F479502
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 759 | 425 | 1518 | 368 |
Family's Representative Sequence
| Representative Sequence | 3300050493|nmdc:mga0k408_111902_c1|nmdc:mga0k408_111902_c1_240_1592 |
| Length | 450 |
| Sequence | MHGQQFQRIFDAGCASVSESRGFHFGVTSPANSLHFRGIRRLRPSKVKFVRGDYFDFELVFARRTTHVLCQIKSLPFGEEQTMNLGFFTMPIHPVDKDWRLSLNEDREAFLLADELGFSEGYVGEHTTDRAENITSCIAFIAWLAAATRQIKLGTGTVNMPNAHPAAIAASIAMLDHILDGRLIFGISPGGLLSDAEVFGNLEADRNAMFLEAINQVLQIWASEPPYNLQGQFWNISVQKTLIEDIGQGFIPRPLQRPHPPIVVTAVAPFSKGVTEAAARGWEPISANFLMPAWVKSHWPKYVEGCKRAGRPADPANWRVAKSVFVAKDAATAKAYATDPNGPYVYYYRSLLTKLKRGGRIELFKTRRDQPDDEVTLASICEKLIIHGTPDSVADQILAFQEETGPFGTLLYAGKDWRDRELGRRSMILMAEKVMPRINAGASSGSKAAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 63 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 64 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 65 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 69 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 70 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 71 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 72 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 79 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 80 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 81 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 108 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 109 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 110 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 111 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 172 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 173 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 174 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 183 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 184 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 185 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 186 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 188 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 189 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 190 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 191 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 193 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 194 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 195 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 197 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 199 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 200 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 201 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 202 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 203 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 204 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 205 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 206 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 207 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 210 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 215 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 216 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 217 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 220 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 221 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 222 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 223 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 224 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 225 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 226 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 227 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 228 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 229 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 230 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 231 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 232 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 233 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 234 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 235 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 236 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 237 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 306 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 307 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 308 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 309 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 310 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 313 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 314 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 315 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 316 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 317 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 318 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 319 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 320 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 321 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 322 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 323 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 324 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 325 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 347 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 348 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 349 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 350 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 357 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 358 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 359 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 360 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 361 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 362 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 363 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 364 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 365 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 366 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 367 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 368 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 369 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 370 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 371 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 372 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 373 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 374 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 375 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 376 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 377 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 378 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 379 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 380 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 381 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 383 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 385 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 386 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 387 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 388 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 389 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 390 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 391 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 392 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 393 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 394 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 395 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 396 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 397 | 2791355199 | |||
| 398 | 2834578030 | Paracoccus thiocyanatus SST | Isolate | Unclassified |
| 399 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 400 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 401 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 402 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 403 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 404 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 405 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 406 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 407 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 408 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 409 | 2906610324 | |||
| 410 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 411 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 412 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 413 | 2922425934 | |||
| 414 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 415 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 416 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 417 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 418 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 419 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 420 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 421 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 422 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 423 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 424 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 425 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.97 |
| Metatranscriptomes | 0 |
| Isolates | 5.03 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.28 |
| Nodule | 4.08 |
| Rhizoplane | 4.22 |
| Rhizosphere | 74.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga0k408_111902_c1 | 3300050493 | Bacteria | 1614 |
| 2 | JGI25406J46586_10000427 | 3300003203 | Bacteria | 19396 |
| 3 | JGI25153J46596_10001468 | 3300003215 | Bacteria | 14070 |
| 4 | rootH1_10011246 | 3300003323 | Bacteria | 3114 |
| 5 | JGI25404J52841_10000743 | 3300003659 | Bacteria | 5098 |
| 6 | Ga0065165_1001530 | 3300005262 | Bacteria | 24255 |
| 7 | Ga0065715_10144331 | 3300005293 | Bacteria | 1798 |
| 8 | Ga0070658_10145193 | 3300005327 | Bacteria | 1984 |
| 9 | Ga0070658_10181543 | 3300005327 | Bacteria | 1771 |
| 10 | Ga0070683_100001547 | 3300005329 | Bacteria | 17802 |
| 11 | Ga0070683_100007227 | 3300005329 | Bacteria | 9370 |
| 12 | Ga0070683_100025184 | 3300005329 | Bacteria | 5340 |
| 13 | Ga0070683_100229193 | 3300005329 | Bacteria | 1766 |
| 14 | Ga0070670_100253154 | 3300005331 | Bacteria | 1534 |
| 15 | Ga0068869_100112053 | 3300005334 | Bacteria | 2076 |
| 16 | Ga0070680_100004177 | 3300005336 | Bacteria | 10825 |
| 17 | Ga0070680_100029327 | 3300005336 | Bacteria | 4419 |
| 18 | Ga0070680_100092866 | 3300005336 | Bacteria | 2499 |
| 19 | Ga0070682_100089667 | 3300005337 | Bacteria | 2009 |
| 20 | Ga0068868_100048648 | 3300005338 | Bacteria | 3326 |
| 21 | Ga0068868_100078090 | 3300005338 | Bacteria | 2649 |
| 22 | Ga0070660_100004765 | 3300005339 | Bacteria | 9381 |
| 23 | Ga0070660_100151256 | 3300005339 | Bacteria | 1866 |
| 24 | Ga0070691_10020669 | 3300005341 | Bacteria | 3043 |
| 25 | Ga0070687_100028973 | 3300005343 | Bacteria | 2691 |
| 26 | Ga0070661_100033765 | 3300005344 | Bacteria | 3708 |
| 27 | Ga0070668_100039747 | 3300005347 | Bacteria | 3597 |
| 28 | Ga0070668_100058493 | 3300005347 | Bacteria | 2982 |
| 29 | Ga0070668_100076610 | 3300005347 | Bacteria | 2613 |
| 30 | Ga0070671_100019364 | 3300005355 | Bacteria | 5538 |
| 31 | Ga0070671_100029173 | 3300005355 | Bacteria | 4549 |
| 32 | Ga0070671_100118268 | 3300005355 | Bacteria | 2229 |
| 33 | Ga0070674_100050645 | 3300005356 | Bacteria | 2859 |
| 34 | Ga0070674_100284126 | 3300005356 | Bacteria | 1313 |
| 35 | Ga0070673_100045712 | 3300005364 | Bacteria | 3397 |
| 36 | Ga0070673_100145708 | 3300005364 | Bacteria | 2002 |
| 37 | Ga0070659_100065860 | 3300005366 | Bacteria | 2870 |
| 38 | Ga0070659_100126567 | 3300005366 | Bacteria | 2073 |
| 39 | Ga0070709_10005541 | 3300005434 | Bacteria | 6833 |
| 40 | Ga0070709_10187687 | 3300005434 | Bacteria | 1456 |
| 41 | Ga0070714_100013074 | 3300005435 | Bacteria | 6643 |
| 42 | Ga0070714_100193326 | 3300005435 | Bacteria | 1858 |
| 43 | Ga0070713_100027095 | 3300005436 | Bacteria | 4508 |
| 44 | Ga0070713_100073252 | 3300005436 | Bacteria | 2899 |
| 45 | Ga0070710_10054823 | 3300005437 | Bacteria | 2250 |
| 46 | Ga0070701_10142093 | 3300005438 | Bacteria | 1374 |
| 47 | Ga0070711_100003525 | 3300005439 | Bacteria | 9132 |
| 48 | Ga0070711_100008622 | 3300005439 | Bacteria | 6254 |
| 49 | Ga0070708_100181949 | 3300005445 | Bacteria | 1965 |
| 50 | Ga0070663_100000736 | 3300005455 | Bacteria | 17673 |
| 51 | Ga0070663_100107000 | 3300005455 | Bacteria | 2096 |
| 52 | Ga0070678_100073707 | 3300005456 | Bacteria | 2563 |
| 53 | Ga0070678_100075387 | 3300005456 | Bacteria | 2537 |
| 54 | Ga0070662_100029622 | 3300005457 | Bacteria | 3821 |
| 55 | Ga0070662_100043001 | 3300005457 | Bacteria | 3229 |
| 56 | Ga0070662_100072640 | 3300005457 | Bacteria | 2540 |
| 57 | Ga0070681_10009108 | 3300005458 | Bacteria | 9756 |
| 58 | Ga0070681_10046397 | 3300005458 | Bacteria | 4344 |
| 59 | Ga0070681_10058095 | 3300005458 | Bacteria | 3848 |
| 60 | Ga0070681_10084622 | 3300005458 | Bacteria | 3124 |
| 61 | Ga0070685_10024687 | 3300005466 | Bacteria | 3303 |
| 62 | Ga0070706_100122730 | 3300005467 | Bacteria | 2422 |
| 63 | Ga0070707_100076183 | 3300005468 | Bacteria | 3236 |
| 64 | Ga0070679_100003396 | 3300005530 | Bacteria | 14587 |
| 65 | Ga0070679_100014293 | 3300005530 | Bacteria | 7623 |
| 66 | Ga0070679_100032807 | 3300005530 | Bacteria | 5139 |
| 67 | Ga0070684_100002360 | 3300005535 | Bacteria | 13921 |
| 68 | Ga0070684_100010214 | 3300005535 | Bacteria | 7429 |
| 69 | Ga0068853_100007764 | 3300005539 | Bacteria | 8604 |
| 70 | Ga0068853_100016904 | 3300005539 | Bacteria | 6012 |
| 71 | Ga0068853_100027851 | 3300005539 | Bacteria | 4750 |
| 72 | Ga0068853_100071086 | 3300005539 | Bacteria | 3030 |
| 73 | Ga0068853_100194118 | 3300005539 | Bacteria | 1846 |
| 74 | Ga0070672_100236106 | 3300005543 | Bacteria | 1537 |
| 75 | Ga0070693_100009703 | 3300005547 | Bacteria | 4795 |
| 76 | Ga0070665_100025420 | 3300005548 | Bacteria | 5967 |
| 77 | Ga0070665_100143011 | 3300005548 | Bacteria | 2395 |
| 78 | Ga0068855_100019998 | 3300005563 | Bacteria | 8040 |
| 79 | Ga0068855_100063031 | 3300005563 | Bacteria | 4327 |
| 80 | Ga0068855_100070450 | 3300005563 | Bacteria | 4067 |
| 81 | Ga0068855_100370998 | 3300005563 | Bacteria | 1573 |
| 82 | Ga0070664_100025362 | 3300005564 | Bacteria | 4913 |
| 83 | Ga0068857_100007288 | 3300005577 | Bacteria | 9525 |
| 84 | Ga0068854_100083207 | 3300005578 | Bacteria | 2366 |
| 85 | Ga0068856_100000183 | 3300005614 | Bacteria | 65005 |
| 86 | Ga0068856_100042682 | 3300005614 | Bacteria | 4461 |
| 87 | Ga0068856_100116406 | 3300005614 | Bacteria | 2673 |
| 88 | Ga0068852_100008748 | 3300005616 | Bacteria | 7487 |
| 89 | Ga0068852_100018677 | 3300005616 | Bacteria | 5465 |
| 90 | Ga0068859_100055884 | 3300005617 | Bacteria | 3972 |
| 91 | Ga0068864_100015786 | 3300005618 | Bacteria | 6283 |
| 92 | Ga0068861_100011429 | 3300005719 | Bacteria | 6173 |
| 93 | Ga0068861_100062787 | 3300005719 | Bacteria | 2854 |
| 94 | Ga0068861_100202672 | 3300005719 | Bacteria | 1666 |
| 95 | Ga0068851_10006248 | 3300005834 | Bacteria | 5436 |
| 96 | Ga0068851_10036850 | 3300005834 | Bacteria | 2451 |
| 97 | Ga0068863_100075269 | 3300005841 | Bacteria | 3194 |
| 98 | Ga0068858_100042194 | 3300005842 | Bacteria | 4230 |
| 99 | Ga0068858_100115231 | 3300005842 | Bacteria | 2511 |
| 100 | Ga0068862_100116089 | 3300005844 | Bacteria | 2354 |
| 101 | Ga0068862_100153030 | 3300005844 | Bacteria | 2054 |
| 102 | Ga0068862_100408332 | 3300005844 | Bacteria | 1272 |
| 103 | Ga0081455_10000968 | 3300005937 | Bacteria | 36782 |
| 104 | Ga0081455_10006130 | 3300005937 | Bacteria | 12989 |
| 105 | Ga0081455_10027486 | 3300005937 | Bacteria | 5214 |
| 106 | Ga0081455_10043147 | 3300005937 | Bacteria | 3949 |
| 107 | Ga0081455_10174483 | 3300005937 | Bacteria | 1634 |
| 108 | Ga0081538_10008625 | 3300005981 | Bacteria | 8621 |
| 109 | Ga0081538_10027677 | 3300005981 | Bacteria | 3922 |
| 110 | Ga0081540_1001901 | 3300005983 | Bacteria | 17473 |
| 111 | Ga0081540_1001903 | 3300005983 | Bacteria | 17470 |
| 112 | Ga0081540_1008229 | 3300005983 | Bacteria | 7308 |
| 113 | Ga0081540_1009156 | 3300005983 | Bacteria | 6833 |
| 114 | Ga0081540_1027395 | 3300005983 | Bacteria | 3230 |
| 115 | Ga0081540_1028634 | 3300005983 | Bacteria | 3123 |
| 116 | Ga0081539_10000003 | 3300005985 | Bacteria | 594833 |
| 117 | Ga0081539_10001264 | 3300005985 | Bacteria | 44681 |
| 118 | Ga0081539_10009942 | 3300005985 | Bacteria | 7844 |
| 119 | Ga0081539_10021323 | 3300005985 | Bacteria | 4335 |
| 120 | Ga0081539_10022414 | 3300005985 | Bacteria | 4179 |
| 121 | Ga0070717_10000620 | 3300006028 | Bacteria | 22822 |
| 122 | Ga0070717_10003695 | 3300006028 | Bacteria | 10995 |
| 123 | Ga0070717_10021656 | 3300006028 | Bacteria | 5069 |
| 124 | Ga0070717_10064138 | 3300006028 | Bacteria | 3051 |
| 125 | Ga0075365_10056818 | 3300006038 | Bacteria | 2602 |
| 126 | Ga0075365_10070940 | 3300006038 | Bacteria | 2344 |
| 127 | Ga0075365_10180878 | 3300006038 | Bacteria | 1474 |
| 128 | Ga0075368_10000568 | 3300006042 | Bacteria | 11071 |
| 129 | Ga0075363_100057360 | 3300006048 | Bacteria | 2090 |
| 130 | Ga0075364_10026158 | 3300006051 | Bacteria | 3721 |
| 131 | Ga0070716_100020164 | 3300006173 | Bacteria | 3497 |
| 132 | Ga0070712_100221595 | 3300006175 | Bacteria | 1498 |
| 133 | Ga0070712_100258062 | 3300006175 | Bacteria | 1396 |
| 134 | Ga0075362_10006285 | 3300006177 | Bacteria | 4416 |
| 135 | Ga0075367_10040317 | 3300006178 | Bacteria | 2726 |
| 136 | Ga0075367_10064551 | 3300006178 | Bacteria | 2190 |
| 137 | Ga0075367_10119282 | 3300006178 | Bacteria | 1624 |
| 138 | Ga0075369_10006424 | 3300006186 | Bacteria | 4442 |
| 139 | Ga0075366_10010155 | 3300006195 | Bacteria | 5280 |
| 140 | Ga0075366_10128813 | 3300006195 | Bacteria | 1527 |
| 141 | Ga0075370_10020093 | 3300006353 | Bacteria | 3645 |
| 142 | Ga0075370_10049433 | 3300006353 | Bacteria | 2384 |
| 143 | Ga0068871_100018780 | 3300006358 | Bacteria | 5266 |
| 144 | Ga0068871_100124261 | 3300006358 | Bacteria | 2183 |
| 145 | Ga0068871_100220867 | 3300006358 | Bacteria | 1642 |
| 146 | Ga0068871_100231003 | 3300006358 | Bacteria | 1605 |
| 147 | Ga0075428_100002217 | 3300006844 | Bacteria | 21050 |
| 148 | Ga0075428_100199239 | 3300006844 | Bacteria | 2165 |
| 149 | Ga0075428_100564828 | 3300006844 | Bacteria | 1216 |
| 150 | Ga0075434_100033237 | 3300006871 | Bacteria | 5089 |
| 151 | Ga0075429_100045445 | 3300006880 | Bacteria | 3821 |
| 152 | Ga0097620_100055884 | 3300006931 | Bacteria | 3972 |
| 153 | Ga0099824_1013434 | 3300006942 | Bacteria | 8497 |
| 154 | Ga0099822_1002066 | 3300006943 | Bacteria | 24562 |
| 155 | Ga0099794_10002279 | 3300007265 | Bacteria | 7050 |
| 156 | Ga0099795_10006177 | 3300007788 | Bacteria | 3248 |
| 157 | Ga0099795_10018213 | 3300007788 | Bacteria | 2253 |
| 158 | Ga0105240_10007889 | 3300009093 | Bacteria | 15352 |
| 159 | Ga0105240_10030954 | 3300009093 | Bacteria | 6948 |
| 160 | Ga0105240_10057601 | 3300009093 | Bacteria | 4853 |
| 161 | Ga0105240_10073130 | 3300009093 | Bacteria | 4234 |
| 162 | Ga0111539_10001244 | 3300009094 | Bacteria | 33917 |
| 163 | Ga0105245_10006466 | 3300009098 | Bacteria | 10308 |
| 164 | Ga0105245_10021026 | 3300009098 | Bacteria | 5724 |
| 165 | Ga0105245_10056619 | 3300009098 | Bacteria | 3524 |
| 166 | Ga0105245_10110736 | 3300009098 | Bacteria | 2553 |
| 167 | Ga0105245_10146381 | 3300009098 | Bacteria | 2229 |
| 168 | Ga0105247_10018512 | 3300009101 | Bacteria | 4177 |
| 169 | Ga0105243_10308856 | 3300009148 | Bacteria | 1436 |
| 170 | Ga0105241_10001928 | 3300009174 | Bacteria | 15692 |
| 171 | Ga0105241_10021404 | 3300009174 | Bacteria | 4780 |
| 172 | Ga0105241_10122551 | 3300009174 | Bacteria | 2095 |
| 173 | Ga0105242_10157759 | 3300009176 | Bacteria | 1983 |
| 174 | Ga0105242_10210905 | 3300009176 | Bacteria | 1731 |
| 175 | Ga0105248_10010552 | 3300009177 | Bacteria | 10178 |
| 176 | Ga0105248_10123329 | 3300009177 | Bacteria | 2923 |
| 177 | Ga0105248_10284802 | 3300009177 | Bacteria | 1861 |
| 178 | Ga0105237_10002303 | 3300009545 | Bacteria | 23741 |
| 179 | Ga0105237_10012648 | 3300009545 | Bacteria | 8884 |
| 180 | Ga0105237_10123552 | 3300009545 | Bacteria | 2583 |
| 181 | Ga0105237_10186159 | 3300009545 | Bacteria | 2076 |
| 182 | Ga0105237_10340699 | 3300009545 | Bacteria | 1504 |
| 183 | Ga0105238_10000813 | 3300009551 | Bacteria | 32330 |
| 184 | Ga0105238_10002953 | 3300009551 | Bacteria | 16966 |
| 185 | Ga0105238_10026202 | 3300009551 | Bacteria | 5941 |
| 186 | Ga0105238_10058304 | 3300009551 | Bacteria | 3870 |
| 187 | Ga0105238_10146792 | 3300009551 | Bacteria | 2335 |
| 188 | Ga0105238_10246860 | 3300009551 | Bacteria | 1763 |
| 189 | Ga0105238_10278384 | 3300009551 | Bacteria | 1654 |
| 190 | Ga0105238_10320641 | 3300009551 | Bacteria | 1535 |
| 191 | Ga0105238_10331622 | 3300009551 | Bacteria | 1508 |
| 192 | Ga0099796_10006594 | 3300010159 | Bacteria | 2983 |
| 193 | Ga0099796_10032444 | 3300010159 | Bacteria | 1711 |
| 194 | Ga0105239_10010234 | 3300010375 | Bacteria | 10503 |
| 195 | Ga0105239_10013645 | 3300010375 | Bacteria | 9020 |
| 196 | Ga0105239_10016969 | 3300010375 | Bacteria | 8048 |
| 197 | Ga0105239_10019242 | 3300010375 | Bacteria | 7541 |
| 198 | Ga0105239_10069197 | 3300010375 | Bacteria | 3878 |
| 199 | Ga0105239_10237538 | 3300010375 | Bacteria | 2046 |
| 200 | Ga0105246_10022719 | 3300011119 | Bacteria | 4051 |
| 201 | Ga0105246_10114055 | 3300011119 | Bacteria | 1990 |
| 202 | Ga0157370_10059395 | 3300013104 | Bacteria | 3634 |
| 203 | Ga0157370_10250655 | 3300013104 | Bacteria | 1638 |
| 204 | Ga0157369_10002453 | 3300013105 | Bacteria | 22254 |
| 205 | Ga0157369_10003244 | 3300013105 | Bacteria | 19372 |
| 206 | Ga0157369_10011859 | 3300013105 | Bacteria | 9898 |
| 207 | Ga0157374_10008339 | 3300013296 | Bacteria | 8845 |
| 208 | Ga0157374_10017285 | 3300013296 | Bacteria | 6348 |
| 209 | Ga0157374_10029281 | 3300013296 | Bacteria | 4984 |
| 210 | Ga0157374_10075141 | 3300013296 | Bacteria | 3193 |
| 211 | Ga0157378_10004403 | 3300013297 | Bacteria | 12399 |
| 212 | Ga0163162_10007321 | 3300013306 | Bacteria | 10728 |
| 213 | Ga0163162_10095815 | 3300013306 | Bacteria | 3055 |
| 214 | Ga0163162_10166013 | 3300013306 | Bacteria | 2331 |
| 215 | Ga0157372_10029296 | 3300013307 | Bacteria | 6010 |
| 216 | Ga0157372_10172243 | 3300013307 | Bacteria | 2505 |
| 217 | Ga0157375_10073245 | 3300013308 | Bacteria | 3444 |
| 218 | Ga0157375_10128688 | 3300013308 | Bacteria | 2650 |
| 219 | Ga0163163_10031547 | 3300014325 | Bacteria | 5116 |
| 220 | Ga0157377_10023715 | 3300014745 | Bacteria | 3255 |
| 221 | Ga0157379_10215914 | 3300014968 | Bacteria | 1737 |
| 222 | Ga0157376_10002079 | 3300014969 | Bacteria | 13458 |
| 223 | Ga0163161_10119501 | 3300017792 | Bacteria | 1979 |
| 224 | Ga0163161_10281694 | 3300017792 | Bacteria | 1304 |
| 225 | Ga0213873_10019393 | 3300021358 | Bacteria | 1577 |
| 226 | Ga0213876_10005651 | 3300021384 | Bacteria | 6865 |
| 227 | Ga0213876_10107138 | 3300021384 | Bacteria | 1483 |
| 228 | Ga0213875_10025026 | 3300021388 | Bacteria | 2845 |
| 229 | Ga0213871_10008889 | 3300021441 | Bacteria | 2231 |
| 230 | Ga0209677_102191 | 3300025253 | Bacteria | 7598 |
| 231 | Ga0209148_1000474 | 3300025254 | Bacteria | 42596 |
| 232 | Ga0209233_1008616 | 3300025261 | Bacteria | 3142 |
| 233 | Ga0209455_1002818 | 3300025272 | Bacteria | 6464 |
| 234 | Ga0209455_1004350 | 3300025272 | Bacteria | 4674 |
| 235 | Ga0209758_1001548 | 3300025297 | Bacteria | 26409 |
| 236 | Ga0209758_1001765 | 3300025297 | Bacteria | 23988 |
| 237 | Ga0209758_1011005 | 3300025297 | Bacteria | 5308 |
| 238 | Ga0209758_1021808 | 3300025297 | Bacteria | 2967 |
| 239 | Ga0207426_1002873 | 3300025302 | Bacteria | 10217 |
| 240 | Ga0207656_10048626 | 3300025321 | Bacteria | 1826 |
| 241 | Ga0207682_10015987 | 3300025893 | Bacteria | 2925 |
| 242 | Ga0207692_10001623 | 3300025898 | Bacteria | 8480 |
| 243 | Ga0207692_10021567 | 3300025898 | Bacteria | 2949 |
| 244 | Ga0207642_10014396 | 3300025899 | Bacteria | 2918 |
| 245 | Ga0207710_10051580 | 3300025900 | Bacteria | 1848 |
| 246 | Ga0207688_10044215 | 3300025901 | Bacteria | 2482 |
| 247 | Ga0207680_10132232 | 3300025903 | Bacteria | 1646 |
| 248 | Ga0207685_10005573 | 3300025905 | Bacteria | 3338 |
| 249 | Ga0207699_10015322 | 3300025906 | Bacteria | 3979 |
| 250 | Ga0207699_10093795 | 3300025906 | Bacteria | 1890 |
| 251 | Ga0207699_10189401 | 3300025906 | Bacteria | 1387 |
| 252 | Ga0207645_10151570 | 3300025907 | Bacteria | 1513 |
| 253 | Ga0207705_10154400 | 3300025909 | Bacteria | 1722 |
| 254 | Ga0207705_10169442 | 3300025909 | Bacteria | 1644 |
| 255 | Ga0207705_10214311 | 3300025909 | Bacteria | 1461 |
| 256 | Ga0207684_10126842 | 3300025910 | Bacteria | 2190 |
| 257 | Ga0207654_10009050 | 3300025911 | Bacteria | 5053 |
| 258 | Ga0207707_10000980 | 3300025912 | Bacteria | 27397 |
| 259 | Ga0207707_10026490 | 3300025912 | Bacteria | 5067 |
| 260 | Ga0207707_10037766 | 3300025912 | Bacteria | 4219 |
| 261 | Ga0207707_10038469 | 3300025912 | Bacteria | 4180 |
| 262 | Ga0207707_10078526 | 3300025912 | Bacteria | 2882 |
| 263 | Ga0207707_10215303 | 3300025912 | Bacteria | 1672 |
| 264 | Ga0207695_10021018 | 3300025913 | Bacteria | 7455 |
| 265 | Ga0207695_10064206 | 3300025913 | Bacteria | 3782 |
| 266 | Ga0207695_10129357 | 3300025913 | Bacteria | 2483 |
| 267 | Ga0207671_10009312 | 3300025914 | Bacteria | 8222 |
| 268 | Ga0207671_10013822 | 3300025914 | Bacteria | 6411 |
| 269 | Ga0207671_10021988 | 3300025914 | Bacteria | 4830 |
| 270 | Ga0207671_10069958 | 3300025914 | Bacteria | 2615 |
| 271 | Ga0207671_10233380 | 3300025914 | Bacteria | 1444 |
| 272 | Ga0207693_10034827 | 3300025915 | Bacteria | 3971 |
| 273 | Ga0207693_10049542 | 3300025915 | Bacteria | 3298 |
| 274 | Ga0207663_10012650 | 3300025916 | Bacteria | 4568 |
| 275 | Ga0207663_10028886 | 3300025916 | Bacteria | 3251 |
| 276 | Ga0207663_10095432 | 3300025916 | Bacteria | 1984 |
| 277 | Ga0207660_10001768 | 3300025917 | Bacteria | 14451 |
| 278 | Ga0207660_10156058 | 3300025917 | Bacteria | 1757 |
| 279 | Ga0207662_10047034 | 3300025918 | Bacteria | 2555 |
| 280 | Ga0207662_10053271 | 3300025918 | Bacteria | 2410 |
| 281 | Ga0207657_10001056 | 3300025919 | Bacteria | 29204 |
| 282 | Ga0207652_10002280 | 3300025921 | Bacteria | 16277 |
| 283 | Ga0207652_10033130 | 3300025921 | Bacteria | 4348 |
| 284 | Ga0207652_10065044 | 3300025921 | Bacteria | 3157 |
| 285 | Ga0207646_10178565 | 3300025922 | Bacteria | 1917 |
| 286 | Ga0207694_10012836 | 3300025924 | Bacteria | 6309 |
| 287 | Ga0207694_10015467 | 3300025924 | Bacteria | 5754 |
| 288 | Ga0207694_10015474 | 3300025924 | Bacteria | 5753 |
| 289 | Ga0207694_10021451 | 3300025924 | Bacteria | 4895 |
| 290 | Ga0207694_10024414 | 3300025924 | Bacteria | 4592 |
| 291 | Ga0207694_10130653 | 3300025924 | Bacteria | 2013 |
| 292 | Ga0207659_10254608 | 3300025926 | Bacteria | 1426 |
| 293 | Ga0207687_10006448 | 3300025927 | Bacteria | 7753 |
| 294 | Ga0207687_10123287 | 3300025927 | Bacteria | 1941 |
| 295 | Ga0207700_10022695 | 3300025928 | Bacteria | 4310 |
| 296 | Ga0207700_10049586 | 3300025928 | Bacteria | 3124 |
| 297 | Ga0207700_10207392 | 3300025928 | Bacteria | 1655 |
| 298 | Ga0207664_10054592 | 3300025929 | Bacteria | 3166 |
| 299 | Ga0207644_10014914 | 3300025931 | Bacteria | 5210 |
| 300 | Ga0207644_10077364 | 3300025931 | Bacteria | 2450 |
| 301 | Ga0207690_10289196 | 3300025932 | Bacteria | 1279 |
| 302 | Ga0207706_10012032 | 3300025933 | Bacteria | 7884 |
| 303 | Ga0207706_10037923 | 3300025933 | Bacteria | 4276 |
| 304 | Ga0207686_10180445 | 3300025934 | Bacteria | 1497 |
| 305 | Ga0207709_10036338 | 3300025935 | Bacteria | 2919 |
| 306 | Ga0207709_10038706 | 3300025935 | Bacteria | 2843 |
| 307 | Ga0207709_10106369 | 3300025935 | Bacteria | 1866 |
| 308 | Ga0207670_10080719 | 3300025936 | Bacteria | 2274 |
| 309 | Ga0207670_10088002 | 3300025936 | Bacteria | 2189 |
| 310 | Ga0207670_10199916 | 3300025936 | Bacteria | 1518 |
| 311 | Ga0207669_10009224 | 3300025937 | Bacteria | 4684 |
| 312 | Ga0207669_10129670 | 3300025937 | Bacteria | 1730 |
| 313 | Ga0207665_10017990 | 3300025939 | Bacteria | 4645 |
| 314 | Ga0207665_10033418 | 3300025939 | Bacteria | 3409 |
| 315 | Ga0207665_10068810 | 3300025939 | Bacteria | 2413 |
| 316 | Ga0207691_10098671 | 3300025940 | Bacteria | 2609 |
| 317 | Ga0207711_10018668 | 3300025941 | Bacteria | 5766 |
| 318 | Ga0207711_10115615 | 3300025941 | Bacteria | 2391 |
| 319 | Ga0207689_10038905 | 3300025942 | Bacteria | 3938 |
| 320 | Ga0207661_10000978 | 3300025944 | Bacteria | 18856 |
| 321 | Ga0207661_10004599 | 3300025944 | Bacteria | 9672 |
| 322 | Ga0207661_10104511 | 3300025944 | Bacteria | 2385 |
| 323 | Ga0207667_10017021 | 3300025949 | Bacteria | 8199 |
| 324 | Ga0207667_10021904 | 3300025949 | Bacteria | 7073 |
| 325 | Ga0207667_10071137 | 3300025949 | Bacteria | 3618 |
| 326 | Ga0207667_10186153 | 3300025949 | Bacteria | 2131 |
| 327 | Ga0207667_10298888 | 3300025949 | Bacteria | 1645 |
| 328 | Ga0207651_10063868 | 3300025960 | Bacteria | 2574 |
| 329 | Ga0207640_10075807 | 3300025981 | Bacteria | 2281 |
| 330 | Ga0207640_10098130 | 3300025981 | Bacteria | 2047 |
| 331 | Ga0207677_10026223 | 3300026023 | Bacteria | 3651 |
| 332 | Ga0207677_10090680 | 3300026023 | Bacteria | 2222 |
| 333 | Ga0207677_10209149 | 3300026023 | Bacteria | 1557 |
| 334 | Ga0207703_10030499 | 3300026035 | Bacteria | 4262 |
| 335 | Ga0207703_10040078 | 3300026035 | Bacteria | 3747 |
| 336 | Ga0207639_10057754 | 3300026041 | Bacteria | 2981 |
| 337 | Ga0207639_10155818 | 3300026041 | Bacteria | 1919 |
| 338 | Ga0207639_10164289 | 3300026041 | Bacteria | 1874 |
| 339 | Ga0207678_10025052 | 3300026067 | Bacteria | 5209 |
| 340 | Ga0207678_10049544 | 3300026067 | Bacteria | 3630 |
| 341 | Ga0207678_10069217 | 3300026067 | Bacteria | 3026 |
| 342 | Ga0207678_10122266 | 3300026067 | Bacteria | 2221 |
| 343 | Ga0207702_10000931 | 3300026078 | Bacteria | 30177 |
| 344 | Ga0207702_10019880 | 3300026078 | Bacteria | 5563 |
| 345 | Ga0207702_10180758 | 3300026078 | Bacteria | 1942 |
| 346 | Ga0207641_10033308 | 3300026088 | Bacteria | 4281 |
| 347 | Ga0207641_10107502 | 3300026088 | Bacteria | 2468 |
| 348 | Ga0207648_10024498 | 3300026089 | Bacteria | 5386 |
| 349 | Ga0207648_10120474 | 3300026089 | Bacteria | 2307 |
| 350 | Ga0207674_10109712 | 3300026116 | Bacteria | 2735 |
| 351 | Ga0207675_100017977 | 3300026118 | Bacteria | 6595 |
| 352 | Ga0207683_10030688 | 3300026121 | Bacteria | 4660 |
| 353 | Ga0207683_10059906 | 3300026121 | Bacteria | 3345 |
| 354 | Ga0207683_10215239 | 3300026121 | Bacteria | 1750 |
| 355 | Ga0207683_10405756 | 3300026121 | Bacteria | 1254 |
| 356 | Ga0207698_10065235 | 3300026142 | Bacteria | 2858 |
| 357 | Ga0207698_10084629 | 3300026142 | Bacteria | 2572 |
| 358 | Ga0207698_10230811 | 3300026142 | Bacteria | 1680 |
| 359 | Ga0209589_1000004 | 3300027357 | Bacteria | 578529 |
| 360 | Ga0209489_100004 | 3300027361 | Bacteria | 578529 |
| 361 | Ga0209700_100004 | 3300027363 | Bacteria | 578529 |
| 362 | Ga0209179_1006316 | 3300027512 | Bacteria | 1904 |
| 363 | Ga0209179_1010413 | 3300027512 | Bacteria | 1621 |
| 364 | Ga0209968_1012748 | 3300027526 | Bacteria | 1313 |
| 365 | Ga0209588_1012945 | 3300027671 | Bacteria | 2538 |
| 366 | Ga0209813_10004076 | 3300027866 | Bacteria | 3465 |
| 367 | Ga0207428_10144870 | 3300027907 | Bacteria | 1811 |
| 368 | Ga0268266_10014979 | 3300028379 | Bacteria | 6656 |
| 369 | Ga0268266_10035979 | 3300028379 | Bacteria | 4212 |
| 370 | Ga0268266_10081876 | 3300028379 | Bacteria | 2815 |
| 371 | Ga0268266_10128937 | 3300028379 | Bacteria | 2260 |
| 372 | Ga0268265_10135733 | 3300028380 | Bacteria | 2052 |
| 373 | Ga0268264_10000073 | 3300028381 | Bacteria | 260615 |
| 374 | Ga0265318_10010442 | 3300028577 | Bacteria | 4045 |
| 375 | Ga0307517_10000756 | 3300028786 | Bacteria | 55661 |
| 376 | Ga0307515_10016019 | 3300028794 | Bacteria | 13759 |
| 377 | Ga0307511_10064493 | 3300030521 | Bacteria | 2753 |
| 378 | Ga0265330_10008288 | 3300031235 | Bacteria | 5009 |
| 379 | Ga0265330_10033498 | 3300031235 | Bacteria | 2297 |
| 380 | Ga0265328_10005665 | 3300031239 | Bacteria | 5337 |
| 381 | Ga0265320_10017383 | 3300031240 | Bacteria | 3997 |
| 382 | Ga0265325_10022559 | 3300031241 | Bacteria | 3447 |
| 383 | Ga0265340_10023117 | 3300031247 | Bacteria | 3172 |
| 384 | Ga0265340_10032140 | 3300031247 | Bacteria | 2621 |
| 385 | Ga0265340_10039366 | 3300031247 | Bacteria | 2333 |
| 386 | Ga0265331_10001606 | 3300031250 | Bacteria | 16506 |
| 387 | Ga0265331_10010603 | 3300031250 | Bacteria | 5089 |
| 388 | Ga0265316_10097225 | 3300031344 | Bacteria | 2241 |
| 389 | Ga0265316_10158652 | 3300031344 | Bacteria | 1692 |
| 390 | Ga0265316_10212618 | 3300031344 | Bacteria | 1430 |
| 391 | Ga0307513_10030795 | 3300031456 | Bacteria | 6090 |
| 392 | Ga0307509_10170678 | 3300031507 | Bacteria | 2055 |
| 393 | Ga0265313_10030548 | 3300031595 | Bacteria | 2772 |
| 394 | Ga0307508_10000025 | 3300031616 | Bacteria | 174642 |
| 395 | Ga0307508_10053562 | 3300031616 | Bacteria | 3580 |
| 396 | Ga0265314_10000895 | 3300031711 | Bacteria | 35520 |
| 397 | Ga0265314_10001458 | 3300031711 | Bacteria | 26393 |
| 398 | Ga0265314_10014289 | 3300031711 | Bacteria | 6364 |
| 399 | Ga0265314_10110193 | 3300031711 | Bacteria | 1751 |
| 400 | Ga0265342_10028079 | 3300031712 | Bacteria | 3509 |
| 401 | Ga0265342_10082351 | 3300031712 | Bacteria | 1857 |
| 402 | Ga0307516_10004702 | 3300031730 | Bacteria | 16699 |
| 403 | Ga0307516_10012948 | 3300031730 | Bacteria | 8939 |
| 404 | Ga0307406_10053043 | 3300031901 | Bacteria | 2582 |
| 405 | Ga0307416_100330771 | 3300032002 | Bacteria | 1531 |
| 406 | Ga0307507_10023208 | 3300033179 | Bacteria | 6818 |
| 407 | Ga0307510_10042569 | 3300033180 | Bacteria | 4947 |
| 408 | Ga0315911_1000014 | 3300033442 | Bacteria | 207605 |
| 409 | Ga0316215_1001396 | 3300033544 | Bacteria | 2324 |
| 410 | Ga0373926_0030460 | 3300035083 | Bacteria | 1900 |
| 411 | Ga0373923_0008211 | 3300035111 | Bacteria | 3710 |
| 412 | Ga0373923_0032949 | 3300035111 | Bacteria | 2096 |
| 413 | Ga0373923_0064237 | 3300035111 | Bacteria | 1565 |
| 414 | Ga0373945_0044619 | 3300035116 | Bacteria | 1613 |
| 415 | Ga0373954_0017812 | 3300035118 | Bacteria | 3193 |
| 416 | Ga0373954_0038713 | 3300035118 | Bacteria | 2218 |
| 417 | Ga0373954_0045823 | 3300035118 | Bacteria | 2043 |
| 418 | Ga0373943_0012642 | 3300035170 | Bacteria | 3805 |
| 419 | Ga0373943_0021171 | 3300035170 | Bacteria | 3002 |
| 420 | Ga0373943_0093375 | 3300035170 | Bacteria | 1562 |
| 421 | Ga0373946_0011389 | 3300035171 | Bacteria | 3318 |
| 422 | Ga0373946_0051175 | 3300035171 | Bacteria | 1728 |
| 423 | Ga0373946_0096291 | 3300035171 | Bacteria | 1320 |
| 424 | Ga0373924_0000771 | 3300035410 | Bacteria | 9947 |
| 425 | Ga0373924_0005907 | 3300035410 | Bacteria | 4362 |
| 426 | Ga0373935_0009037 | 3300035692 | Bacteria | 5962 |
| 427 | Ga0373935_0037992 | 3300035692 | Bacteria | 3013 |
| 428 | Ga0373927_0060396 | 3300035695 | Bacteria | 2453 |
| 429 | Ga0373933_0000052 | 3300035724 | Bacteria | 70592 |
| 430 | Ga0373933_0071185 | 3300035724 | Bacteria | 2116 |
| 431 | Ga0373947_0010219 | 3300035725 | Bacteria | 5388 |
| 432 | Ga0373947_0016342 | 3300035725 | Bacteria | 4265 |
| 433 | Ga0373947_0021732 | 3300035725 | Bacteria | 3716 |
| 434 | Ga0373947_0029897 | 3300035725 | Bacteria | 3198 |
| 435 | Ga0373937_0034113 | 3300036401 | Bacteria | 4628 |
| 436 | Ga0373937_0097601 | 3300036401 | Bacteria | 2725 |
| 437 | Ga0373925_0011826 | 3300037068 | Bacteria | 6316 |
| 438 | Ga0373925_0028774 | 3300037068 | Bacteria | 4073 |
| 439 | Ga0373925_0078961 | 3300037068 | Bacteria | 2499 |
| 440 | Ga0373925_0197097 | 3300037068 | Bacteria | 1600 |
| 441 | Ga0395900_0001158 | 3300037418 | Bacteria | 33053 |
| 442 | Ga0395900_0015185 | 3300037418 | Bacteria | 7852 |
| 443 | Ga0395900_0439525 | 3300037418 | Bacteria | 1262 |
| 444 | Ga0395898_0005716 | 3300037466 | Bacteria | 13400 |
| 445 | Ga0395898_0081582 | 3300037466 | Bacteria | 3118 |
| 446 | Ga0395905_0023969 | 3300037471 | Bacteria | 5762 |
| 447 | Ga0436364_0048275 | 3300037853 | Bacteria | 3885 |
| 448 | Ga0436364_0937856 | 3300037853 | Bacteria | 2752 |
| 449 | Ga0395901_0005474 | 3300038443 | Bacteria | 12858 |
| 450 | Ga0400483_017169 | 3300039062 | Bacteria | 12778 |
| 451 | Ga0436365_0956137 | 3300039437 | Bacteria | 2020 |
| 452 | Ga0436365_1324557 | 3300039437 | Bacteria | 36147 |
| 453 | Ga0436360_0023881 | 3300039438 | Bacteria | 3986 |
| 454 | Ga0436360_1175566 | 3300039438 | Bacteria | 2503 |
| 455 | Ga0436362_0103639 | 3300039453 | Bacteria | 1745 |
| 456 | Ga0439453_0001175 | 3300041408 | Bacteria | 3286 |
| 457 | Ga0439453_0003715 | 3300041408 | Bacteria | 2216 |
| 458 | Ga0439465_0043109 | 3300041413 | Bacteria | 1464 |
| 459 | Ga0466969_0099216 | 3300044656 | Bacteria | 1373 |
| 460 | Ga0466966_0094141 | 3300044684 | Bacteria | 1857 |
| 461 | Ga0466963_0004084 | 3300044694 | Bacteria | 8445 |
| 462 | Ga0466970_0064020 | 3300044765 | Bacteria | 1972 |
| 463 | Ga0466957_0026868 | 3300044842 | Bacteria | 3417 |
| 464 | Ga0466957_0166155 | 3300044842 | Bacteria | 1435 |
| 465 | Ga0466959_0007200 | 3300045049 | Bacteria | 7793 |
| 466 | Ga0466967_0014366 | 3300045976 | Bacteria | 6165 |
| 467 | Ga0466967_0054589 | 3300045976 | Bacteria | 3517 |
| 468 | Ga0466967_0252422 | 3300045976 | Bacteria | 1685 |
| 469 | Ga0495617_019542 | 3300046452 | Bacteria | 2291 |
| 470 | Ga0495592_0011943 | 3300046454 | Bacteria | 6583 |
| 471 | Ga0495592_0015839 | 3300046454 | Bacteria | 5719 |
| 472 | Ga0495603_0015901 | 3300046455 | Bacteria | 4548 |
| 473 | Ga0495603_0018380 | 3300046455 | Bacteria | 4230 |
| 474 | Ga0495603_0023108 | 3300046455 | Bacteria | 3764 |
| 475 | Ga0495603_0032472 | 3300046455 | Bacteria | 3140 |
| 476 | Ga0495629_0009351 | 3300046459 | Bacteria | 7172 |
| 477 | Ga0495629_0012019 | 3300046459 | Bacteria | 6275 |
| 478 | Ga0495629_0082205 | 3300046459 | Bacteria | 2248 |
| 479 | Ga0495641_0009000 | 3300046461 | Bacteria | 5997 |
| 480 | Ga0495651_0023234 | 3300046462 | Bacteria | 4822 |
| 481 | Ga0495651_0082483 | 3300046462 | Bacteria | 2426 |
| 482 | Ga0495653_0057124 | 3300046463 | Bacteria | 2972 |
| 483 | Ga0495653_0078018 | 3300046463 | Bacteria | 2458 |
| 484 | Ga0495650_0062956 | 3300046471 | Bacteria | 1481 |
| 485 | Ga0495580_0040719 | 3300046472 | Bacteria | 3317 |
| 486 | Ga0495582_0003004 | 3300046473 | Bacteria | 9451 |
| 487 | Ga0495582_0008385 | 3300046473 | Bacteria | 5702 |
| 488 | Ga0495605_0090647 | 3300046474 | Bacteria | 1417 |
| 489 | Ga0495639_0004634 | 3300046475 | Bacteria | 5902 |
| 490 | Ga0495639_0043441 | 3300046475 | Bacteria | 2030 |
| 491 | Ga0495662_0007517 | 3300046476 | Bacteria | 5383 |
| 492 | Ga0495664_0002577 | 3300046477 | Bacteria | 9747 |
| 493 | Ga0495584_0031570 | 3300046491 | Bacteria | 2681 |
| 494 | Ga0495585_0145750 | 3300046492 | Bacteria | 1237 |
| 495 | Ga0495606_0082627 | 3300046507 | Bacteria | 1993 |
| 496 | Ga0495608_0050947 | 3300046511 | Bacteria | 2745 |
| 497 | Ga0495618_0105816 | 3300046514 | Bacteria | 1801 |
| 498 | Ga0495628_0012582 | 3300046516 | Bacteria | 7130 |
| 499 | Ga0495628_0023124 | 3300046516 | Bacteria | 5104 |
| 500 | Ga0495628_0071401 | 3300046516 | Bacteria | 2706 |
| 501 | Ga0495630_0027243 | 3300046517 | Bacteria | 4237 |
| 502 | Ga0495630_0060592 | 3300046517 | Bacteria | 2841 |
| 503 | Ga0495631_0013200 | 3300046518 | Bacteria | 4015 |
| 504 | Ga0495632_0118032 | 3300046519 | Bacteria | 1241 |
| 505 | Ga0495643_0056053 | 3300046522 | Bacteria | 2105 |
| 506 | Ga0495644_0013365 | 3300046523 | Bacteria | 3150 |
| 507 | Ga0495648_0015937 | 3300046524 | Bacteria | 5431 |
| 508 | Ga0495663_0024903 | 3300046525 | Bacteria | 1742 |
| 509 | Ga0495666_0009204 | 3300046526 | Bacteria | 4938 |
| 510 | Ga0495652_0011406 | 3300046529 | Bacteria | 8038 |
| 511 | Ga0495652_0031142 | 3300046529 | Bacteria | 4673 |
| 512 | Ga0495652_0083201 | 3300046529 | Bacteria | 2635 |
| 513 | Ga0495652_0122414 | 3300046529 | Bacteria | 2072 |
| 514 | Ga0495665_0002362 | 3300046531 | Bacteria | 10187 |
| 515 | Ga0495665_0041711 | 3300046531 | Bacteria | 2443 |
| 516 | Ga0495640_0012751 | 3300046533 | Bacteria | 6417 |
| 517 | Ga0495640_0013691 | 3300046533 | Bacteria | 6163 |
| 518 | Ga0495587_0013010 | 3300046536 | Bacteria | 5233 |
| 519 | Ga0495597_0079643 | 3300046542 | Bacteria | 1403 |
| 520 | Ga0495622_0008474 | 3300046557 | Bacteria | 4760 |
| 521 | Ga0495622_0029181 | 3300046557 | Bacteria | 2577 |
| 522 | Ga0495633_0083672 | 3300046558 | Bacteria | 1484 |
| 523 | Ga0495667_0017709 | 3300046559 | Bacteria | 4812 |
| 524 | Ga0495667_0024177 | 3300046559 | Bacteria | 4092 |
| 525 | Ga0495667_0032132 | 3300046559 | Bacteria | 3520 |
| 526 | Ga0495667_0043144 | 3300046559 | Bacteria | 2990 |
| 527 | Ga0495656_0004457 | 3300046615 | Bacteria | 4799 |
| 528 | Ga0495656_0007675 | 3300046615 | Bacteria | 3824 |
| 529 | Ga0495668_0072328 | 3300046616 | Bacteria | 1894 |
| 530 | Ga0495634_0006174 | 3300046642 | Bacteria | 9124 |
| 531 | Ga0495634_0040442 | 3300046642 | Bacteria | 3171 |
| 532 | Ga0495611_0031354 | 3300046648 | Bacteria | 2339 |
| 533 | Ga0495625_0028888 | 3300046660 | Bacteria | 4152 |
| 534 | Ga0495635_0001193 | 3300046663 | Bacteria | 17302 |
| 535 | Ga0495635_0003853 | 3300046663 | Bacteria | 10418 |
| 536 | Ga0495635_0084812 | 3300046663 | Bacteria | 2167 |
| 537 | Ga0495659_0006925 | 3300046664 | Bacteria | 3588 |
| 538 | Ga0495588_0004114 | 3300046674 | Bacteria | 6404 |
| 539 | Ga0495657_0004871 | 3300046675 | Bacteria | 10689 |
| 540 | Ga0495599_0027780 | 3300046678 | Bacteria | 3545 |
| 541 | Ga0495599_0091811 | 3300046678 | Bacteria | 1895 |
| 542 | Ga0495599_0107811 | 3300046678 | Bacteria | 1735 |
| 543 | Ga0495623_0017659 | 3300046679 | Bacteria | 4608 |
| 544 | Ga0495646_0094254 | 3300046680 | Bacteria | 1724 |
| 545 | Ga0495647_0004568 | 3300046681 | Bacteria | 4507 |
| 546 | Ga0495658_0007213 | 3300046683 | Bacteria | 5492 |
| 547 | Ga0495658_0111900 | 3300046683 | Bacteria | 1642 |
| 548 | Ga0495669_0013271 | 3300046684 | Bacteria | 3509 |
| 549 | Ga0495613_0109850 | 3300046689 | Bacteria | 1988 |
| 550 | Ga0495613_0122225 | 3300046689 | Bacteria | 1869 |
| 551 | Ga0495624_0012698 | 3300046690 | Bacteria | 5752 |
| 552 | Ga0495624_0064600 | 3300046690 | Bacteria | 2287 |
| 553 | Ga0495670_0018618 | 3300046691 | Bacteria | 3420 |
| 554 | Ga0495670_0038344 | 3300046691 | Bacteria | 2389 |
| 555 | Ga0495649_0089214 | 3300046694 | Bacteria | 1644 |
| 556 | Ga0495600_0006484 | 3300046809 | Bacteria | 7122 |
| 557 | Ga0495581_0009207 | 3300047315 | Bacteria | 5711 |
| 558 | Ga0495604_0004723 | 3300047317 | Bacteria | 10795 |
| 559 | Ga0495604_0068237 | 3300047317 | Bacteria | 2699 |
| 560 | Ga0495604_0087799 | 3300047317 | Bacteria | 2315 |
| 561 | Ga0495674_0017125 | 3300047319 | Bacteria | 6750 |
| 562 | Ga0495674_0020468 | 3300047319 | Bacteria | 6123 |
| 563 | Ga0495674_0021918 | 3300047319 | Bacteria | 5900 |
| 564 | Ga0495674_0108812 | 3300047319 | Bacteria | 2351 |
| 565 | Ga0495672_0014325 | 3300047320 | Bacteria | 5435 |
| 566 | Ga0495680_0007559 | 3300047322 | Bacteria | 9938 |
| 567 | Ga0495680_0026290 | 3300047322 | Bacteria | 4801 |
| 568 | Ga0495675_0007310 | 3300047444 | Bacteria | 6806 |
| 569 | Ga0495675_0065263 | 3300047444 | Bacteria | 2302 |
| 570 | Ga0495677_0026121 | 3300047445 | Bacteria | 2119 |
| 571 | Ga0495684_0004769 | 3300047471 | Bacteria | 10598 |
| 572 | Ga0495684_0060120 | 3300047471 | Bacteria | 2893 |
| 573 | Ga0495686_0043037 | 3300047472 | Bacteria | 2867 |
| 574 | Ga0495593_0008293 | 3300047673 | Bacteria | 6045 |
| 575 | Ga0495593_0077281 | 3300047673 | Bacteria | 1724 |
| 576 | Ga0495602_0158945 | 3300048088 | Bacteria | 1767 |
| 577 | Ga0496100_0001966 | 3300048903 | Bacteria | 10302 |
| 578 | Ga0496102_0008961 | 3300048905 | Bacteria | 8584 |
| 579 | Ga0496104_0044151 | 3300048907 | Bacteria | 4188 |
| 580 | Ga0496104_0345205 | 3300048907 | Bacteria | 1401 |
| 581 | Ga0496105_0003693 | 3300048908 | Bacteria | 11390 |
| 582 | Ga0496105_0037607 | 3300048908 | Bacteria | 3985 |
| 583 | Ga0496106_0008772 | 3300048909 | Bacteria | 7471 |
| 584 | Ga0496106_0011690 | 3300048909 | Bacteria | 6484 |
| 585 | Ga0496106_0035274 | 3300048909 | Bacteria | 3740 |
| 586 | Ga0496107_0029976 | 3300048910 | Bacteria | 3875 |
| 587 | Ga0496107_0045850 | 3300048910 | Bacteria | 3145 |
| 588 | Ga0496108_0009248 | 3300048911 | Bacteria | 7972 |
| 589 | Ga0496108_0049240 | 3300048911 | Bacteria | 3524 |
| 590 | Ga0496108_0060114 | 3300048911 | Bacteria | 3197 |
| 591 | Ga0496109_0034672 | 3300048912 | Bacteria | 4548 |
| 592 | Ga0496110_0045040 | 3300048913 | Bacteria | 3854 |
| 593 | Ga0496110_0226537 | 3300048913 | Bacteria | 1700 |
| 594 | Ga0496111_0010797 | 3300048914 | Bacteria | 6140 |
| 595 | Ga0496111_0018005 | 3300048914 | Bacteria | 4887 |
| 596 | Ga0496112_0000243 | 3300048915 | Bacteria | 34998 |
| 597 | Ga0496112_0007463 | 3300048915 | Bacteria | 9710 |
| 598 | Ga0496112_0041094 | 3300048915 | Bacteria | 4524 |
| 599 | Ga0496112_0086520 | 3300048915 | Bacteria | 3101 |
| 600 | Ga0496113_0026739 | 3300048916 | Bacteria | 4129 |
| 601 | Ga0496113_0035597 | 3300048916 | Bacteria | 3641 |
| 602 | Ga0496113_0164517 | 3300048916 | Bacteria | 1755 |
| 603 | Ga0496113_0203086 | 3300048916 | Bacteria | 1575 |
| 604 | Ga0496114_0076917 | 3300048917 | Bacteria | 2813 |
| 605 | Ga0496114_0216064 | 3300048917 | Bacteria | 1682 |
| 606 | Ga0496115_0003657 | 3300048918 | Bacteria | 11062 |
| 607 | Ga0496115_0130420 | 3300048918 | Bacteria | 2072 |
| 608 | Ga0496116_0035780 | 3300048919 | Bacteria | 3484 |
| 609 | Ga0496117_0037427 | 3300048920 | Bacteria | 3614 |
| 610 | Ga0496118_0000368 | 3300048921 | Bacteria | 75743 |
| 611 | Ga0496118_0036702 | 3300048921 | Bacteria | 3957 |
| 612 | Ga0496118_0172941 | 3300048921 | Bacteria | 1317 |
| 613 | Ga0496121_0000144 | 3300048924 | Bacteria | 156856 |
| 614 | Ga0496121_0008049 | 3300048924 | Bacteria | 12567 |
| 615 | Ga0496121_0039498 | 3300048924 | Bacteria | 4157 |
| 616 | Ga0496121_0103201 | 3300048924 | Bacteria | 2194 |
| 617 | Ga0496121_0164993 | 3300048924 | Bacteria | 1615 |
| 618 | Ga0496124_0000503 | 3300048927 | Bacteria | 67137 |
| 619 | Ga0496124_0017985 | 3300048927 | Bacteria | 6641 |
| 620 | Ga0496125_0033849 | 3300048928 | Bacteria | 4514 |
| 621 | Ga0496126_0007210 | 3300048929 | Bacteria | 12229 |
| 622 | Ga0496126_0011446 | 3300048929 | Bacteria | 9181 |
| 623 | Ga0496126_0052940 | 3300048929 | Bacteria | 3685 |
| 624 | Ga0496126_0081361 | 3300048929 | Bacteria | 2863 |
| 625 | Ga0496126_0089027 | 3300048929 | Bacteria | 2718 |
| 626 | Ga0496126_0096645 | 3300048929 | Bacteria | 2589 |
| 627 | Ga0496126_0160637 | 3300048929 | Bacteria | 1920 |
| 628 | Ga0501034_0014364 | 3300049571 | Bacteria | 8160 |
| 629 | Ga0501034_0060263 | 3300049571 | Bacteria | 3813 |
| 630 | Ga0501036_0015333 | 3300049572 | Bacteria | 6400 |
| 631 | Ga0501037_0069958 | 3300049573 | Bacteria | 2554 |
| 632 | Ga0501038_0206797 | 3300049574 | Bacteria | 1573 |
| 633 | Ga0501039_0018533 | 3300049575 | Bacteria | 5344 |
| 634 | Ga0501043_0015124 | 3300049579 | Bacteria | 6038 |
| 635 | Ga0501046_0139273 | 3300049580 | Bacteria | 1837 |
| 636 | Ga0501046_0142497 | 3300049580 | Bacteria | 1813 |
| 637 | Ga0501047_0002308 | 3300049581 | Bacteria | 18243 |
| 638 | Ga0501047_0124194 | 3300049581 | Bacteria | 2461 |
| 639 | Ga0501047_0155584 | 3300049581 | Bacteria | 2160 |
| 640 | Ga0501047_0206255 | 3300049581 | Bacteria | 1825 |
| 641 | Ga0501048_0020015 | 3300049582 | Bacteria | 4908 |
| 642 | Ga0501070_0007020 | 3300049586 | Bacteria | 9579 |
| 643 | Ga0501072_0005373 | 3300049588 | Bacteria | 9751 |
| 644 | Ga0501073_0014523 | 3300049589 | Bacteria | 5722 |
| 645 | Ga0501074_0044595 | 3300049590 | Bacteria | 3209 |
| 646 | Ga0501077_0002418 | 3300049593 | Bacteria | 11209 |
| 647 | Ga0501079_0153972 | 3300049741 | Bacteria | 1792 |
| 648 | Ga0501080_0015144 | 3300049742 | Bacteria | 7104 |
| 649 | Ga0501080_0026564 | 3300049742 | Bacteria | 5379 |
| 650 | Ga0501080_0055757 | 3300049742 | Bacteria | 3681 |
| 651 | Ga0501081_0058516 | 3300049743 | Bacteria | 2666 |
| 652 | Ga0501081_0109797 | 3300049743 | Bacteria | 1957 |
| 653 | Ga0501083_0145467 | 3300049744 | Bacteria | 1552 |
| 654 | Ga0501035_0051019 | 3300049822 | Bacteria | 3705 |
| 655 | Ga0501044_0003604 | 3300049823 | Bacteria | 17424 |
| 656 | Ga0501044_0052930 | 3300049823 | Bacteria | 4178 |
| 657 | Ga0501045_0158728 | 3300049824 | Bacteria | 1683 |
| 658 | nmdc:mga03n38_107529_c1 | 3300050490 | Bacteria | 1354 |
| 659 | nmdc:mga03n38_37395_c1 | 3300050490 | Bacteria | 2093 |
| 660 | nmdc:mga00v17_101365_c1 | 3300050491 | Bacteria | 1818 |
| 661 | nmdc:mga00v17_5856_c1 | 3300050491 | Bacteria | 6492 |
| 662 | nmdc:mga0yw44_47602_c1 | 3300050492 | Bacteria | 2582 |
| 663 | nmdc:mga0k408_12201_c1 | 3300050493 | Bacteria | 4695 |
| 664 | nmdc:mga06z11_10424_c1 | 3300050494 | Bacteria | 3961 |
| 665 | nmdc:mga09592_158107_c1 | 3300050508 | Bacteria | 1957 |
| 666 | nmdc:mga08y16_159744_c1 | 3300050511 | Bacteria | 2341 |
| 667 | nmdc:mga08y16_4325_c1 | 3300050511 | Bacteria | 14838 |
| 668 | nmdc:mga0n895_119778_c1 | 3300050512 | Bacteria | 2653 |
| 669 | nmdc:mga0n895_371258_c1 | 3300050512 | Bacteria | 1448 |
| 670 | Ga0495601_0147511 | 3300053077 | Bacteria | 1535 |
| 671 | Ga0495595_0000520 | 3300053084 | Bacteria | 14684 |
| 672 | Ga0495619_0034484 | 3300053085 | Bacteria | 3290 |
| 673 | Ga0500643_002833 | 3300053087 | Bacteria | 8658 |
| 674 | Ga0500647_0048659 | 3300053091 | Bacteria | 2038 |
| 675 | Ga0500647_0067272 | 3300053091 | Bacteria | 1723 |
| 676 | Ga0500583_0085850 | 3300053092 | Bacteria | 1526 |
| 677 | Ga0500651_0022361 | 3300053093 | Bacteria | 3949 |
| 678 | Ga0500566_0000075 | 3300053094 | Bacteria | 48255 |
| 679 | Ga0500566_0000699 | 3300053094 | Bacteria | 18900 |
| 680 | Ga0500566_0005926 | 3300053094 | Bacteria | 7269 |
| 681 | Ga0500641_0031731 | 3300053096 | Bacteria | 2085 |
| 682 | Ga0500594_0005487 | 3300053118 | Bacteria | 2815 |
| 683 | Ga0500595_000003 | 3300053119 | Bacteria | 419332 |
| 684 | Ga0500595_002486 | 3300053119 | Bacteria | 9120 |
| 685 | Ga0500595_003031 | 3300053119 | Bacteria | 7980 |
| 686 | Ga0500595_013526 | 3300053119 | Bacteria | 3124 |
| 687 | Ga0500595_015856 | 3300053119 | Bacteria | 2819 |
| 688 | Ga0500614_000391 | 3300053123 | Bacteria | 11388 |
| 689 | Ga0500652_068947 | 3300053131 | Bacteria | 1463 |
| 690 | Ga0500559_0000245 | 3300053136 | Bacteria | 42738 |
| 691 | Ga0500559_0004273 | 3300053136 | Bacteria | 6835 |
| 692 | Ga0500559_0086454 | 3300053136 | Bacteria | 1431 |
| 693 | Ga0500568_0003807 | 3300053139 | Bacteria | 8245 |
| 694 | Ga0500588_0037202 | 3300053146 | Bacteria | 1444 |
| 695 | Ga0500589_082772 | 3300053147 | Bacteria | 1429 |
| 696 | Ga0500603_000124 | 3300053150 | Bacteria | 18201 |
| 697 | Ga0500603_002939 | 3300053150 | Bacteria | 3691 |
| 698 | Ga0500603_010756 | 3300053150 | Bacteria | 2072 |
| 699 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 700 | Ga0500616_0015249 | 3300053153 | Bacteria | 4398 |
| 701 | Ga0500630_000448 | 3300053159 | Bacteria | 17947 |
| 702 | Ga0500638_028905 | 3300053162 | Bacteria | 2665 |
| 703 | Ga0500638_049242 | 3300053162 | Bacteria | 2038 |
| 704 | Ga0500638_104726 | 3300053162 | Bacteria | 1314 |
| 705 | Ga0500639_000112 | 3300053163 | Bacteria | 38789 |
| 706 | Ga0500636_0032504 | 3300053177 | Bacteria | 3088 |
| 707 | Ga0500636_0073063 | 3300053177 | Bacteria | 1987 |
| 708 | Ga0500637_0044081 | 3300053178 | Bacteria | 2526 |
| 709 | Ga0500645_000078 | 3300053730 | Bacteria | 76931 |
| 710 | Ga0500596_004367 | 3300053735 | Bacteria | 2595 |
| 711 | Ga0500596_009127 | 3300053735 | Bacteria | 1556 |
| 712 | Ga0500599_002740 | 3300053736 | Bacteria | 2127 |
| 713 | Ga0500601_001621 | 3300053737 | Bacteria | 2434 |
| 714 | Ga0501084_0193816 | 3300054114 | Bacteria | 1714 |
| 715 | Ga0500661_001975 | 3300055283 | Bacteria | 3871 |
| 716 | Ga0501082_0000510 | 3300060353 | Bacteria | 34491 |
| 717 | Ga0501082_0005454 | 3300060353 | Bacteria | 11046 |
| 718 | Ga0530510_0037742 | 3300061734 | Bacteria | 3486 |
| 719 | 2509148686 | 2508501128 | Bacteria | 8613869 |
| 720 | 2513660164 | 2513237096 | Bacteria | 8722461 |
| 721 | 2513693624 | 2513237101 | Bacteria | 7952346 |
| 722 | 2513862395 | 2513237137 | Bacteria | 9558895 |
| 723 | 2513888378 | 2513237141 | Bacteria | 8496279 |
| 724 | 2513919408 | 2513237145 | Bacteria | 8979722 |
| 725 | 2517105447 | 2517093001 | Bacteria | 9002274 |
| 726 | 2524535725 | 2524023228 | Bacteria | 10118060 |
| 727 | 2671123976 | 2667528175 | Bacteria | 7532676 |
| 728 | 2723847524 | 2721755755 | Bacteria | 8322773 |
| 729 | 2728752982 | 2728368998 | Bacteria | 8720350 |
| 730 | 2793071361 | 2791355197 | Bacteria | 8420563 |
| 731 | 2793081284 | |||
| 732 | 2834580324 | 2834578030 | Bacteria | 3530182 |
| 733 | 2844319547 | 2844315083 | Bacteria | 8138177 |
| 734 | 2874611487 | 2874604998 | Bacteria | 7834745 |
| 735 | 2876817046 | 2876808645 | Bacteria | 8824342 |
| 736 | 2879117569 | 2879110137 | Bacteria | 8907982 |
| 737 | 2885376749 | 2885374607 | Bacteria | 8927485 |
| 738 | 2885416996 | 2885409591 | Bacteria | 9235467 |
| 739 | 2889042288 | 2889033259 | Bacteria | 9099371 |
| 740 | 2903734484 | 2903727486 | Bacteria | 8281579 |
| 741 | 2903749596 | 2903748898 | Bacteria | 9972761 |
| 742 | 2906609279 | 2906602504 | Bacteria | 8295279 |
| 743 | 2906611121 | |||
| 744 | 2906636552 | 2906635258 | Bacteria | 8601019 |
| 745 | 2922362910 | 2922361189 | Bacteria | 7436256 |
| 746 | 2922390547 | 2922386360 | Bacteria | 7017218 |
| 747 | 2922428186 | |||
| 748 | 3005478171 | 3005474847 | Bacteria | 9259049 |
| 749 | 8006932354 | 8006926726 | Bacteria | 6749210 |
| 750 | 8006943043 | 8006933436 | Bacteria | 10410654 |
| 751 | 8006970152 | 8006964411 | Bacteria | 8966052 |
| 752 | 8006982837 | 8006973647 | Bacteria | 10679141 |
| 753 | 8006985433 | 8006984368 | Bacteria | 9651211 |
| 754 | 8006994510 | 8006994254 | Bacteria | 8309700 |
| 755 | 8019558888 | 8019555841 | Bacteria | 9642137 |
| 756 | 8019566419 | 8019565922 | Bacteria | 9639779 |
| 757 | 8056681246 | 8056673599 | Bacteria | 7871253 |
| 758 | 8056694446 | 8056689827 | Bacteria | 6712655 |
| 759 | 8056968523 | 8056967851 | Bacteria | 9038162 |
| 760 | nmdc:mga0k408_111902_c1 | |||
| 761 | JGI25406J46586_10000427 | |||
| 762 | JGI25153J46596_10001468 | |||
| 763 | rootH1_10011246 | |||
| 764 | JGI25404J52841_10000743 | |||
| 765 | Ga0065165_1001530 | |||
| 766 | Ga0065715_10144331 | |||
| 767 | Ga0070658_10145193 | |||
| 768 | Ga0070658_10181543 | |||
| 769 | Ga0070683_100001547 | |||
| 770 | Ga0070683_100007227 | |||
| 771 | Ga0070683_100025184 | |||
| 772 | Ga0070683_100229193 | |||
| 773 | Ga0070670_100253154 | |||
| 774 | Ga0068869_100112053 | |||
| 775 | Ga0070680_100004177 | |||
| 776 | Ga0070680_100029327 | |||
| 777 | Ga0070680_100092866 | |||
| 778 | Ga0070682_100089667 | |||
| 779 | Ga0068868_100048648 | |||
| 780 | Ga0068868_100078090 | |||
| 781 | Ga0070660_100004765 | |||
| 782 | Ga0070660_100151256 | |||
| 783 | Ga0070691_10020669 | |||
| 784 | Ga0070687_100028973 | |||
| 785 | Ga0070661_100033765 | |||
| 786 | Ga0070668_100039747 | |||
| 787 | Ga0070668_100058493 | |||
| 788 | Ga0070668_100076610 | |||
| 789 | Ga0070671_100019364 | |||
| 790 | Ga0070671_100029173 | |||
| 791 | Ga0070671_100118268 | |||
| 792 | Ga0070674_100050645 | |||
| 793 | Ga0070674_100284126 | |||
| 794 | Ga0070673_100045712 | |||
| 795 | Ga0070673_100145708 | |||
| 796 | Ga0070659_100065860 | |||
| 797 | Ga0070659_100126567 | |||
| 798 | Ga0070709_10005541 | |||
| 799 | Ga0070709_10187687 | |||
| 800 | Ga0070714_100013074 | |||
| 801 | Ga0070714_100193326 | |||
| 802 | Ga0070713_100027095 | |||
| 803 | Ga0070713_100073252 | |||
| 804 | Ga0070710_10054823 | |||
| 805 | Ga0070701_10142093 | |||
| 806 | Ga0070711_100003525 | |||
| 807 | Ga0070711_100008622 | |||
| 808 | Ga0070708_100181949 | |||
| 809 | Ga0070663_100000736 | |||
| 810 | Ga0070663_100107000 | |||
| 811 | Ga0070678_100073707 | |||
| 812 | Ga0070678_100075387 | |||
| 813 | Ga0070662_100029622 | |||
| 814 | Ga0070662_100043001 | |||
| 815 | Ga0070662_100072640 | |||
| 816 | Ga0070681_10009108 | |||
| 817 | Ga0070681_10046397 | |||
| 818 | Ga0070681_10058095 | |||
| 819 | Ga0070681_10084622 | |||
| 820 | Ga0070685_10024687 | |||
| 821 | Ga0070706_100122730 | |||
| 822 | Ga0070707_100076183 | |||
| 823 | Ga0070679_100003396 | |||
| 824 | Ga0070679_100014293 | |||
| 825 | Ga0070679_100032807 | |||
| 826 | Ga0070684_100002360 | |||
| 827 | Ga0070684_100010214 | |||
| 828 | Ga0068853_100007764 | |||
| 829 | Ga0068853_100016904 | |||
| 830 | Ga0068853_100027851 | |||
| 831 | Ga0068853_100071086 | |||
| 832 | Ga0068853_100194118 | |||
| 833 | Ga0070672_100236106 | |||
| 834 | Ga0070693_100009703 | |||
| 835 | Ga0070665_100025420 | |||
| 836 | Ga0070665_100143011 | |||
| 837 | Ga0068855_100019998 | |||
| 838 | Ga0068855_100063031 | |||
| 839 | Ga0068855_100070450 | |||
| 840 | Ga0068855_100370998 | |||
| 841 | Ga0070664_100025362 | |||
| 842 | Ga0068857_100007288 | |||
| 843 | Ga0068854_100083207 | |||
| 844 | Ga0068856_100000183 | |||
| 845 | Ga0068856_100042682 | |||
| 846 | Ga0068856_100116406 | |||
| 847 | Ga0068852_100008748 | |||
| 848 | Ga0068852_100018677 | |||
| 849 | Ga0068859_100055884 | |||
| 850 | Ga0068864_100015786 | |||
| 851 | Ga0068861_100011429 | |||
| 852 | Ga0068861_100062787 | |||
| 853 | Ga0068861_100202672 | |||
| 854 | Ga0068851_10006248 | |||
| 855 | Ga0068851_10036850 | |||
| 856 | Ga0068863_100075269 | |||
| 857 | Ga0068858_100042194 | |||
| 858 | Ga0068858_100115231 | |||
| 859 | Ga0068862_100116089 | |||
| 860 | Ga0068862_100153030 | |||
| 861 | Ga0068862_100408332 | |||
| 862 | Ga0081455_10000968 | |||
| 863 | Ga0081455_10006130 | |||
| 864 | Ga0081455_10027486 | |||
| 865 | Ga0081455_10043147 | |||
| 866 | Ga0081455_10174483 | |||
| 867 | Ga0081538_10008625 | |||
| 868 | Ga0081538_10027677 | |||
| 869 | Ga0081540_1001901 | |||
| 870 | Ga0081540_1001903 | |||
| 871 | Ga0081540_1008229 | |||
| 872 | Ga0081540_1009156 | |||
| 873 | Ga0081540_1027395 | |||
| 874 | Ga0081540_1028634 | |||
| 875 | Ga0081539_10000003 | |||
| 876 | Ga0081539_10001264 | |||
| 877 | Ga0081539_10009942 | |||
| 878 | Ga0081539_10021323 | |||
| 879 | Ga0081539_10022414 | |||
| 880 | Ga0070717_10000620 | |||
| 881 | Ga0070717_10003695 | |||
| 882 | Ga0070717_10021656 | |||
| 883 | Ga0070717_10064138 | |||
| 884 | Ga0075365_10056818 | |||
| 885 | Ga0075365_10070940 | |||
| 886 | Ga0075365_10180878 | |||
| 887 | Ga0075368_10000568 | |||
| 888 | Ga0075363_100057360 | |||
| 889 | Ga0075364_10026158 | |||
| 890 | Ga0070716_100020164 | |||
| 891 | Ga0070712_100221595 | |||
| 892 | Ga0070712_100258062 | |||
| 893 | Ga0075362_10006285 | |||
| 894 | Ga0075367_10040317 | |||
| 895 | Ga0075367_10064551 | |||
| 896 | Ga0075367_10119282 | |||
| 897 | Ga0075369_10006424 | |||
| 898 | Ga0075366_10010155 | |||
| 899 | Ga0075366_10128813 | |||
| 900 | Ga0075370_10020093 | |||
| 901 | Ga0075370_10049433 | |||
| 902 | Ga0068871_100018780 | |||
| 903 | Ga0068871_100124261 | |||
| 904 | Ga0068871_100220867 | |||
| 905 | Ga0068871_100231003 | |||
| 906 | Ga0075428_100002217 | |||
| 907 | Ga0075428_100199239 | |||
| 908 | Ga0075428_100564828 | |||
| 909 | Ga0075434_100033237 | |||
| 910 | Ga0075429_100045445 | |||
| 911 | Ga0097620_100055884 | |||
| 912 | Ga0099824_1013434 | |||
| 913 | Ga0099822_1002066 | |||
| 914 | Ga0099794_10002279 | |||
| 915 | Ga0099795_10006177 | |||
| 916 | Ga0099795_10018213 | |||
| 917 | Ga0105240_10007889 | |||
| 918 | Ga0105240_10030954 | |||
| 919 | Ga0105240_10057601 | |||
| 920 | Ga0105240_10073130 | |||
| 921 | Ga0111539_10001244 | |||
| 922 | Ga0105245_10006466 | |||
| 923 | Ga0105245_10021026 | |||
| 924 | Ga0105245_10056619 | |||
| 925 | Ga0105245_10110736 | |||
| 926 | Ga0105245_10146381 | |||
| 927 | Ga0105247_10018512 | |||
| 928 | Ga0105243_10308856 | |||
| 929 | Ga0105241_10001928 | |||
| 930 | Ga0105241_10021404 | |||
| 931 | Ga0105241_10122551 | |||
| 932 | Ga0105242_10157759 | |||
| 933 | Ga0105242_10210905 | |||
| 934 | Ga0105248_10010552 | |||
| 935 | Ga0105248_10123329 | |||
| 936 | Ga0105248_10284802 | |||
| 937 | Ga0105237_10002303 | |||
| 938 | Ga0105237_10012648 | |||
| 939 | Ga0105237_10123552 | |||
| 940 | Ga0105237_10186159 | |||
| 941 | Ga0105237_10340699 | |||
| 942 | Ga0105238_10000813 | |||
| 943 | Ga0105238_10002953 | |||
| 944 | Ga0105238_10026202 | |||
| 945 | Ga0105238_10058304 | |||
| 946 | Ga0105238_10146792 | |||
| 947 | Ga0105238_10246860 | |||
| 948 | Ga0105238_10278384 | |||
| 949 | Ga0105238_10320641 | |||
| 950 | Ga0105238_10331622 | |||
| 951 | Ga0099796_10006594 | |||
| 952 | Ga0099796_10032444 | |||
| 953 | Ga0105239_10010234 | |||
| 954 | Ga0105239_10013645 | |||
| 955 | Ga0105239_10016969 | |||
| 956 | Ga0105239_10019242 | |||
| 957 | Ga0105239_10069197 | |||
| 958 | Ga0105239_10237538 | |||
| 959 | Ga0105246_10022719 | |||
| 960 | Ga0105246_10114055 | |||
| 961 | Ga0157370_10059395 | |||
| 962 | Ga0157370_10250655 | |||
| 963 | Ga0157369_10002453 | |||
| 964 | Ga0157369_10003244 | |||
| 965 | Ga0157369_10011859 | |||
| 966 | Ga0157374_10008339 | |||
| 967 | Ga0157374_10017285 | |||
| 968 | Ga0157374_10029281 | |||
| 969 | Ga0157374_10075141 | |||
| 970 | Ga0157378_10004403 | |||
| 971 | Ga0163162_10007321 | |||
| 972 | Ga0163162_10095815 | |||
| 973 | Ga0163162_10166013 | |||
| 974 | Ga0157372_10029296 | |||
| 975 | Ga0157372_10172243 | |||
| 976 | Ga0157375_10073245 | |||
| 977 | Ga0157375_10128688 | |||
| 978 | Ga0163163_10031547 | |||
| 979 | Ga0157377_10023715 | |||
| 980 | Ga0157379_10215914 | |||
| 981 | Ga0157376_10002079 | |||
| 982 | Ga0163161_10119501 | |||
| 983 | Ga0163161_10281694 | |||
| 984 | Ga0213873_10019393 | |||
| 985 | Ga0213876_10005651 | |||
| 986 | Ga0213876_10107138 | |||
| 987 | Ga0213875_10025026 | |||
| 988 | Ga0213871_10008889 | |||
| 989 | Ga0209677_102191 | |||
| 990 | Ga0209148_1000474 | |||
| 991 | Ga0209233_1008616 | |||
| 992 | Ga0209455_1002818 | |||
| 993 | Ga0209455_1004350 | |||
| 994 | Ga0209758_1001548 | |||
| 995 | Ga0209758_1001765 | |||
| 996 | Ga0209758_1011005 | |||
| 997 | Ga0209758_1021808 | |||
| 998 | Ga0207426_1002873 | |||
| 999 | Ga0207656_10048626 | |||
| 1000 | Ga0207682_10015987 | |||
| 1001 | Ga0207692_10001623 | |||
| 1002 | Ga0207692_10021567 | |||
| 1003 | Ga0207642_10014396 | |||
| 1004 | Ga0207710_10051580 | |||
| 1005 | Ga0207688_10044215 | |||
| 1006 | Ga0207680_10132232 | |||
| 1007 | Ga0207685_10005573 | |||
| 1008 | Ga0207699_10015322 | |||
| 1009 | Ga0207699_10093795 | |||
| 1010 | Ga0207699_10189401 | |||
| 1011 | Ga0207645_10151570 | |||
| 1012 | Ga0207705_10154400 | |||
| 1013 | Ga0207705_10169442 | |||
| 1014 | Ga0207705_10214311 | |||
| 1015 | Ga0207684_10126842 | |||
| 1016 | Ga0207654_10009050 | |||
| 1017 | Ga0207707_10000980 | |||
| 1018 | Ga0207707_10026490 | |||
| 1019 | Ga0207707_10037766 | |||
| 1020 | Ga0207707_10038469 | |||
| 1021 | Ga0207707_10078526 | |||
| 1022 | Ga0207707_10215303 | |||
| 1023 | Ga0207695_10021018 | |||
| 1024 | Ga0207695_10064206 | |||
| 1025 | Ga0207695_10129357 | |||
| 1026 | Ga0207671_10009312 | |||
| 1027 | Ga0207671_10013822 | |||
| 1028 | Ga0207671_10021988 | |||
| 1029 | Ga0207671_10069958 | |||
| 1030 | Ga0207671_10233380 | |||
| 1031 | Ga0207693_10034827 | |||
| 1032 | Ga0207693_10049542 | |||
| 1033 | Ga0207663_10012650 | |||
| 1034 | Ga0207663_10028886 | |||
| 1035 | Ga0207663_10095432 | |||
| 1036 | Ga0207660_10001768 | |||
| 1037 | Ga0207660_10156058 | |||
| 1038 | Ga0207662_10047034 | |||
| 1039 | Ga0207662_10053271 | |||
| 1040 | Ga0207657_10001056 | |||
| 1041 | Ga0207652_10002280 | |||
| 1042 | Ga0207652_10033130 | |||
| 1043 | Ga0207652_10065044 | |||
| 1044 | Ga0207646_10178565 | |||
| 1045 | Ga0207694_10012836 | |||
| 1046 | Ga0207694_10015467 | |||
| 1047 | Ga0207694_10015474 | |||
| 1048 | Ga0207694_10021451 | |||
| 1049 | Ga0207694_10024414 | |||
| 1050 | Ga0207694_10130653 | |||
| 1051 | Ga0207659_10254608 | |||
| 1052 | Ga0207687_10006448 | |||
| 1053 | Ga0207687_10123287 | |||
| 1054 | Ga0207700_10022695 | |||
| 1055 | Ga0207700_10049586 | |||
| 1056 | Ga0207700_10207392 | |||
| 1057 | Ga0207664_10054592 | |||
| 1058 | Ga0207644_10014914 | |||
| 1059 | Ga0207644_10077364 | |||
| 1060 | Ga0207690_10289196 | |||
| 1061 | Ga0207706_10012032 | |||
| 1062 | Ga0207706_10037923 | |||
| 1063 | Ga0207686_10180445 | |||
| 1064 | Ga0207709_10036338 | |||
| 1065 | Ga0207709_10038706 | |||
| 1066 | Ga0207709_10106369 | |||
| 1067 | Ga0207670_10080719 | |||
| 1068 | Ga0207670_10088002 | |||
| 1069 | Ga0207670_10199916 | |||
| 1070 | Ga0207669_10009224 | |||
| 1071 | Ga0207669_10129670 | |||
| 1072 | Ga0207665_10017990 | |||
| 1073 | Ga0207665_10033418 | |||
| 1074 | Ga0207665_10068810 | |||
| 1075 | Ga0207691_10098671 | |||
| 1076 | Ga0207711_10018668 | |||
| 1077 | Ga0207711_10115615 | |||
| 1078 | Ga0207689_10038905 | |||
| 1079 | Ga0207661_10000978 | |||
| 1080 | Ga0207661_10004599 | |||
| 1081 | Ga0207661_10104511 | |||
| 1082 | Ga0207667_10017021 | |||
| 1083 | Ga0207667_10021904 | |||
| 1084 | Ga0207667_10071137 | |||
| 1085 | Ga0207667_10186153 | |||
| 1086 | Ga0207667_10298888 | |||
| 1087 | Ga0207651_10063868 | |||
| 1088 | Ga0207640_10075807 | |||
| 1089 | Ga0207640_10098130 | |||
| 1090 | Ga0207677_10026223 | |||
| 1091 | Ga0207677_10090680 | |||
| 1092 | Ga0207677_10209149 | |||
| 1093 | Ga0207703_10030499 | |||
| 1094 | Ga0207703_10040078 | |||
| 1095 | Ga0207639_10057754 | |||
| 1096 | Ga0207639_10155818 | |||
| 1097 | Ga0207639_10164289 | |||
| 1098 | Ga0207678_10025052 | |||
| 1099 | Ga0207678_10049544 | |||
| 1100 | Ga0207678_10069217 | |||
| 1101 | Ga0207678_10122266 | |||
| 1102 | Ga0207702_10000931 | |||
| 1103 | Ga0207702_10019880 | |||
| 1104 | Ga0207702_10180758 | |||
| 1105 | Ga0207641_10033308 | |||
| 1106 | Ga0207641_10107502 | |||
| 1107 | Ga0207648_10024498 | |||
| 1108 | Ga0207648_10120474 | |||
| 1109 | Ga0207674_10109712 | |||
| 1110 | Ga0207675_100017977 | |||
| 1111 | Ga0207683_10030688 | |||
| 1112 | Ga0207683_10059906 | |||
| 1113 | Ga0207683_10215239 | |||
| 1114 | Ga0207683_10405756 | |||
| 1115 | Ga0207698_10065235 | |||
| 1116 | Ga0207698_10084629 | |||
| 1117 | Ga0207698_10230811 | |||
| 1118 | Ga0209589_1000004 | |||
| 1119 | Ga0209489_100004 | |||
| 1120 | Ga0209700_100004 | |||
| 1121 | Ga0209179_1006316 | |||
| 1122 | Ga0209179_1010413 | |||
| 1123 | Ga0209968_1012748 | |||
| 1124 | Ga0209588_1012945 | |||
| 1125 | Ga0209813_10004076 | |||
| 1126 | Ga0207428_10144870 | |||
| 1127 | Ga0268266_10014979 | |||
| 1128 | Ga0268266_10035979 | |||
| 1129 | Ga0268266_10081876 | |||
| 1130 | Ga0268266_10128937 | |||
| 1131 | Ga0268265_10135733 | |||
| 1132 | Ga0268264_10000073 | |||
| 1133 | Ga0265318_10010442 | |||
| 1134 | Ga0307517_10000756 | |||
| 1135 | Ga0307515_10016019 | |||
| 1136 | Ga0307511_10064493 | |||
| 1137 | Ga0265330_10008288 | |||
| 1138 | Ga0265330_10033498 | |||
| 1139 | Ga0265328_10005665 | |||
| 1140 | Ga0265320_10017383 | |||
| 1141 | Ga0265325_10022559 | |||
| 1142 | Ga0265340_10023117 | |||
| 1143 | Ga0265340_10032140 | |||
| 1144 | Ga0265340_10039366 | |||
| 1145 | Ga0265331_10001606 | |||
| 1146 | Ga0265331_10010603 | |||
| 1147 | Ga0265316_10097225 | |||
| 1148 | Ga0265316_10158652 | |||
| 1149 | Ga0265316_10212618 | |||
| 1150 | Ga0307513_10030795 | |||
| 1151 | Ga0307509_10170678 | |||
| 1152 | Ga0265313_10030548 | |||
| 1153 | Ga0307508_10000025 | |||
| 1154 | Ga0307508_10053562 | |||
| 1155 | Ga0265314_10000895 | |||
| 1156 | Ga0265314_10001458 | |||
| 1157 | Ga0265314_10014289 | |||
| 1158 | Ga0265314_10110193 | |||
| 1159 | Ga0265342_10028079 | |||
| 1160 | Ga0265342_10082351 | |||
| 1161 | Ga0307516_10004702 | |||
| 1162 | Ga0307516_10012948 | |||
| 1163 | Ga0307406_10053043 | |||
| 1164 | Ga0307416_100330771 | |||
| 1165 | Ga0307507_10023208 | |||
| 1166 | Ga0307510_10042569 | |||
| 1167 | Ga0315911_1000014 | |||
| 1168 | Ga0316215_1001396 | |||
| 1169 | Ga0373926_0030460 | |||
| 1170 | Ga0373923_0008211 | |||
| 1171 | Ga0373923_0032949 | |||
| 1172 | Ga0373923_0064237 | |||
| 1173 | Ga0373945_0044619 | |||
| 1174 | Ga0373954_0017812 | |||
| 1175 | Ga0373954_0038713 | |||
| 1176 | Ga0373954_0045823 | |||
| 1177 | Ga0373943_0012642 | |||
| 1178 | Ga0373943_0021171 | |||
| 1179 | Ga0373943_0093375 | |||
| 1180 | Ga0373946_0011389 | |||
| 1181 | Ga0373946_0051175 | |||
| 1182 | Ga0373946_0096291 | |||
| 1183 | Ga0373924_0000771 | |||
| 1184 | Ga0373924_0005907 | |||
| 1185 | Ga0373935_0009037 | |||
| 1186 | Ga0373935_0037992 | |||
| 1187 | Ga0373927_0060396 | |||
| 1188 | Ga0373933_0000052 | |||
| 1189 | Ga0373933_0071185 | |||
| 1190 | Ga0373947_0010219 | |||
| 1191 | Ga0373947_0016342 | |||
| 1192 | Ga0373947_0021732 | |||
| 1193 | Ga0373947_0029897 | |||
| 1194 | Ga0373937_0034113 | |||
| 1195 | Ga0373937_0097601 | |||
| 1196 | Ga0373925_0011826 | |||
| 1197 | Ga0373925_0028774 | |||
| 1198 | Ga0373925_0078961 | |||
| 1199 | Ga0373925_0197097 | |||
| 1200 | Ga0395900_0001158 | |||
| 1201 | Ga0395900_0015185 | |||
| 1202 | Ga0395900_0439525 | |||
| 1203 | Ga0395898_0005716 | |||
| 1204 | Ga0395898_0081582 | |||
| 1205 | Ga0395905_0023969 | |||
| 1206 | Ga0436364_0048275 | |||
| 1207 | Ga0436364_0937856 | |||
| 1208 | Ga0395901_0005474 | |||
| 1209 | Ga0400483_017169 | |||
| 1210 | Ga0436365_0956137 | |||
| 1211 | Ga0436365_1324557 | |||
| 1212 | Ga0436360_0023881 | |||
| 1213 | Ga0436360_1175566 | |||
| 1214 | Ga0436362_0103639 | |||
| 1215 | Ga0439453_0001175 | |||
| 1216 | Ga0439453_0003715 | |||
| 1217 | Ga0439465_0043109 | |||
| 1218 | Ga0466969_0099216 | |||
| 1219 | Ga0466966_0094141 | |||
| 1220 | Ga0466963_0004084 | |||
| 1221 | Ga0466970_0064020 | |||
| 1222 | Ga0466957_0026868 | |||
| 1223 | Ga0466957_0166155 | |||
| 1224 | Ga0466959_0007200 | |||
| 1225 | Ga0466967_0014366 | |||
| 1226 | Ga0466967_0054589 | |||
| 1227 | Ga0466967_0252422 | |||
| 1228 | Ga0495617_019542 | |||
| 1229 | Ga0495592_0011943 | |||
| 1230 | Ga0495592_0015839 | |||
| 1231 | Ga0495603_0015901 | |||
| 1232 | Ga0495603_0018380 | |||
| 1233 | Ga0495603_0023108 | |||
| 1234 | Ga0495603_0032472 | |||
| 1235 | Ga0495629_0009351 | |||
| 1236 | Ga0495629_0012019 | |||
| 1237 | Ga0495629_0082205 | |||
| 1238 | Ga0495641_0009000 | |||
| 1239 | Ga0495651_0023234 | |||
| 1240 | Ga0495651_0082483 | |||
| 1241 | Ga0495653_0057124 | |||
| 1242 | Ga0495653_0078018 | |||
| 1243 | Ga0495650_0062956 | |||
| 1244 | Ga0495580_0040719 | |||
| 1245 | Ga0495582_0003004 | |||
| 1246 | Ga0495582_0008385 | |||
| 1247 | Ga0495605_0090647 | |||
| 1248 | Ga0495639_0004634 | |||
| 1249 | Ga0495639_0043441 | |||
| 1250 | Ga0495662_0007517 | |||
| 1251 | Ga0495664_0002577 | |||
| 1252 | Ga0495584_0031570 | |||
| 1253 | Ga0495585_0145750 | |||
| 1254 | Ga0495606_0082627 | |||
| 1255 | Ga0495608_0050947 | |||
| 1256 | Ga0495618_0105816 | |||
| 1257 | Ga0495628_0012582 | |||
| 1258 | Ga0495628_0023124 | |||
| 1259 | Ga0495628_0071401 | |||
| 1260 | Ga0495630_0027243 | |||
| 1261 | Ga0495630_0060592 | |||
| 1262 | Ga0495631_0013200 | |||
| 1263 | Ga0495632_0118032 | |||
| 1264 | Ga0495643_0056053 | |||
| 1265 | Ga0495644_0013365 | |||
| 1266 | Ga0495648_0015937 | |||
| 1267 | Ga0495663_0024903 | |||
| 1268 | Ga0495666_0009204 | |||
| 1269 | Ga0495652_0011406 | |||
| 1270 | Ga0495652_0031142 | |||
| 1271 | Ga0495652_0083201 | |||
| 1272 | Ga0495652_0122414 | |||
| 1273 | Ga0495665_0002362 | |||
| 1274 | Ga0495665_0041711 | |||
| 1275 | Ga0495640_0012751 | |||
| 1276 | Ga0495640_0013691 | |||
| 1277 | Ga0495587_0013010 | |||
| 1278 | Ga0495597_0079643 | |||
| 1279 | Ga0495622_0008474 | |||
| 1280 | Ga0495622_0029181 | |||
| 1281 | Ga0495633_0083672 | |||
| 1282 | Ga0495667_0017709 | |||
| 1283 | Ga0495667_0024177 | |||
| 1284 | Ga0495667_0032132 | |||
| 1285 | Ga0495667_0043144 | |||
| 1286 | Ga0495656_0004457 | |||
| 1287 | Ga0495656_0007675 | |||
| 1288 | Ga0495668_0072328 | |||
| 1289 | Ga0495634_0006174 | |||
| 1290 | Ga0495634_0040442 | |||
| 1291 | Ga0495611_0031354 | |||
| 1292 | Ga0495625_0028888 | |||
| 1293 | Ga0495635_0001193 | |||
| 1294 | Ga0495635_0003853 | |||
| 1295 | Ga0495635_0084812 | |||
| 1296 | Ga0495659_0006925 | |||
| 1297 | Ga0495588_0004114 | |||
| 1298 | Ga0495657_0004871 | |||
| 1299 | Ga0495599_0027780 | |||
| 1300 | Ga0495599_0091811 | |||
| 1301 | Ga0495599_0107811 | |||
| 1302 | Ga0495623_0017659 | |||
| 1303 | Ga0495646_0094254 | |||
| 1304 | Ga0495647_0004568 | |||
| 1305 | Ga0495658_0007213 | |||
| 1306 | Ga0495658_0111900 | |||
| 1307 | Ga0495669_0013271 | |||
| 1308 | Ga0495613_0109850 | |||
| 1309 | Ga0495613_0122225 | |||
| 1310 | Ga0495624_0012698 | |||
| 1311 | Ga0495624_0064600 | |||
| 1312 | Ga0495670_0018618 | |||
| 1313 | Ga0495670_0038344 | |||
| 1314 | Ga0495649_0089214 | |||
| 1315 | Ga0495600_0006484 | |||
| 1316 | Ga0495581_0009207 | |||
| 1317 | Ga0495604_0004723 | |||
| 1318 | Ga0495604_0068237 | |||
| 1319 | Ga0495604_0087799 | |||
| 1320 | Ga0495674_0017125 | |||
| 1321 | Ga0495674_0020468 | |||
| 1322 | Ga0495674_0021918 | |||
| 1323 | Ga0495674_0108812 | |||
| 1324 | Ga0495672_0014325 | |||
| 1325 | Ga0495680_0007559 | |||
| 1326 | Ga0495680_0026290 | |||
| 1327 | Ga0495675_0007310 | |||
| 1328 | Ga0495675_0065263 | |||
| 1329 | Ga0495677_0026121 | |||
| 1330 | Ga0495684_0004769 | |||
| 1331 | Ga0495684_0060120 | |||
| 1332 | Ga0495686_0043037 | |||
| 1333 | Ga0495593_0008293 | |||
| 1334 | Ga0495593_0077281 | |||
| 1335 | Ga0495602_0158945 | |||
| 1336 | Ga0496100_0001966 | |||
| 1337 | Ga0496102_0008961 | |||
| 1338 | Ga0496104_0044151 | |||
| 1339 | Ga0496104_0345205 | |||
| 1340 | Ga0496105_0003693 | |||
| 1341 | Ga0496105_0037607 | |||
| 1342 | Ga0496106_0008772 | |||
| 1343 | Ga0496106_0011690 | |||
| 1344 | Ga0496106_0035274 | |||
| 1345 | Ga0496107_0029976 | |||
| 1346 | Ga0496107_0045850 | |||
| 1347 | Ga0496108_0009248 | |||
| 1348 | Ga0496108_0049240 | |||
| 1349 | Ga0496108_0060114 | |||
| 1350 | Ga0496109_0034672 | |||
| 1351 | Ga0496110_0045040 | |||
| 1352 | Ga0496110_0226537 | |||
| 1353 | Ga0496111_0010797 | |||
| 1354 | Ga0496111_0018005 | |||
| 1355 | Ga0496112_0000243 | |||
| 1356 | Ga0496112_0007463 | |||
| 1357 | Ga0496112_0041094 | |||
| 1358 | Ga0496112_0086520 | |||
| 1359 | Ga0496113_0026739 | |||
| 1360 | Ga0496113_0035597 | |||
| 1361 | Ga0496113_0164517 | |||
| 1362 | Ga0496113_0203086 | |||
| 1363 | Ga0496114_0076917 | |||
| 1364 | Ga0496114_0216064 | |||
| 1365 | Ga0496115_0003657 | |||
| 1366 | Ga0496115_0130420 | |||
| 1367 | Ga0496116_0035780 | |||
| 1368 | Ga0496117_0037427 | |||
| 1369 | Ga0496118_0000368 | |||
| 1370 | Ga0496118_0036702 | |||
| 1371 | Ga0496118_0172941 | |||
| 1372 | Ga0496121_0000144 | |||
| 1373 | Ga0496121_0008049 | |||
| 1374 | Ga0496121_0039498 | |||
| 1375 | Ga0496121_0103201 | |||
| 1376 | Ga0496121_0164993 | |||
| 1377 | Ga0496124_0000503 | |||
| 1378 | Ga0496124_0017985 | |||
| 1379 | Ga0496125_0033849 | |||
| 1380 | Ga0496126_0007210 | |||
| 1381 | Ga0496126_0011446 | |||
| 1382 | Ga0496126_0052940 | |||
| 1383 | Ga0496126_0081361 | |||
| 1384 | Ga0496126_0089027 | |||
| 1385 | Ga0496126_0096645 | |||
| 1386 | Ga0496126_0160637 | |||
| 1387 | Ga0501034_0014364 | |||
| 1388 | Ga0501034_0060263 | |||
| 1389 | Ga0501036_0015333 | |||
| 1390 | Ga0501037_0069958 | |||
| 1391 | Ga0501038_0206797 | |||
| 1392 | Ga0501039_0018533 | |||
| 1393 | Ga0501043_0015124 | |||
| 1394 | Ga0501046_0139273 | |||
| 1395 | Ga0501046_0142497 | |||
| 1396 | Ga0501047_0002308 | |||
| 1397 | Ga0501047_0124194 | |||
| 1398 | Ga0501047_0155584 | |||
| 1399 | Ga0501047_0206255 | |||
| 1400 | Ga0501048_0020015 | |||
| 1401 | Ga0501070_0007020 | |||
| 1402 | Ga0501072_0005373 | |||
| 1403 | Ga0501073_0014523 | |||
| 1404 | Ga0501074_0044595 | |||
| 1405 | Ga0501077_0002418 | |||
| 1406 | Ga0501079_0153972 | |||
| 1407 | Ga0501080_0015144 | |||
| 1408 | Ga0501080_0026564 | |||
| 1409 | Ga0501080_0055757 | |||
| 1410 | Ga0501081_0058516 | |||
| 1411 | Ga0501081_0109797 | |||
| 1412 | Ga0501083_0145467 | |||
| 1413 | Ga0501035_0051019 | |||
| 1414 | Ga0501044_0003604 | |||
| 1415 | Ga0501044_0052930 | |||
| 1416 | Ga0501045_0158728 | |||
| 1417 | nmdc:mga03n38_107529_c1 | |||
| 1418 | nmdc:mga03n38_37395_c1 | |||
| 1419 | nmdc:mga00v17_101365_c1 | |||
| 1420 | nmdc:mga00v17_5856_c1 | |||
| 1421 | nmdc:mga0yw44_47602_c1 | |||
| 1422 | nmdc:mga0k408_12201_c1 | |||
| 1423 | nmdc:mga06z11_10424_c1 | |||
| 1424 | nmdc:mga09592_158107_c1 | |||
| 1425 | nmdc:mga08y16_159744_c1 | |||
| 1426 | nmdc:mga08y16_4325_c1 | |||
| 1427 | nmdc:mga0n895_119778_c1 | |||
| 1428 | nmdc:mga0n895_371258_c1 | |||
| 1429 | Ga0495601_0147511 | |||
| 1430 | Ga0495595_0000520 | |||
| 1431 | Ga0495619_0034484 | |||
| 1432 | Ga0500643_002833 | |||
| 1433 | Ga0500647_0048659 | |||
| 1434 | Ga0500647_0067272 | |||
| 1435 | Ga0500583_0085850 | |||
| 1436 | Ga0500651_0022361 | |||
| 1437 | Ga0500566_0000075 | |||
| 1438 | Ga0500566_0000699 | |||
| 1439 | Ga0500566_0005926 | |||
| 1440 | Ga0500641_0031731 | |||
| 1441 | Ga0500594_0005487 | |||
| 1442 | Ga0500595_000003 | |||
| 1443 | Ga0500595_002486 | |||
| 1444 | Ga0500595_003031 | |||
| 1445 | Ga0500595_013526 | |||
| 1446 | Ga0500595_015856 | |||
| 1447 | Ga0500614_000391 | |||
| 1448 | Ga0500652_068947 | |||
| 1449 | Ga0500559_0000245 | |||
| 1450 | Ga0500559_0004273 | |||
| 1451 | Ga0500559_0086454 | |||
| 1452 | Ga0500568_0003807 | |||
| 1453 | Ga0500588_0037202 | |||
| 1454 | Ga0500589_082772 | |||
| 1455 | Ga0500603_000124 | |||
| 1456 | Ga0500603_002939 | |||
| 1457 | Ga0500603_010756 | |||
| 1458 | Ga0500616_0000002 | |||
| 1459 | Ga0500616_0015249 | |||
| 1460 | Ga0500630_000448 | |||
| 1461 | Ga0500638_028905 | |||
| 1462 | Ga0500638_049242 | |||
| 1463 | Ga0500638_104726 | |||
| 1464 | Ga0500639_000112 | |||
| 1465 | Ga0500636_0032504 | |||
| 1466 | Ga0500636_0073063 | |||
| 1467 | Ga0500637_0044081 | |||
| 1468 | Ga0500645_000078 | |||
| 1469 | Ga0500596_004367 | |||
| 1470 | Ga0500596_009127 | |||
| 1471 | Ga0500599_002740 | |||
| 1472 | Ga0500601_001621 | |||
| 1473 | Ga0501084_0193816 | |||
| 1474 | Ga0500661_001975 | |||
| 1475 | Ga0501082_0000510 | |||
| 1476 | Ga0501082_0005454 | |||
| 1477 | Ga0530510_0037742 | |||
| 1478 | 2509148686 | |||
| 1479 | 2513660164 | |||
| 1480 | 2513693624 | |||
| 1481 | 2513862395 | |||
| 1482 | 2513888378 | |||
| 1483 | 2513919408 | |||
| 1484 | 2517105447 | |||
| 1485 | 2524535725 | |||
| 1486 | 2671123976 | |||
| 1487 | 2723847524 | |||
| 1488 | 2728752982 | |||
| 1489 | 2793071361 | |||
| 1490 | 2793081284 | |||
| 1491 | 2834580324 | |||
| 1492 | 2844319547 | |||
| 1493 | 2874611487 | |||
| 1494 | 2876817046 | |||
| 1495 | 2879117569 | |||
| 1496 | 2885376749 | |||
| 1497 | 2885416996 | |||
| 1498 | 2889042288 | |||
| 1499 | 2903734484 | |||
| 1500 | 2903749596 | |||
| 1501 | 2906609279 | |||
| 1502 | 2906611121 | |||
| 1503 | 2906636552 | |||
| 1504 | 2922362910 | |||
| 1505 | 2922390547 | |||
| 1506 | 2922428186 | |||
| 1507 | 3005478171 | |||
| 1508 | 8006932354 | |||
| 1509 | 8006943043 | |||
| 1510 | 8006970152 | |||
| 1511 | 8006982837 | |||
| 1512 | 8006985433 | |||
| 1513 | 8006994510 | |||
| 1514 | 8019558888 | |||
| 1515 | 8019566419 | |||
| 1516 | 8056681246 | |||
| 1517 | 8056694446 | |||
| 1518 | 8056968523 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5aec-assembly1.cif.gz_A | type ii baeyer-villiger monooxygenase.the oxygenating constituent of 3,6-diketocamphane monooxygenase from cam plasmid of pseudomonas putida in complex with fmn. | 0.8893 | 1 | 356 |
| 5aec-assembly1.cif.gz_B | type ii baeyer-villiger monooxygenase.the oxygenating constituent of 3,6-diketocamphane monooxygenase from cam plasmid of pseudomonas putida in complex with fmn. | 0.8881 | 1 | 356 |
| 4uwm-assembly1.cif.gz_A | type ii baeyer-villiger monooxygenase.the oxygenating constituent of 3,6-diketocamphane monooxygenase from cam plasmid of pseudomonas putida in complex with fmn. | 0.8866 | 1 | 356 |
| 4uwm-assembly1.cif.gz_B | type ii baeyer-villiger monooxygenase.the oxygenating constituent of 3,6-diketocamphane monooxygenase from cam plasmid of pseudomonas putida in complex with fmn. | 0.8858 | 1 | 356 |
| 7bip-assembly1.cif.gz_B | crystal structure of monooxygenase rslo1 from streptomyces bottropensis | 0.8797 | 1 | 355 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P95278_1_358_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9193 | 1 | 357 | 3.20.20.30 |
| af_P95278_1_358_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9144 | 1 | 357 | 3.20.20.30 |
| 4uwmA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.8866 | 1 | 356 | 3.20.20.30 |
| 4uwmA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.8704 | 1 | 356 | 3.20.20.30 |
| af_I6X7W8_4_352_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.8426 | 1 | 357 | 3.20.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A345ZWQ3-F1-model_v4 | Flavin-dependent oxidoreductase | 0.9969 | 1 | 361 |
GO:0004497
GO:0005829 GO:0016705 |
| AF-A0A345ZWQ3-F1-model_v4 | Flavin-dependent oxidoreductase | 0.9915 | 1 | 361 |
GO:0004497
GO:0005829 GO:0016705 |
| AF-A0A3N5MLU4-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9878 | 1 | 208 |
GO:0004497
GO:0005829 GO:0016705 |
| AF-A0A1J5PDR7-F1-model_v4 | Luciferase-like domain-containing protein | 0.9832 | 221 | 368 |
GO:0016705
|
| AF-A0A3N5MLU4-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9831 | 1 | 208 |
GO:0004497
GO:0005829 GO:0016705 |