Ga0501034_0080710 3300049571 Bacteria 3256
514 Ga0501039_0406802 3300049575 Bacteria 1069
515 Ga0501046_0060206 3300049580 Bacteria 2972
516 Ga0501047_0275591 3300049581 Bacteria 1528
517 Ga0501067_0022379 3300049583 Bacteria 3498
518 Ga0501044_0434669 3300049823 Bacteria 1221
519 nmdc:mga03n38_45605_c1 3300050490 Bacteria 1931
520 nmdc:mga0yw44_13913_c1 3300050492 Bacteria 4253
521 nmdc:mga06z11_168018_c1 3300050494 Bacteria 1258
522 nmdc:mga07m45_137617_c1 3300050496 Bacteria 1414
523 nmdc:mga08y16_30607_c1 3300050511 Bacteria 5663
524 nmdc:mga0a205_287959_c1 3300050515 Bacteria 1517
525 nmdc:mga0sz30_185344_c1 3300050516 Bacteria 924
526 Ga0500635_0046689 3300053080 Bacteria 1469
527 Ga0495619_0010257 3300053085 Bacteria 5898
528 Ga0495619_0042088 3300053085 Bacteria 2990
529 Ga0495619_0255899 3300053085 Bacteria 1213
530 Ga0500643_006068 3300053087 Bacteria 5105
531 Ga0500643_022242 3300053087 Bacteria 2044
532 Ga0500646_0006123 3300053090 Bacteria 3057
533 Ga0500651_0008259 3300053093 Bacteria 6117
534 Ga0500651_0009030 3300053093 Bacteria 5899
535 Ga0500566_0000029 3300053094 Bacteria 75384
536 Ga0500566_0000139 3300053094 Bacteria 37343
537 Ga0500566_0078766 3300053094 Bacteria 1838
538 Ga0500640_100312 3300053095 Bacteria 1197
539 Ga0500641_0024716 3300053096 Bacteria 2318
540 Ga0500641_0083833 3300053096 Bacteria 1355
541 Ga0500650_0004684 3300053098 Bacteria 4985
542 Ga0500554_005453 3300053102 Bacteria 2775
543 Ga0500555_003871 3300053103 Bacteria 4258
544 Ga0500556_0000019 3300053104 Bacteria 186017
545 Ga0500569_000516 3300053109 Bacteria 6443
546 Ga0500569_000864 3300053109 Bacteria 5377
547 Ga0500572_018341 3300053111 Bacteria 1811
548 Ga0500592_006645 3300053116 Bacteria 1841
549 Ga0500595_001557 3300053119 Bacteria 12138
550 Ga0500595_002157 3300053119 Bacteria 10008
551 Ga0500595_012821 3300053119 Bacteria 3227
552 Ga0500595_016051 3300053119 Bacteria 2796
553 Ga0500608_035435 3300053122 Bacteria 2380
554 Ga0500614_032696 3300053123 Bacteria 1281
555 Ga0500642_0000039 3300053130 Bacteria 98235
556 Ga0500642_0002118 3300053130 Bacteria 5770
557 Ga0500642_0026140 3300053130 Bacteria 2379
558 Ga0500642_0028540 3300053130 Bacteria 2303
559 Ga0500652_001066 3300053131 Bacteria 8907
560 Ga0500655_030790 3300053133 Bacteria 1033
561 Ga0500658_0009611 3300053134 Bacteria 3565
562 Ga0500568_0001467 3300053139 Bacteria 15123
563 Ga0500568_0008598 3300053139 Bacteria 4906
564 Ga0500568_0010187 3300053139 Bacteria 4417
565 Ga0500577_0034909 3300053142 Bacteria 1790
566 Ga0500577_0092177 3300053142 Bacteria 1226
567 Ga0500585_119091 3300053144 Bacteria 942
568 Ga0500589_147594 3300053147 Bacteria 961
569 Ga0500603_002683 3300053150 Bacteria 3874
570 Ga0500604_0025269 3300053151 Bacteria 1706
571 Ga0500616_0000038 3300053153 Bacteria 386801
572 Ga0500616_0000059 3300053153 Bacteria 259741
573 Ga0500616_0015647 3300053153 Bacteria 4331
574 Ga0500619_045425 3300053154 Bacteria 1404
575 Ga0500620_054428 3300053155 Bacteria 1349
576 Ga0500620_063319 3300053155 Bacteria 1263
577 Ga0500622_0015463 3300053156 Bacteria 4084
578 Ga0500622_0185245 3300053156 Bacteria 958
579 Ga0500627_0117092 3300053158 Bacteria 1201
580 Ga0500627_0128272 3300053158 Bacteria 1145
581 Ga0500634_0143339 3300053161 Bacteria 1128
582 Ga0500638_116171 3300053162 Bacteria 1230
583 Ga0500639_007050 3300053163 Bacteria 5827
584 Ga0500636_0000563 3300053177 Bacteria 20246
585 Ga0500636_0012647 3300053177 Bacteria 4948
586 Ga0500570_087710 3300053724 Bacteria 1370
587 Ga0500625_090653 3300053729 Bacteria 1309
588 Ga0500609_002302 3300053731 Bacteria 2727
589 Ga0500599_000667 3300053736 Bacteria 3689
590 Ga0500601_000189 3300053737 Bacteria 12584
591 2507505607 2507262055 Bacteria 8048963
592 2508539500 2508501009 Bacteria 7784016
593 2508695869 2508501042 Bacteria 8719808
594 2511401125 2511231028 Bacteria 8046582
595 2513628936 2513237092 Bacteria 8341956
596 2513642279 2513237094 Bacteria 8789602
597 2513652784 2513237095 Bacteria 8976980
598 2513673923 2513237098 Bacteria 9902361
599 2513700410 2513237102 Bacteria 7703324
600 2513718815 2513237104 Bacteria 10034502
601 2513876952 2513237139 Bacteria 8737671
602 2514016072 2513237161 Bacteria 8871253
603 2515624006 2515154112 Bacteria 8294334
604 2517105903 2517093001 Bacteria 9002274
605 2524440060 2524023205 Bacteria 8918781
606 2524468373 2524023210 Bacteria 9029266
607 2528852092 2528768022 Bacteria 10457665
608 2603862313 2602042107 Bacteria 6226103
609 2617353230 2617270735 Bacteria 9163226
610 2617377276 2617270741 Bacteria 8201522
611 2644290715 2643221651 Bacteria 4798932
612 2745077828 2744054633 Bacteria 8678936
613 2793065620 2791355196 Bacteria 7323613
614 2793065939 2791355196 Bacteria 7323613
615 2805921253 2802429603 Bacteria 8777136
616 2818239236 2816332527 Bacteria 8933356
617 2824624894 2824617872 Bacteria 8814715
618 2824631754 2824626560 Bacteria 8813858
619 2824657433 2824653114 Bacteria 8493680
620 2824670451 2824661429 Bacteria 9877870
621 2824685545 2824679649 Bacteria 8248951
622 2824694169 2824687955 Bacteria 8360029
623 2824729549 2824723954 Bacteria 8758240
624 2824762093 2824753945 Bacteria 9787441
625 2824772412 2824763712 Bacteria 9792355
626 2824777503 2824773399 Bacteria 8360218
627 2838125737 2838122688 Bacteria 8803140
628 2841947948 2841941048 Bacteria 8688029
629 2841957045 2841949485 Bacteria 8680857
630 2841965138 2841957949 Bacteria 8652217
631 2841972776 2841966195 Bacteria 8673214
632 2841977554 2841974524 Bacteria 8931498
633 2841984889 2841983080 Bacteria 8395090
634 2842041345 2842038055 Bacteria 8002051
635 2842049387 2842045827 Bacteria 8006841
636 2844315842 2844315083 Bacteria 8138177
637 2847942655 2847939898 Bacteria 8606328
638 2857515616 2857509624 Bacteria 7472071
639 2857525799 2857524615 Bacteria 6615449
640 2874591116 2874590934 Bacteria 8299676
641 2874617131 2874612657 Bacteria 8252029
642 2874621362 2874620515 Bacteria 8290088
643 2874636781 2874628541 Bacteria 8630250
644 2874647753 2874645413 Bacteria 8214782
645 2876764041 2876761206 Bacteria 10111113
646 2876772043 2876771140 Bacteria 8287509
647 2876819300 2876818435 Bacteria 8274608
648 2879074960 2879074833 Bacteria 8279565
649 2879106718 2879099564 Bacteria 10442239
650 2879135779 2879127579 Bacteria 8294491
651 2879150948 2879142872 Bacteria 8267021
652 2881367126 2881364244 Bacteria 7710352
653 2881668409 2881665667 Bacteria 8175609
654 2885368700 2885366525 Bacteria 8326213
655 2885411198 2885409591 Bacteria 9235467
656 2888379130 2888378607 Bacteria 9652610
657 2888390307 2888388044 Bacteria 7304136
658 2888427528 2888419890 Bacteria 7857137
659 2903730858 2903727486 Bacteria 8281579
660 2903775700 2903768456 Bacteria 9749579
661 2904668032 2904666416 Bacteria 8226587
662 2904714163 2904711408 Bacteria 9771557
663 2906603681 2906602504 Bacteria 8295279
664 2906633195 2906626472 Bacteria 8826946
665 2906648054 2906643746 Bacteria 8722424
666 2919074339 2919073203 Bacteria 6531949
667 2922369137
668 2922400748 2922393267 Bacteria 8285685
669 2929618991 2929615660 Bacteria 9193770
670 2929631068 2929624759 Bacteria 9339455
671 2932789033 2932784394 Bacteria 9704911
672 2932801336 2932794094 Bacteria 7915132
673 2932808849 2932801729 Bacteria 7987968
674 2932814330 2932809354 Bacteria 9135765
675 2932820456 2932818245 Bacteria 9955613
676 2932834488 2932828146 Bacteria 9745859
677 2933580299 2933577622 Bacteria 9116884
678 2935614662 2935608549 Bacteria 8203142
679 2935624471 2935616580 Bacteria 9032984
680 2935645861 2935638405 Bacteria 10015038
681 2935649053 2935648319 Bacteria 8801166
682 2935658175 2935656913 Bacteria 8965014
683 2935673428 2935665750 Bacteria 9571747
684 2935682605 2935675223 Bacteria 9928132
685 2935686781 2935684952 Bacteria 9590419
686 2935701539 2935694250 Bacteria 9291695
687 2935710486 2935703347 Bacteria 10242284
688 2935716469 2935713505 Bacteria 9608509
689 2935723406 2935722832 Bacteria 9608746
690 2935734962 2935732158 Bacteria 9706831
691 2935744247 2935741537 Bacteria 9707219
692 2935752747 2935750917 Bacteria 9590372
693 2935764706 2935760218 Bacteria 9817913
694 2935789157 2935785616 Bacteria 7962367
695 2935796906 2935793552 Bacteria 8012592
696 2935806183 2935801545 Bacteria 9301974
697 2935816949 2935810662 Bacteria 9401221
698 2935826297 2935819856 Bacteria 8261050
699 2935835238 2935827899 Bacteria 10038562
700 2935841380 2935837841 Bacteria 9454360
701 2935853793 2935847175 Bacteria 8228321
702 2935863052 2935855204 Bacteria 9035059
703 2935871862 2935864058 Bacteria 9784707
704 2935882247 2935873716 Bacteria 9632195
705 2935883280 2935883170 Bacteria 7964738
706 2935911014 2935908558 Bacteria 8568796
707 2935924175 2935916978 Bacteria 9113783
708 2935932772 2935926038 Bacteria 8601059
709 2935937335 2935934488 Bacteria 8602579
710 2935949464 2935942939 Bacteria 8599779
711 2935958137 2935951376 Bacteria 8602333
712 2935967227 2935959822 Bacteria 7869783
713 2935971208 2935967501 Bacteria 8603075
714 2935982198 2935975950 Bacteria 8347125
715 2935985337 2935984226 Bacteria 8302647
716 2936000182 2935992306 Bacteria 9802711
717 2936010096 2936002035 Bacteria 9362176
718 2936012394 2936011229 Bacteria 8801034
719 2936020525 2936019824 Bacteria 8804134
720 2936029687 2936028420 Bacteria 8965941
721 2936043940 2936037263 Bacteria 9446081
722 2936051848 2936046547 Bacteria 8903709
723 2936056899 2936055302 Bacteria 8785755
724 2940558660 2940556831 Bacteria 9590747
725 2941535693 2941531003 Bacteria 7653939
726 2941543606 2941538514 Bacteria 9402094
727 3005486391 3005483717 Bacteria 7877331
728 3005506268 3005506211 Bacteria 6943378
729 3005589048 3005587118 Bacteria 7794411
730 3005595426 3005594810 Bacteria 8716512
731 3005711387 3005710791 Bacteria 7622528
732 3005718660 3005718088 Bacteria 8283608
733 8006931167 8006926726 Bacteria 6749210
734 8016517769 8016511872 Bacteria 9921665
735 8016525830 8016522445 Bacteria 8156687
736 8016539433 8016530956 Bacteria 8155261
737 8016549572 8016548790 Bacteria 8155074
738 8016569123 8016566248 Bacteria 8158151
739 8016581760 8016575299 Bacteria 8154085
740 8016585942 8016583857 Bacteria 10421953
741 8016596008 8016595262 Bacteria 8149947
742 8016606882 8016603502 Bacteria 8731218
743 8017058861 8017057580 Bacteria 10023680
744 8019530713 8019530166 Bacteria 8155624
745 8019540872 8019538911 Bacteria 7872763
746 8019549743 8019547302 Bacteria 7996444
747 8019576790 8019576017 Bacteria 10049540
748 8019594846 8019586578 Bacteria 10212056
749 8019606893 8019597564 Bacteria 10041141
750 8019611615 8019608314 Bacteria 10042931
751 8019623346 8019619141 Bacteria 9218857
752 8019640867 8019638758 Bacteria 9062356
753 8019652963 8019648815 Bacteria 10014479
754 8019666592 8019659431 Bacteria 8577854
755 8019676331 8019668869 Bacteria 8791617
756 8019679666 8019678201 Bacteria 8863603
757 8019695801 8019687851 Bacteria 8712826
758 8055742840 8055742211 Bacteria 9226248
759 8056975626 8056967851 Bacteria 9038162
760 Ga0207665_10305035
761 JGI25165J46597_1009332
762 JGI25153J46596_10003051
763 JGI25153J46596_10004570
764 JGI25153J46596_10006145
765 JGI25153J46596_10011665
766 JGI25153J46596_10037172
767 JGI25160J50197_1001574
768 JGI25160J50197_1001779
769 JGI25404J52841_10004554
770 Ga0055531_10005617
771 Ga0065165_1005041
772 Ga0070658_10026144
773 Ga0070676_10065637
774 Ga0070690_100046706
775 Ga0068869_100098356
776 Ga0068869_100187122
777 Ga0070666_10267489
778 Ga0070680_100171374
779 Ga0070682_100129177
780 Ga0068868_100023606
781 Ga0070660_100023921
782 Ga0070661_100270881
783 Ga0070668_100034627
784 Ga0070668_100133435
785 Ga0070671_100207274
786 Ga0070673_100413478
787 Ga0070688_100381699
788 Ga0070659_100022001
789 Ga0070659_100399672
790 Ga0070667_100064979
791 Ga0070667_100466714
792 Ga0070709_10001043
793 Ga0070709_10002120
794 Ga0070714_100040555
795 Ga0070713_100014537
796 Ga0070713_100017000
797 Ga0070713_100030913
798 Ga0070713_100122498
799 Ga0070710_10001640
800 Ga0070710_10038234
801 Ga0070711_100040459
802 Ga0070663_100109435
803 Ga0070663_100281085
804 Ga0070663_100333944
805 Ga0068867_100510338
806 Ga0070685_10347712
807 Ga0070679_100296853
808 Ga0070684_100027981
809 Ga0068853_100224076
810 Ga0070672_100012411
811 Ga0070672_100130698
812 Ga0070693_100252828
813 Ga0070665_100063043
814 Ga0070665_100140122
815 Ga0070665_100315868
816 Ga0070665_100329221
817 Ga0068855_100025627
818 Ga0068855_100212587
819 Ga0070664_100150931
820 Ga0070664_100359423
821 Ga0068857_100108211
822 Ga0068854_100152216
823 Ga0068854_100372222
824 Ga0070702_100069289
825 Ga0068852_100151120
826 Ga0068852_100293463
827 Ga0068859_100104583
828 Ga0068859_100311133
829 Ga0068864_100069630
830 Ga0068861_100058920
831 Ga0068861_100144444
832 Ga0068863_100302870
833 Ga0068858_100099371
834 Ga0068858_100109449
835 Ga0068860_100211678
836 Ga0068862_100153267
837 Ga0068862_100168984
838 Ga0081455_10005919
839 Ga0081455_10061026
840 Ga0081540_1008966
841 Ga0081540_1009964
842 Ga0081540_1014575
843 Ga0081539_10042554
844 Ga0070717_10001143
845 Ga0070717_10047973
846 Ga0070717_10289195
847 Ga0075365_10068554
848 Ga0075365_10283760
849 Ga0075364_10046309
850 Ga0070715_10002760
851 Ga0070716_100007223
852 Ga0070716_100042884
853 Ga0070712_100006152
854 Ga0070712_100182258
855 Ga0075366_10002600
856 Ga0097621_100329117
857 Ga0068871_100104701
858 Ga0097620_100104575
859 Ga0097620_100311137
860 Ga0099824_1012187
861 Ga0105240_10005129
862 Ga0105240_10035009
863 Ga0105245_10222206
864 Ga0105245_10298809
865 Ga0105247_10220530
866 Ga0105243_10134417
867 Ga0105241_10014074
868 Ga0105241_10047814
869 Ga0105237_10013514
870 Ga0105238_10694036
871 Ga0105249_10164886
872 Ga0105239_10024829
873 Ga0105239_10179264
874 Ga0105239_10488087
875 Ga0105239_10690001
876 Ga0105246_10179142
877 Ga0105246_10378322
878 Ga0157370_10093494
879 Ga0157369_10013512
880 Ga0157374_10364765
881 Ga0163162_10291947
882 Ga0163162_10300490
883 Ga0157375_10025269
884 Ga0157375_10165233
885 Ga0163163_10052116
886 Ga0163163_10133233
887 Ga0157377_10133500
888 Ga0157377_10176179
889 Ga0157377_10400498
890 Ga0157376_10145982
891 Ga0157376_10150868
892 Ga0163161_10036195
893 Ga0206353_10623774
894 Ga0214544_1000087
895 Ga0214542_1000018
896 Ga0214545_1000009
897 Ga0214543_1000037
898 Ga0209563_104871
899 Ga0209677_105069
900 Ga0209148_1002285
901 Ga0209233_1005177
902 Ga0209233_1013010
903 Ga0209455_1003892
904 Ga0209455_1006163
905 Ga0209673_1028217
906 Ga0209564_1003384
907 Ga0209564_1007864
908 Ga0209758_1000030
909 Ga0209758_1000884
910 Ga0209758_1000949
911 Ga0209758_1006161
912 Ga0209758_1007096
913 Ga0209758_1010276
914 Ga0209758_1011559
915 Ga0209758_1017944
916 Ga0209758_1022776
917 Ga0209256_1016593
918 Ga0207426_1001522
919 Ga0207426_1015480
920 Ga0209257_1003355
921 Ga0207692_10004318
922 Ga0207692_10016120
923 Ga0207647_10019817
924 Ga0207699_10000360
925 Ga0207699_10013541
926 Ga0207645_10107781
927 Ga0207705_10142379
928 Ga0207654_10013203
929 Ga0207654_10204600
930 Ga0207654_10255164
931 Ga0207707_10111344
932 Ga0207695_10000059
933 Ga0207695_10245684
934 Ga0207671_10094291
935 Ga0207671_10235667
936 Ga0207671_10360461
937 Ga0207693_10000073
938 Ga0207693_10059536
939 Ga0207663_10000861
940 Ga0207660_10020024
941 Ga0207657_10004881
942 Ga0207652_10181195
943 Ga0207646_10473353
944 Ga0207687_10105091
945 Ga0207687_10167300
946 Ga0207700_10034750
947 Ga0207700_10052688
948 Ga0207700_10102804
949 Ga0207664_10023264
950 Ga0207664_10027950
951 Ga0207664_10209929
952 Ga0207664_10344058
953 Ga0207644_10492611
954 Ga0207690_10074693
955 Ga0207709_10104454
956 Ga0207669_10029822
957 Ga0207704_10163511
958 Ga0207665_10000629
959 Ga0207665_10045899
960 Ga0207691_10187098
961 Ga0207689_10061122
962 Ga0207661_10551095
963 Ga0207679_10204384
964 Ga0207667_10019657
965 Ga0207667_10079342
966 Ga0207667_10275853
967 Ga0207667_10302771
968 Ga0207651_10382497
969 Ga0207712_10230685
970 Ga0207668_10015065
971 Ga0207668_10090760
972 Ga0207640_10045306
973 Ga0207658_10139899
974 Ga0207658_10378790
975 Ga0207677_10028452
976 Ga0207677_10435579
977 Ga0207639_10261493
978 Ga0207678_10029495
979 Ga0207678_10041959
980 Ga0207678_10261671
981 Ga0207678_10370875
982 Ga0207702_10140091
983 Ga0207702_10232705
984 Ga0207641_10213959
985 Ga0207641_10319570
986 Ga0207648_10063416
987 Ga0207648_10179191
988 Ga0207648_10462270
989 Ga0207648_10634240
990 Ga0207676_10032534
991 Ga0207676_10135482
992 Ga0207675_100024363
993 Ga0207675_100060324
994 Ga0207683_10289750
995 Ga0207698_10325690
996 Ga0209389_1000161
997 Ga0209589_1000103
998 Ga0209489_100304
999 Ga0268266_10011749
1000 Ga0268266_10020841
1001 Ga0268266_10027183
1002 Ga0268266_10239769
1003 Ga0268266_10371567
1004 Ga0268265_10020343
1005 Ga0268265_10137061
1006 Ga0268264_10219845
1007 Ga0307515_10012007
1008 Ga0265330_10055090
1009 Ga0265332_10030006
1010 Ga0265340_10001209
1011 Ga0307409_100402749
1012 Ga0307415_100123096
1013 Ga0307510_10035286
1014 Ga0307510_10089059
1015 Ga0373934_0003939
1016 Ga0373936_0010427
1017 Ga0373936_0020794
1018 Ga0373953_0000259
1019 Ga0373954_0000249
1020 Ga0373956_0018532
1021 Ga0373957_0003088
1022 Ga0373943_0003923
1023 Ga0373946_0005379
1024 Ga0373955_0009036
1025 Ga0373924_0003664
1026 Ga0373931_0021849
1027 Ga0373931_0145012
1028 Ga0373935_0000434
1029 Ga0373935_0112742
1030 Ga0373927_0003717
1031 Ga0373927_0018294
1032 Ga0373927_0163883
1033 Ga0373933_0001831
1034 Ga0373933_0346076
1035 Ga0373947_0003045
1036 Ga0373947_0212569
1037 Ga0373937_0171393
1038 Ga0373925_0006130
1039 Ga0373925_0458817
1040 Ga0395900_0000696
1041 Ga0395900_0350891
1042 Ga0395898_0035004
1043 Ga0395898_0107104
1044 Ga0395905_0036154
1045 Ga0395905_0654254
1046 Ga0395901_0048644
1047 Ga0436365_0801382
1048 Ga0436361_0327284
1049 Ga0451797_1195647
1050 Ga0466969_0030684
1051 Ga0466972_0001053
1052 Ga0466972_0037257
1053 Ga0466966_0000137
1054 Ga0466961_0000039
1055 Ga0466963_0001672
1056 Ga0466968_0005199
1057 Ga0466970_0074283
1058 Ga0466957_0090202
1059 Ga0466960_0003772
1060 Ga0466960_0043701
1061 Ga0466959_0001594
1062 Ga0466959_0249432
1063 Ga0466967_0068542
1064 Ga0466967_0212731
1065 Ga0466967_0614173
1066 Ga0495592_0011025
1067 Ga0495592_0011508
1068 Ga0495592_0172975
1069 Ga0495592_0255347
1070 Ga0495603_0000189
1071 Ga0495603_0021216
1072 Ga0495603_0127912
1073 Ga0495603_0146563
1074 Ga0495629_0000268
1075 Ga0495629_0001490
1076 Ga0495629_0031949
1077 Ga0495638_0013239
1078 Ga0495638_0019032
1079 Ga0495638_0069119
1080 Ga0495638_0077661
1081 Ga0495641_0002442
1082 Ga0495651_0011203
1083 Ga0495653_0000300
1084 Ga0495580_0006330
1085 Ga0495582_0000144
1086 Ga0495605_0184778
1087 Ga0495639_0000067
1088 Ga0495662_0000005
1089 Ga0495664_0052227
1090 Ga0495584_0144600
1091 Ga0495594_0000102
1092 Ga0495594_0044547
1093 Ga0495607_0111811
1094 Ga0495607_0173690
1095 Ga0495583_0043017
1096 Ga0495606_0000858
1097 Ga0495608_0000255
1098 Ga0495608_0040269
1099 Ga0495610_0062316
1100 Ga0495610_0074333
1101 Ga0495618_0039068
1102 Ga0495620_0025893
1103 Ga0495628_0036326
1104 Ga0495628_0040804
1105 Ga0495630_0014512
1106 Ga0495643_0111638
1107 Ga0495644_0026625
1108 Ga0495648_0000382
1109 Ga0495648_0050531
1110 Ga0495648_0074678
1111 Ga0495666_0104893
1112 Ga0495652_0007246
1113 Ga0495652_0048270
1114 Ga0495652_0106931
1115 Ga0495665_0000935
1116 Ga0495640_0005833
1117 Ga0495640_0012005
1118 Ga0495640_0048180
1119 Ga0495586_0328668
1120 Ga0495587_0008775
1121 Ga0495587_0013918
1122 Ga0495597_0107671
1123 Ga0495597_0121699
1124 Ga0495645_0027614
1125 Ga0495645_0072463
1126 Ga0495622_0000649
1127 Ga0495622_0008376
1128 Ga0495667_0000121
1129 Ga0495667_0013372
1130 Ga0495656_0086448
1131 Ga0495668_0207077
1132 Ga0495634_0001407
1133 Ga0495634_0051027
1134 Ga0495625_0188236
1135 Ga0495635_0000072
1136 Ga0495635_0002392
1137 Ga0495635_0037151
1138 Ga0495635_0050480
1139 Ga0495661_0029665
1140 Ga0495588_0002782
1141 Ga0495588_0010392
1142 Ga0495588_0046101
1143 Ga0495588_0109722
1144 Ga0495657_0004271
1145 Ga0495657_0111504
1146 Ga0495599_0007431
1147 Ga0495599_0174472
1148 Ga0495623_0010400
1149 Ga0495646_0007628
1150 Ga0495646_0061399
1151 Ga0495647_0002197
1152 Ga0495658_0000439
1153 Ga0495669_0017393
1154 Ga0495669_0063308
1155 Ga0495613_0001828
1156 Ga0495613_0055857
1157 Ga0495613_0154119
1158 Ga0495613_0262260
1159 Ga0495624_0000460
1160 Ga0495600_0001929
1161 Ga0495600_0014429
1162 Ga0495660_0115625
1163 Ga0495581_0000084
1164 Ga0495581_0127057
1165 Ga0495604_0002223
1166 Ga0495604_0010947
1167 Ga0495604_0061619
1168 Ga0495674_0004128
1169 Ga0495674_0019201
1170 Ga0495674_0192303
1171 Ga0495672_0021500
1172 Ga0495672_0097821
1173 Ga0495676_0006985
1174 Ga0495680_0001208
1175 Ga0495680_0005809
1176 Ga0495687_130376
1177 Ga0495675_0010221
1178 Ga0495675_0070404
1179 Ga0495673_0066228
1180 Ga0495684_0000594
1181 Ga0495684_0036127
1182 Ga0495686_0093532
1183 Ga0495593_0000038
1184 Ga0495593_0000109
1185 Ga0495593_0021842
1186 Ga0495602_0025029
1187 Ga0495602_0234433
1188 Ga0496100_0014354
1189 Ga0496100_0083660
1190 Ga0496100_0151677
1191 Ga0496101_0004551
1192 Ga0496101_0005097
1193 Ga0496101_0162068
1194 Ga0496102_0030130
1195 Ga0496102_0067141
1196 Ga0496102_0150978
1197 Ga0496102_0222523
1198 Ga0496102_0246787
1199 Ga0496102_0363315
1200 Ga0496103_0164558
1201 Ga0496103_0271318
1202 Ga0496104_0010015
1203 Ga0496104_0025881
1204 Ga0496104_0116175
1205 Ga0496105_0016080
1206 Ga0496105_0106523
1207 Ga0496106_0005291
1208 Ga0496106_0047592
1209 Ga0496106_0067572
1210 Ga0496106_0315860
1211 Ga0496106_0419485
1212 Ga0496107_0023956
1213 Ga0496107_0159094
1214 Ga0496108_0036900
1215 Ga0496108_0675490
1216 Ga0496109_0230011
1217 Ga0496109_0380920
1218 Ga0496110_0010473
1219 Ga0496110_0026129
1220 Ga0496110_0083738
1221 Ga0496110_0137677
1222 Ga0496110_0189228
1223 Ga0496110_0281664
1224 Ga0496110_0636985
1225 Ga0496111_0051658
1226 Ga0496111_0534285
1227 Ga0496112_0000065
1228 Ga0496112_0212900
1229 Ga0496112_0285337
1230 Ga0496112_0309949
1231 Ga0496112_0394288
1232 Ga0496112_0598785
1233 Ga0496113_0006834
1234 Ga0496113_0116439
1235 Ga0496113_0178563
1236 Ga0496113_0375907
1237 Ga0496114_0016363
1238 Ga0496115_0018231
1239 Ga0496115_0033662
1240 Ga0496116_0009854
1241 Ga0496116_0011726
1242 Ga0496116_0205825
1243 Ga0496117_0086289
1244 Ga0496117_0117523
1245 Ga0496117_0134676
1246 Ga0496118_0021615
1247 Ga0496118_0063550
1248 Ga0496118_0094591
1249 Ga0496119_0007073
1250 Ga0496119_0022737
1251 Ga0496119_0079633
1252 Ga0496120_0016701
1253 Ga0496120_0023248
1254 Ga0496121_0002554
1255 Ga0496121_0033524
1256 Ga0496121_0090747
1257 Ga0496121_0139985
1258 Ga0496121_0178700
1259 Ga0496121_0189252
1260 Ga0496123_0020379
1261 Ga0496124_0174964
1262 Ga0496125_0000904
1263 Ga0496125_0004420
1264 Ga0496125_0046908
1265 Ga0496125_0093476
1266 Ga0496126_0059273
1267 Ga0496126_0070519
1268 Ga0496126_0076086
1269 Ga0496126_0088464
1270 Ga0496126_0237057
1271 Ga0496126_0304006
1272 Ga0501034_0080710
1273 Ga0501039_0406802
1274 Ga0501046_0060206
1275 Ga0501047_0275591
1276 Ga0501067_0022379
1277 Ga0501044_0434669
1278 nmdc:mga03n38_45605_c1
1279 nmdc:mga0yw44_13913_c1
1280 nmdc:mga06z11_168018_c1
1281 nmdc:mga07m45_137617_c1
1282 nmdc:mga08y16_30607_c1
1283 nmdc:mga0a205_287959_c1
1284 nmdc:mga0sz30_185344_c1
1285 Ga0500635_0046689
1286 Ga0495619_0010257
1287 Ga0495619_0042088
1288 Ga0495619_0255899
1289 Ga0500643_006068
1290 Ga0500643_022242
1291 Ga0500646_0006123
1292 Ga0500651_0008259
1293 Ga0500651_0009030
1294 Ga0500566_0000029
1295 Ga0500566_0000139
1296 Ga0500566_0078766
1297 Ga0500640_100312
1298 Ga0500641_0024716
1299 Ga0500641_0083833
1300 Ga0500650_0004684
1301 Ga0500554_005453
1302 Ga0500555_003871
1303 Ga0500556_0000019
1304 Ga0500569_000516
1305 Ga0500569_000864
1306 Ga0500572_018341
1307 Ga0500592_006645
1308 Ga0500595_001557
1309 Ga0500595_002157
1310 Ga0500595_012821
1311 Ga0500595_016051
1312 Ga0500608_035435
1313 Ga0500614_032696
1314 Ga0500642_0000039
1315 Ga0500642_0002118
1316 Ga0500642_0026140
1317 Ga0500642_0028540
1318 Ga0500652_001066
1319 Ga0500655_030790
1320 Ga0500658_0009611
1321 Ga0500568_0001467
1322 Ga0500568_0008598
1323 Ga0500568_0010187
1324 Ga0500577_0034909
1325 Ga0500577_0092177
1326 Ga0500585_119091
1327 Ga0500589_147594
1328 Ga0500603_002683
1329 Ga0500604_0025269
1330 Ga0500616_0000038
1331 Ga0500616_0000059
1332 Ga0500616_0015647
1333 Ga0500619_045425
1334 Ga0500620_054428
1335 Ga0500620_063319
1336 Ga0500622_0015463
1337 Ga0500622_0185245
1338 Ga0500627_0117092
1339 Ga0500627_0128272
1340 Ga0500634_0143339
1341 Ga0500638_116171
1342 Ga0500639_007050
1343 Ga0500636_0000563
1344 Ga0500636_0012647
1345 Ga0500570_087710
1346 Ga0500625_090653
1347 Ga0500609_002302
1348 Ga0500599_000667
1349 Ga0500601_000189
1350 2507505607
1351 2508539500
1352 2508695869
1353 2511401125
1354 2513628936
1355 2513642279
1356 2513652784
1357 2513673923
1358 2513700410
1359 2513718815
1360 2513876952
1361 2514016072
1362 2515624006
1363 2517105903
1364 2524440060
1365 2524468373
1366 2528852092
1367 2603862313
1368 2617353230
1369 2617377276
1370 2644290715
1371 2745077828
1372 2793065620
1373 2793065939
1374 2805921253
1375 2818239236
1376 2824624894
1377 2824631754
1378 2824657433
1379 2824670451
1380 2824685545
1381 2824694169
1382 2824729549
1383 2824762093
1384 2824772412
1385 2824777503
1386 2838125737
1387 2841947948
1388 2841957045
1389 2841965138
1390 2841972776
1391 2841977554
1392 2841984889
1393 2842041345
1394 2842049387
1395 2844315842
1396 2847942655
1397 2857515616
1398 2857525799
1399 2874591116
1400 2874617131
1401 2874621362
1402 2874636781
1403 2874647753
1404 2876764041
1405 2876772043
1406 2876819300
1407 2879074960
1408 2879106718
1409 2879135779
1410 2879150948
1411 2881367126
1412 2881668409
1413 2885368700
1414 2885411198
1415 2888379130
1416 2888390307
1417 2888427528
1418 2903730858
1419 2903775700
1420 2904668032
1421 2904714163
1422 2906603681
1423 2906633195
1424 2906648054
1425 2919074339
1426 2922369137
1427 2922400748
1428 2929618991
1429 2929631068
1430 2932789033
1431 2932801336
1432 2932808849
1433 2932814330
1434 2932820456
1435 2932834488
1436 2933580299
1437 2935614662
1438 2935624471
1439 2935645861
1440 2935649053
1441 2935658175
1442 2935673428
1443 2935682605
1444 2935686781
1445 2935701539
1446 2935710486
1447 2935716469
1448 2935723406
1449 2935734962
1450 2935744247
1451 2935752747
1452 2935764706
1453 2935789157
1454 2935796906
1455 2935806183
1456 2935816949
1457 2935826297
1458 2935835238
1459 2935841380
1460 2935853793
1461 2935863052
1462 2935871862
1463 2935882247
1464 2935883280
1465 2935911014
1466 2935924175
1467 2935932772
1468 2935937335
1469 2935949464
1470 2935958137
1471 2935967227
1472 2935971208
1473 2935982198
1474 2935985337
1475 2936000182
1476 2936010096
1477 2936012394
1478 2936020525
1479 2936029687
1480 2936043940
1481 2936051848
1482 2936056899
1483 2940558660
1484 2941535693
1485 2941543606
1486 3005486391
1487 3005506268
1488 3005589048
1489 3005595426
1490 3005711387
1491 3005718660
1492 8006931167
1493 8016517769
1494 8016525830
1495 8016539433
1496 8016549572
1497 8016569123
1498 8016581760
1499 8016585942
1500 8016596008
1501 8016606882
1502 8017058861
1503 8019530713
1504 8019540872
1505 8019549743
1506 8019576790
1507 8019594846
1508 8019606893
1509 8019611615
1510 8019623346
1511 8019640867
1512 8019652963
1513 8019666592
1514 8019676331
1515 8019679666
1516 8019695801
1517 8055742840
1518 8056975626

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

112

200

0.88

PF13649

Methyltransf_25

Methyltransferase domain

90

175

0.86

PF08241

Methyltransf_11

Methyltransferase domain

87

179

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p35-assembly1.cif.gz_B crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens 0.7094 52 264
7ebx-assembly1.cif.gz_A crystal structure of juvenile hormone acid methyltransferase jhamt in complex with s-adenosyl-l-homocysteine. 0.6969 40 263
3ccf-assembly1.cif.gz_A crystal structure of putative methyltransferase (yp_321342.1) from anabaena variabilis atcc 29413 at 1.90 a resolution 0.695 49 263
2p35-assembly1.cif.gz_A crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens 0.6875 46 264
7ec0-assembly1.cif.gz_A crystal structure of juvenile hormone acid methyltransferase jhamt in complex with s-adenosyl homocysteine and methyl farnesoate 0.6816 40 263
ID Description Score Start End Superfamily
af_A0A0R0II64_62_165_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9185 97 141 3.40.50.150
af_A2APY7_47_247_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8727 22 197 3.40.50.150
af_A0A1D6IAK3_2_136_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8621 39 145 3.40.50.150
af_C0PCR5_51_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8576 28 201 3.40.50.150
af_Q9NAP7_34_269_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8429 52 263 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A5S9C5X4-F1-model_v4 deleted 0.8944 19 268
AF-S9TSC2-F1-model_v4 SAM-dependent methyltransferase 0.8917 19 265 GO:0008757
GO:0032259
AF-A0A429VCV5-F1-model_v4 Methyltransferase 0.8706 48 267 GO:0008168
GO:0032259
AF-A0A1Y2K2K2-F1-model_v4 Putative type 11 methyltransferase 0.8631 16 270 GO:0008757
GO:0032259
AF-A0A429VCV5-F1-model_v4 Methyltransferase 0.8631 48 267 GO:0008168
GO:0032259

Map