F479502

General Info

Members Datasets Scaffolds Average Seq Length
759 425 1518 368

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_111902_c1|nmdc:mga0k408_111902_c1_240_1592
Length 450
Sequence MHGQQFQRIFDAGCASVSESRGFHFGVTSPANSLHFRGIRRLRPSKVKFVRGDYFDFELVFARRTTHVLCQIKSLPFGEEQTMNLGFFTMPIHPVDKDWRLSLNEDREAFLLADELGFSEGYVGEHTTDRAENITSCIAFIAWLAAATRQIKLGTGTVNMPNAHPAAIAASIAMLDHILDGRLIFGISPGGLLSDAEVFGNLEADRNAMFLEAINQVLQIWASEPPYNLQGQFWNISVQKTLIEDIGQGFIPRPLQRPHPPIVVTAVAPFSKGVTEAAARGWEPISANFLMPAWVKSHWPKYVEGCKRAGRPADPANWRVAKSVFVAKDAATAKAYATDPNGPYVYYYRSLLTKLKRGGRIELFKTRRDQPDDEVTLASICEKLIIHGTPDSVADQILAFQEETGPFGTLLYAGKDWRDRELGRRSMILMAEKVMPRINAGASSGSKAAE

Samples

Sample ID Description Type Environment
1 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
79 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
111 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
114 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
172 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
173 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
174 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
183 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
184 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
185 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
186 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
187 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
188 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
189 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
190 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
191 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
192 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
193 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
194 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
195 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
196 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
199 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
203 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
204 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
205 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
206 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
207 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
209 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
210 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
211 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
212 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
215 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
216 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
227 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
228 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
229 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
230 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
231 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
232 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
233 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
234 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
235 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
238 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
239 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
244 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
245 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
246 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
247 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
248 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
249 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
250 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
251 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
252 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
253 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
254 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
255 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
256 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
259 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
260 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
261 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
262 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
263 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
264 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
265 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
266 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
267 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
268 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
269 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
270 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
271 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
272 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
273 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
274 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
275 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
276 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
277 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
278 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
279 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
280 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
281 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
282 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
283 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
284 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
285 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
286 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
287 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
288 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
289 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
290 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
291 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
292 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
293 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
294 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
295 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
296 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
297 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
298 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
299 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
300 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
301 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
302 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
303 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
304 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
305 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
308 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
309 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
314 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
315 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
316 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
317 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
318 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
319 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
320 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
321 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
322 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
323 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
324 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
325 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
335 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
336 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
337 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
338 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
339 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
340 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
341 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
342 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
343 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
346 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
347 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
348 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
349 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
350 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
351 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
352 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
353 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
354 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
355 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
356 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
357 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
358 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
359 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
360 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
361 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
362 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
363 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
364 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
365 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
366 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
367 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
368 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
369 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
370 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
371 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
372 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
373 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
374 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
375 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
376 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
377 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
378 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
379 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
380 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
381 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
382 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
383 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
384 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
385 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
386 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
387 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
388 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
389 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
390 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
391 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
392 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
393 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
394 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
395 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
396 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
397 2791355199
398 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
399 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
400 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
401 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
402 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
403 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
404 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
405 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
406 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
407 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
408 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
409 2906610324
410 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
411 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
412 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
413 2922425934
414 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
415 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
416 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
417 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
418 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
419 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
420 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
421 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
422 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
423 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
424 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
425 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.97
Metatranscriptomes 0
Isolates 5.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.28
Nodule 4.08
Rhizoplane 4.22
Rhizosphere 74.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0k408_111902_c1 3300050493 Bacteria 1614
2 JGI25406J46586_10000427 3300003203 Bacteria 19396
3 JGI25153J46596_10001468 3300003215 Bacteria 14070
4 rootH1_10011246 3300003323 Bacteria 3114
5 JGI25404J52841_10000743 3300003659 Bacteria 5098
6 Ga0065165_1001530 3300005262 Bacteria 24255
7 Ga0065715_10144331 3300005293 Bacteria 1798
8 Ga0070658_10145193 3300005327 Bacteria 1984
9 Ga0070658_10181543 3300005327 Bacteria 1771
10 Ga0070683_100001547 3300005329 Bacteria 17802
11 Ga0070683_100007227 3300005329 Bacteria 9370
12 Ga0070683_100025184 3300005329 Bacteria 5340
13 Ga0070683_100229193 3300005329 Bacteria 1766
14 Ga0070670_100253154 3300005331 Bacteria 1534
15 Ga0068869_100112053 3300005334 Bacteria 2076
16 Ga0070680_100004177 3300005336 Bacteria 10825
17 Ga0070680_100029327 3300005336 Bacteria 4419
18 Ga0070680_100092866 3300005336 Bacteria 2499
19 Ga0070682_100089667 3300005337 Bacteria 2009
20 Ga0068868_100048648 3300005338 Bacteria 3326
21 Ga0068868_100078090 3300005338 Bacteria 2649
22 Ga0070660_100004765 3300005339 Bacteria 9381
23 Ga0070660_100151256 3300005339 Bacteria 1866
24 Ga0070691_10020669 3300005341 Bacteria 3043
25 Ga0070687_100028973 3300005343 Bacteria 2691
26 Ga0070661_100033765 3300005344 Bacteria 3708
27 Ga0070668_100039747 3300005347 Bacteria 3597
28 Ga0070668_100058493 3300005347 Bacteria 2982
29 Ga0070668_100076610 3300005347 Bacteria 2613
30 Ga0070671_100019364 3300005355 Bacteria 5538
31 Ga0070671_100029173 3300005355 Bacteria 4549
32 Ga0070671_100118268 3300005355 Bacteria 2229
33 Ga0070674_100050645 3300005356 Bacteria 2859
34 Ga0070674_100284126 3300005356 Bacteria 1313
35 Ga0070673_100045712 3300005364 Bacteria 3397
36 Ga0070673_100145708 3300005364 Bacteria 2002
37 Ga0070659_100065860 3300005366 Bacteria 2870
38 Ga0070659_100126567 3300005366 Bacteria 2073
39 Ga0070709_10005541 3300005434 Bacteria 6833
40 Ga0070709_10187687 3300005434 Bacteria 1456
41 Ga0070714_100013074 3300005435 Bacteria 6643
42 Ga0070714_100193326 3300005435 Bacteria 1858
43 Ga0070713_100027095 3300005436 Bacteria 4508
44 Ga0070713_100073252 3300005436 Bacteria 2899
45 Ga0070710_10054823 3300005437 Bacteria 2250
46 Ga0070701_10142093 3300005438 Bacteria 1374
47 Ga0070711_100003525 3300005439 Bacteria 9132
48 Ga0070711_100008622 3300005439 Bacteria 6254
49 Ga0070708_100181949 3300005445 Bacteria 1965
50 Ga0070663_100000736 3300005455 Bacteria 17673
51 Ga0070663_100107000 3300005455 Bacteria 2096
52 Ga0070678_100073707 3300005456 Bacteria 2563
53 Ga0070678_100075387 3300005456 Bacteria 2537
54 Ga0070662_100029622 3300005457 Bacteria 3821
55 Ga0070662_100043001 3300005457 Bacteria 3229
56 Ga0070662_100072640 3300005457 Bacteria 2540
57 Ga0070681_10009108 3300005458 Bacteria 9756
58 Ga0070681_10046397 3300005458 Bacteria 4344
59 Ga0070681_10058095 3300005458 Bacteria 3848
60 Ga0070681_10084622 3300005458 Bacteria 3124
61 Ga0070685_10024687 3300005466 Bacteria 3303
62 Ga0070706_100122730 3300005467 Bacteria 2422
63 Ga0070707_100076183 3300005468 Bacteria 3236
64 Ga0070679_100003396 3300005530 Bacteria 14587
65 Ga0070679_100014293 3300005530 Bacteria 7623
66 Ga0070679_100032807 3300005530 Bacteria 5139
67 Ga0070684_100002360 3300005535 Bacteria 13921
68 Ga0070684_100010214 3300005535 Bacteria 7429
69 Ga0068853_100007764 3300005539 Bacteria 8604
70 Ga0068853_100016904 3300005539 Bacteria 6012
71 Ga0068853_100027851 3300005539 Bacteria 4750
72 Ga0068853_100071086 3300005539 Bacteria 3030
73 Ga0068853_100194118 3300005539 Bacteria 1846
74 Ga0070672_100236106 3300005543 Bacteria 1537
75 Ga0070693_100009703 3300005547 Bacteria 4795
76 Ga0070665_100025420 3300005548 Bacteria 5967
77 Ga0070665_100143011 3300005548 Bacteria 2395
78 Ga0068855_100019998 3300005563 Bacteria 8040
79 Ga0068855_100063031 3300005563 Bacteria 4327
80 Ga0068855_100070450 3300005563 Bacteria 4067
81 Ga0068855_100370998 3300005563 Bacteria 1573
82 Ga0070664_100025362 3300005564 Bacteria 4913
83 Ga0068857_100007288 3300005577 Bacteria 9525
84 Ga0068854_100083207 3300005578 Bacteria 2366
85 Ga0068856_100000183 3300005614 Bacteria 65005
86 Ga0068856_100042682 3300005614 Bacteria 4461
87 Ga0068856_100116406 3300005614 Bacteria 2673
88 Ga0068852_100008748 3300005616 Bacteria 7487
89 Ga0068852_100018677 3300005616 Bacteria 5465
90 Ga0068859_100055884 3300005617 Bacteria 3972
91 Ga0068864_100015786 3300005618 Bacteria 6283
92 Ga0068861_100011429 3300005719 Bacteria 6173
93 Ga0068861_100062787 3300005719 Bacteria 2854
94 Ga0068861_100202672 3300005719 Bacteria 1666
95 Ga0068851_10006248 3300005834 Bacteria 5436
96 Ga0068851_10036850 3300005834 Bacteria 2451
97 Ga0068863_100075269 3300005841 Bacteria 3194
98 Ga0068858_100042194 3300005842 Bacteria 4230
99 Ga0068858_100115231 3300005842 Bacteria 2511
100 Ga0068862_100116089 3300005844 Bacteria 2354
101 Ga0068862_100153030 3300005844 Bacteria 2054
102 Ga0068862_100408332 3300005844 Bacteria 1272
103 Ga0081455_10000968 3300005937 Bacteria 36782
104 Ga0081455_10006130 3300005937 Bacteria 12989
105 Ga0081455_10027486 3300005937 Bacteria 5214
106 Ga0081455_10043147 3300005937 Bacteria 3949
107 Ga0081455_10174483 3300005937 Bacteria 1634
108 Ga0081538_10008625 3300005981 Bacteria 8621
109 Ga0081538_10027677 3300005981 Bacteria 3922
110 Ga0081540_1001901 3300005983 Bacteria 17473
111 Ga0081540_1001903 3300005983 Bacteria 17470
112 Ga0081540_1008229 3300005983 Bacteria 7308
113 Ga0081540_1009156 3300005983 Bacteria 6833
114 Ga0081540_1027395 3300005983 Bacteria 3230
115 Ga0081540_1028634 3300005983 Bacteria 3123
116 Ga0081539_10000003 3300005985 Bacteria 594833
117 Ga0081539_10001264 3300005985 Bacteria 44681
118 Ga0081539_10009942 3300005985 Bacteria 7844
119 Ga0081539_10021323 3300005985 Bacteria 4335
120 Ga0081539_10022414 3300005985 Bacteria 4179
121 Ga0070717_10000620 3300006028 Bacteria 22822
122 Ga0070717_10003695 3300006028 Bacteria 10995
123 Ga0070717_10021656 3300006028 Bacteria 5069
124 Ga0070717_10064138 3300006028 Bacteria 3051
125 Ga0075365_10056818 3300006038 Bacteria 2602
126 Ga0075365_10070940 3300006038 Bacteria 2344
127 Ga0075365_10180878 3300006038 Bacteria 1474
128 Ga0075368_10000568 3300006042 Bacteria 11071
129 Ga0075363_100057360 3300006048 Bacteria 2090
130 Ga0075364_10026158 3300006051 Bacteria 3721
131 Ga0070716_100020164 3300006173 Bacteria 3497
132 Ga0070712_100221595 3300006175 Bacteria 1498
133 Ga0070712_100258062 3300006175 Bacteria 1396
134 Ga0075362_10006285 3300006177 Bacteria 4416
135 Ga0075367_10040317 3300006178 Bacteria 2726
136 Ga0075367_10064551 3300006178 Bacteria 2190
137 Ga0075367_10119282 3300006178 Bacteria 1624
138 Ga0075369_10006424 3300006186 Bacteria 4442
139 Ga0075366_10010155 3300006195 Bacteria 5280
140 Ga0075366_10128813 3300006195 Bacteria 1527
141 Ga0075370_10020093 3300006353 Bacteria 3645
142 Ga0075370_10049433 3300006353 Bacteria 2384
143 Ga0068871_100018780 3300006358 Bacteria 5266
144 Ga0068871_100124261 3300006358 Bacteria 2183
145 Ga0068871_100220867 3300006358 Bacteria 1642
146 Ga0068871_100231003 3300006358 Bacteria 1605
147 Ga0075428_100002217 3300006844 Bacteria 21050
148 Ga0075428_100199239 3300006844 Bacteria 2165
149 Ga0075428_100564828 3300006844 Bacteria 1216
150 Ga0075434_100033237 3300006871 Bacteria 5089
151 Ga0075429_100045445 3300006880 Bacteria 3821
152 Ga0097620_100055884 3300006931 Bacteria 3972
153 Ga0099824_1013434 3300006942 Bacteria 8497
154 Ga0099822_1002066 3300006943 Bacteria 24562
155 Ga0099794_10002279 3300007265 Bacteria 7050
156 Ga0099795_10006177 3300007788 Bacteria 3248
157 Ga0099795_10018213 3300007788 Bacteria 2253
158 Ga0105240_10007889 3300009093 Bacteria 15352
159 Ga0105240_10030954 3300009093 Bacteria 6948
160 Ga0105240_10057601 3300009093 Bacteria 4853
161 Ga0105240_10073130 3300009093 Bacteria 4234
162 Ga0111539_10001244 3300009094 Bacteria 33917
163 Ga0105245_10006466 3300009098 Bacteria 10308
164 Ga0105245_10021026 3300009098 Bacteria 5724
165 Ga0105245_10056619 3300009098 Bacteria 3524
166 Ga0105245_10110736 3300009098 Bacteria 2553
167 Ga0105245_10146381 3300009098 Bacteria 2229
168 Ga0105247_10018512 3300009101 Bacteria 4177
169 Ga0105243_10308856 3300009148 Bacteria 1436
170 Ga0105241_10001928 3300009174 Bacteria 15692
171 Ga0105241_10021404 3300009174 Bacteria 4780
172 Ga0105241_10122551 3300009174 Bacteria 2095
173 Ga0105242_10157759 3300009176 Bacteria 1983
174 Ga0105242_10210905 3300009176 Bacteria 1731
175 Ga0105248_10010552 3300009177 Bacteria 10178
176 Ga0105248_10123329 3300009177 Bacteria 2923
177 Ga0105248_10284802 3300009177 Bacteria 1861
178 Ga0105237_10002303 3300009545 Bacteria 23741
179 Ga0105237_10012648 3300009545 Bacteria 8884
180 Ga0105237_10123552 3300009545 Bacteria 2583
181 Ga0105237_10186159 3300009545 Bacteria 2076
182 Ga0105237_10340699 3300009545 Bacteria 1504
183 Ga0105238_10000813 3300009551 Bacteria 32330
184 Ga0105238_10002953 3300009551 Bacteria 16966
185 Ga0105238_10026202 3300009551 Bacteria 5941
186 Ga0105238_10058304 3300009551 Bacteria 3870
187 Ga0105238_10146792 3300009551 Bacteria 2335
188 Ga0105238_10246860 3300009551 Bacteria 1763
189 Ga0105238_10278384 3300009551 Bacteria 1654
190 Ga0105238_10320641 3300009551 Bacteria 1535
191 Ga0105238_10331622 3300009551 Bacteria 1508
192 Ga0099796_10006594 3300010159 Bacteria 2983
193 Ga0099796_10032444 3300010159 Bacteria 1711
194 Ga0105239_10010234 3300010375 Bacteria 10503
195 Ga0105239_10013645 3300010375 Bacteria 9020
196 Ga0105239_10016969 3300010375 Bacteria 8048
197 Ga0105239_10019242 3300010375 Bacteria 7541
198 Ga0105239_10069197 3300010375 Bacteria 3878
199 Ga0105239_10237538 3300010375 Bacteria 2046
200 Ga0105246_10022719 3300011119 Bacteria 4051
201 Ga0105246_10114055 3300011119 Bacteria 1990
202 Ga0157370_10059395 3300013104 Bacteria 3634
203 Ga0157370_10250655 3300013104 Bacteria 1638
204 Ga0157369_10002453 3300013105 Bacteria 22254
205 Ga0157369_10003244 3300013105 Bacteria 19372
206 Ga0157369_10011859 3300013105 Bacteria 9898
207 Ga0157374_10008339 3300013296 Bacteria 8845
208 Ga0157374_10017285 3300013296 Bacteria 6348
209 Ga0157374_10029281 3300013296 Bacteria 4984
210 Ga0157374_10075141 3300013296 Bacteria 3193
211 Ga0157378_10004403 3300013297 Bacteria 12399
212 Ga0163162_10007321 3300013306 Bacteria 10728
213 Ga0163162_10095815 3300013306 Bacteria 3055
214 Ga0163162_10166013 3300013306 Bacteria 2331
215 Ga0157372_10029296 3300013307 Bacteria 6010
216 Ga0157372_10172243 3300013307 Bacteria 2505
217 Ga0157375_10073245 3300013308 Bacteria 3444
218 Ga0157375_10128688 3300013308 Bacteria 2650
219 Ga0163163_10031547 3300014325 Bacteria 5116
220 Ga0157377_10023715 3300014745 Bacteria 3255
221 Ga0157379_10215914 3300014968 Bacteria 1737
222 Ga0157376_10002079 3300014969 Bacteria 13458
223 Ga0163161_10119501 3300017792 Bacteria 1979
224 Ga0163161_10281694 3300017792 Bacteria 1304
225 Ga0213873_10019393 3300021358 Bacteria 1577
226 Ga0213876_10005651 3300021384 Bacteria 6865
227 Ga0213876_10107138 3300021384 Bacteria 1483
228 Ga0213875_10025026 3300021388 Bacteria 2845
229 Ga0213871_10008889 3300021441 Bacteria 2231
230 Ga0209677_102191 3300025253 Bacteria 7598
231 Ga0209148_1000474 3300025254 Bacteria 42596
232 Ga0209233_1008616 3300025261 Bacteria 3142
233 Ga0209455_1002818 3300025272 Bacteria 6464
234 Ga0209455_1004350 3300025272 Bacteria 4674
235 Ga0209758_1001548 3300025297 Bacteria 26409
236 Ga0209758_1001765 3300025297 Bacteria 23988
237 Ga0209758_1011005 3300025297 Bacteria 5308
238 Ga0209758_1021808 3300025297 Bacteria 2967
239 Ga0207426_1002873 3300025302 Bacteria 10217
240 Ga0207656_10048626 3300025321 Bacteria 1826
241 Ga0207682_10015987 3300025893 Bacteria 2925
242 Ga0207692_10001623 3300025898 Bacteria 8480
243 Ga0207692_10021567 3300025898 Bacteria 2949
244 Ga0207642_10014396 3300025899 Bacteria 2918
245 Ga0207710_10051580 3300025900 Bacteria 1848
246 Ga0207688_10044215 3300025901 Bacteria 2482
247 Ga0207680_10132232 3300025903 Bacteria 1646
248 Ga0207685_10005573 3300025905 Bacteria 3338
249 Ga0207699_10015322 3300025906 Bacteria 3979
250 Ga0207699_10093795 3300025906 Bacteria 1890
251 Ga0207699_10189401 3300025906 Bacteria 1387
252 Ga0207645_10151570 3300025907 Bacteria 1513
253 Ga0207705_10154400 3300025909 Bacteria 1722
254 Ga0207705_10169442 3300025909 Bacteria 1644
255 Ga0207705_10214311 3300025909 Bacteria 1461
256 Ga0207684_10126842 3300025910 Bacteria 2190
257 Ga0207654_10009050 3300025911 Bacteria 5053
258 Ga0207707_10000980 3300025912 Bacteria 27397
259 Ga0207707_10026490 3300025912 Bacteria 5067
260 Ga0207707_10037766 3300025912 Bacteria 4219
261 Ga0207707_10038469 3300025912 Bacteria 4180
262 Ga0207707_10078526 3300025912 Bacteria 2882
263 Ga0207707_10215303 3300025912 Bacteria 1672
264 Ga0207695_10021018 3300025913 Bacteria 7455
265 Ga0207695_10064206 3300025913 Bacteria 3782
266 Ga0207695_10129357 3300025913 Bacteria 2483
267 Ga0207671_10009312 3300025914 Bacteria 8222
268 Ga0207671_10013822 3300025914 Bacteria 6411
269 Ga0207671_10021988 3300025914 Bacteria 4830
270 Ga0207671_10069958 3300025914 Bacteria 2615
271 Ga0207671_10233380 3300025914 Bacteria 1444
272 Ga0207693_10034827 3300025915 Bacteria 3971
273 Ga0207693_10049542 3300025915 Bacteria 3298
274 Ga0207663_10012650 3300025916 Bacteria 4568
275 Ga0207663_10028886 3300025916 Bacteria 3251
276 Ga0207663_10095432 3300025916 Bacteria 1984
277 Ga0207660_10001768 3300025917 Bacteria 14451
278 Ga0207660_10156058 3300025917 Bacteria 1757
279 Ga0207662_10047034 3300025918 Bacteria 2555
280 Ga0207662_10053271 3300025918 Bacteria 2410
281 Ga0207657_10001056 3300025919 Bacteria 29204
282 Ga0207652_10002280 3300025921 Bacteria 16277
283 Ga0207652_10033130 3300025921 Bacteria 4348
284 Ga0207652_10065044 3300025921 Bacteria 3157
285 Ga0207646_10178565 3300025922 Bacteria 1917
286 Ga0207694_10012836 3300025924 Bacteria 6309
287 Ga0207694_10015467 3300025924 Bacteria 5754
288 Ga0207694_10015474 3300025924 Bacteria 5753
289 Ga0207694_10021451 3300025924 Bacteria 4895
290 Ga0207694_10024414 3300025924 Bacteria 4592
291 Ga0207694_10130653 3300025924 Bacteria 2013
292 Ga0207659_10254608 3300025926 Bacteria 1426
293 Ga0207687_10006448 3300025927 Bacteria 7753
294 Ga0207687_10123287 3300025927 Bacteria 1941
295 Ga0207700_10022695 3300025928 Bacteria 4310
296 Ga0207700_10049586 3300025928 Bacteria 3124
297 Ga0207700_10207392 3300025928 Bacteria 1655
298 Ga0207664_10054592 3300025929 Bacteria 3166
299 Ga0207644_10014914 3300025931 Bacteria 5210
300 Ga0207644_10077364 3300025931 Bacteria 2450
301 Ga0207690_10289196 3300025932 Bacteria 1279
302 Ga0207706_10012032 3300025933 Bacteria 7884
303 Ga0207706_10037923 3300025933 Bacteria 4276
304 Ga0207686_10180445 3300025934 Bacteria 1497
305 Ga0207709_10036338 3300025935 Bacteria 2919
306 Ga0207709_10038706 3300025935 Bacteria 2843
307 Ga0207709_10106369 3300025935 Bacteria 1866
308 Ga0207670_10080719 3300025936 Bacteria 2274
309 Ga0207670_10088002 3300025936 Bacteria 2189
310 Ga0207670_10199916 3300025936 Bacteria 1518
311 Ga0207669_10009224 3300025937 Bacteria 4684
312 Ga0207669_10129670 3300025937 Bacteria 1730
313 Ga0207665_10017990 3300025939 Bacteria 4645
314 Ga0207665_10033418 3300025939 Bacteria 3409
315 Ga0207665_10068810 3300025939 Bacteria 2413
316 Ga0207691_10098671 3300025940 Bacteria 2609
317 Ga0207711_10018668 3300025941 Bacteria 5766
318 Ga0207711_10115615 3300025941 Bacteria 2391
319 Ga0207689_10038905 3300025942 Bacteria 3938
320 Ga0207661_10000978 3300025944 Bacteria 18856
321 Ga0207661_10004599 3300025944 Bacteria 9672
322 Ga0207661_10104511 3300025944 Bacteria 2385
323 Ga0207667_10017021 3300025949 Bacteria 8199
324 Ga0207667_10021904 3300025949 Bacteria 7073
325 Ga0207667_10071137 3300025949 Bacteria 3618
326 Ga0207667_10186153 3300025949 Bacteria 2131
327 Ga0207667_10298888 3300025949 Bacteria 1645
328 Ga0207651_10063868 3300025960 Bacteria 2574
329 Ga0207640_10075807 3300025981 Bacteria 2281
330 Ga0207640_10098130 3300025981 Bacteria 2047
331 Ga0207677_10026223 3300026023 Bacteria 3651
332 Ga0207677_10090680 3300026023 Bacteria 2222
333 Ga0207677_10209149 3300026023 Bacteria 1557
334 Ga0207703_10030499 3300026035 Bacteria 4262
335 Ga0207703_10040078 3300026035 Bacteria 3747
336 Ga0207639_10057754 3300026041 Bacteria 2981
337 Ga0207639_10155818 3300026041 Bacteria 1919
338 Ga0207639_10164289 3300026041 Bacteria 1874
339 Ga0207678_10025052 3300026067 Bacteria 5209
340 Ga0207678_10049544 3300026067 Bacteria 3630
341 Ga0207678_10069217 3300026067 Bacteria 3026
342 Ga0207678_10122266 3300026067 Bacteria 2221
343 Ga0207702_10000931 3300026078 Bacteria 30177
344 Ga0207702_10019880 3300026078 Bacteria 5563
345 Ga0207702_10180758 3300026078 Bacteria 1942
346 Ga0207641_10033308 3300026088 Bacteria 4281
347 Ga0207641_10107502 3300026088 Bacteria 2468
348 Ga0207648_10024498 3300026089 Bacteria 5386
349 Ga0207648_10120474 3300026089 Bacteria 2307
350 Ga0207674_10109712 3300026116 Bacteria 2735
351 Ga0207675_100017977 3300026118 Bacteria 6595
352 Ga0207683_10030688 3300026121 Bacteria 4660
353 Ga0207683_10059906 3300026121 Bacteria 3345
354 Ga0207683_10215239 3300026121 Bacteria 1750
355 Ga0207683_10405756 3300026121 Bacteria 1254
356 Ga0207698_10065235 3300026142 Bacteria 2858
357 Ga0207698_10084629 3300026142 Bacteria 2572
358 Ga0207698_10230811 3300026142 Bacteria 1680
359 Ga0209589_1000004 3300027357 Bacteria 578529
360 Ga0209489_100004 3300027361 Bacteria 578529
361 Ga0209700_100004 3300027363 Bacteria 578529
362 Ga0209179_1006316 3300027512 Bacteria 1904
363 Ga0209179_1010413 3300027512 Bacteria 1621
364 Ga0209968_1012748 3300027526 Bacteria 1313
365 Ga0209588_1012945 3300027671 Bacteria 2538
366 Ga0209813_10004076 3300027866 Bacteria 3465
367 Ga0207428_10144870 3300027907 Bacteria 1811
368 Ga0268266_10014979 3300028379 Bacteria 6656
369 Ga0268266_10035979 3300028379 Bacteria 4212
370 Ga0268266_10081876 3300028379 Bacteria 2815
371 Ga0268266_10128937 3300028379 Bacteria 2260
372 Ga0268265_10135733 3300028380 Bacteria 2052
373 Ga0268264_10000073 3300028381 Bacteria 260615
374 Ga0265318_10010442 3300028577 Bacteria 4045
375 Ga0307517_10000756 3300028786 Bacteria 55661
376 Ga0307515_10016019 3300028794 Bacteria 13759
377 Ga0307511_10064493 3300030521 Bacteria 2753
378 Ga0265330_10008288 3300031235 Bacteria 5009
379 Ga0265330_10033498 3300031235 Bacteria 2297
380 Ga0265328_10005665 3300031239 Bacteria 5337
381 Ga0265320_10017383 3300031240 Bacteria 3997
382 Ga0265325_10022559 3300031241 Bacteria 3447
383 Ga0265340_10023117 3300031247 Bacteria 3172
384 Ga0265340_10032140 3300031247 Bacteria 2621
385 Ga0265340_10039366 3300031247 Bacteria 2333
386 Ga0265331_10001606 3300031250 Bacteria 16506
387 Ga0265331_10010603 3300031250 Bacteria 5089
388 Ga0265316_10097225 3300031344 Bacteria 2241
389 Ga0265316_10158652 3300031344 Bacteria 1692
390 Ga0265316_10212618 3300031344 Bacteria 1430
391 Ga0307513_10030795 3300031456 Bacteria 6090
392 Ga0307509_10170678 3300031507 Bacteria 2055
393 Ga0265313_10030548 3300031595 Bacteria 2772
394 Ga0307508_10000025 3300031616 Bacteria 174642
395 Ga0307508_10053562 3300031616 Bacteria 3580
396 Ga0265314_10000895 3300031711 Bacteria 35520
397 Ga0265314_10001458 3300031711 Bacteria 26393
398 Ga0265314_10014289 3300031711 Bacteria 6364
399 Ga0265314_10110193 3300031711 Bacteria 1751
400 Ga0265342_10028079 3300031712 Bacteria 3509
401 Ga0265342_10082351 3300031712 Bacteria 1857
402 Ga0307516_10004702 3300031730 Bacteria 16699
403 Ga0307516_10012948 3300031730 Bacteria 8939
404 Ga0307406_10053043 3300031901 Bacteria 2582
405 Ga0307416_100330771 3300032002 Bacteria 1531
406 Ga0307507_10023208 3300033179 Bacteria 6818
407 Ga0307510_10042569 3300033180 Bacteria 4947
408 Ga0315911_1000014 3300033442 Bacteria 207605
409 Ga0316215_1001396 3300033544 Bacteria 2324
410 Ga0373926_0030460 3300035083 Bacteria 1900
411 Ga0373923_0008211 3300035111 Bacteria 3710
412 Ga0373923_0032949 3300035111 Bacteria 2096
413 Ga0373923_0064237 3300035111 Bacteria 1565
414 Ga0373945_0044619 3300035116 Bacteria 1613
415 Ga0373954_0017812 3300035118 Bacteria 3193
416 Ga0373954_0038713 3300035118 Bacteria 2218
417 Ga0373954_0045823 3300035118 Bacteria 2043
418 Ga0373943_0012642 3300035170 Bacteria 3805
419 Ga0373943_0021171 3300035170 Bacteria 3002
420 Ga0373943_0093375 3300035170 Bacteria 1562
421 Ga0373946_0011389 3300035171 Bacteria 3318
422 Ga0373946_0051175 3300035171 Bacteria 1728
423 Ga0373946_0096291 3300035171 Bacteria 1320
424 Ga0373924_0000771 3300035410 Bacteria 9947
425 Ga0373924_0005907 3300035410 Bacteria 4362
426 Ga0373935_0009037 3300035692 Bacteria 5962
427 Ga0373935_0037992 3300035692 Bacteria 3013
428 Ga0373927_0060396 3300035695 Bacteria 2453
429 Ga0373933_0000052 3300035724 Bacteria 70592
430 Ga0373933_0071185 3300035724 Bacteria 2116
431 Ga0373947_0010219 3300035725 Bacteria 5388
432 Ga0373947_0016342 3300035725 Bacteria 4265
433 Ga0373947_0021732 3300035725 Bacteria 3716
434 Ga0373947_0029897 3300035725 Bacteria 3198
435 Ga0373937_0034113 3300036401 Bacteria 4628
436 Ga0373937_0097601 3300036401 Bacteria 2725
437 Ga0373925_0011826 3300037068 Bacteria 6316
438 Ga0373925_0028774 3300037068 Bacteria 4073
439 Ga0373925_0078961 3300037068 Bacteria 2499
440 Ga0373925_0197097 3300037068 Bacteria 1600
441 Ga0395900_0001158 3300037418 Bacteria 33053
442 Ga0395900_0015185 3300037418 Bacteria 7852
443 Ga0395900_0439525 3300037418 Bacteria 1262
444 Ga0395898_0005716 3300037466 Bacteria 13400
445 Ga0395898_0081582 3300037466 Bacteria 3118
446 Ga0395905_0023969 3300037471 Bacteria 5762
447 Ga0436364_0048275 3300037853 Bacteria 3885
448 Ga0436364_0937856 3300037853 Bacteria 2752
449 Ga0395901_0005474 3300038443 Bacteria 12858
450 Ga0400483_017169 3300039062 Bacteria 12778
451 Ga0436365_0956137 3300039437 Bacteria 2020
452 Ga0436365_1324557 3300039437 Bacteria 36147
453 Ga0436360_0023881 3300039438 Bacteria 3986
454 Ga0436360_1175566 3300039438 Bacteria 2503
455 Ga0436362_0103639 3300039453 Bacteria 1745
456 Ga0439453_0001175 3300041408 Bacteria 3286
457 Ga0439453_0003715 3300041408 Bacteria 2216
458 Ga0439465_0043109 3300041413 Bacteria 1464
459 Ga0466969_0099216 3300044656 Bacteria 1373
460 Ga0466966_0094141 3300044684 Bacteria 1857
461 Ga0466963_0004084 3300044694 Bacteria 8445
462 Ga0466970_0064020 3300044765 Bacteria 1972
463 Ga0466957_0026868 3300044842 Bacteria 3417
464 Ga0466957_0166155 3300044842 Bacteria 1435
465 Ga0466959_0007200 3300045049 Bacteria 7793
466 Ga0466967_0014366 3300045976 Bacteria 6165
467 Ga0466967_0054589 3300045976 Bacteria 3517
468 Ga0466967_0252422 3300045976 Bacteria 1685
469 Ga0495617_019542 3300046452 Bacteria 2291
470 Ga0495592_0011943 3300046454 Bacteria 6583
471 Ga0495592_0015839 3300046454 Bacteria 5719
472 Ga0495603_0015901 3300046455 Bacteria 4548
473 Ga0495603_0018380 3300046455 Bacteria 4230
474 Ga0495603_0023108 3300046455 Bacteria 3764
475 Ga0495603_0032472 3300046455 Bacteria 3140
476 Ga0495629_0009351 3300046459 Bacteria 7172
477 Ga0495629_0012019 3300046459 Bacteria 6275
478 Ga0495629_0082205 3300046459 Bacteria 2248
479 Ga0495641_0009000 3300046461 Bacteria 5997
480 Ga0495651_0023234 3300046462 Bacteria 4822
481 Ga0495651_0082483 3300046462 Bacteria 2426
482 Ga0495653_0057124 3300046463 Bacteria 2972
483 Ga0495653_0078018 3300046463 Bacteria 2458
484 Ga0495650_0062956 3300046471 Bacteria 1481
485 Ga0495580_0040719 3300046472 Bacteria 3317
486 Ga0495582_0003004 3300046473 Bacteria 9451
487 Ga0495582_0008385 3300046473 Bacteria 5702
488 Ga0495605_0090647 3300046474 Bacteria 1417
489 Ga0495639_0004634 3300046475 Bacteria 5902
490 Ga0495639_0043441 3300046475 Bacteria 2030
491 Ga0495662_0007517 3300046476 Bacteria 5383
492 Ga0495664_0002577 3300046477 Bacteria 9747
493 Ga0495584_0031570 3300046491 Bacteria 2681
494 Ga0495585_0145750 3300046492 Bacteria 1237
495 Ga0495606_0082627 3300046507 Bacteria 1993
496 Ga0495608_0050947 3300046511 Bacteria 2745
497 Ga0495618_0105816 3300046514 Bacteria 1801
498 Ga0495628_0012582 3300046516 Bacteria 7130
499 Ga0495628_0023124 3300046516 Bacteria 5104
500 Ga0495628_0071401 3300046516 Bacteria 2706
501 Ga0495630_0027243 3300046517 Bacteria 4237
502 Ga0495630_0060592 3300046517 Bacteria 2841
503 Ga0495631_0013200 3300046518 Bacteria 4015
504 Ga0495632_0118032 3300046519 Bacteria 1241
505 Ga0495643_0056053 3300046522 Bacteria 2105
506 Ga0495644_0013365 3300046523 Bacteria 3150
507 Ga0495648_0015937 3300046524 Bacteria 5431
508 Ga0495663_0024903 3300046525 Bacteria 1742
509 Ga0495666_0009204 3300046526 Bacteria 4938
510 Ga0495652_0011406 3300046529 Bacteria 8038
511 Ga0495652_0031142 3300046529 Bacteria 4673
512 Ga0495652_0083201 3300046529 Bacteria 2635
513 Ga0495652_0122414 3300046529 Bacteria 2072
514 Ga0495665_0002362 3300046531 Bacteria 10187
515 Ga0495665_0041711 3300046531 Bacteria 2443
516 Ga0495640_0012751 3300046533 Bacteria 6417
517 Ga0495640_0013691 3300046533 Bacteria 6163
518 Ga0495587_0013010 3300046536 Bacteria 5233
519 Ga0495597_0079643 3300046542 Bacteria 1403
520 Ga0495622_0008474 3300046557 Bacteria 4760
521 Ga0495622_0029181 3300046557 Bacteria 2577
522 Ga0495633_0083672 3300046558 Bacteria 1484
523 Ga0495667_0017709 3300046559 Bacteria 4812
524 Ga0495667_0024177 3300046559 Bacteria 4092
525 Ga0495667_0032132 3300046559 Bacteria 3520
526 Ga0495667_0043144 3300046559 Bacteria 2990
527 Ga0495656_0004457 3300046615 Bacteria 4799
528 Ga0495656_0007675 3300046615 Bacteria 3824
529 Ga0495668_0072328 3300046616 Bacteria 1894
530 Ga0495634_0006174 3300046642 Bacteria 9124
531 Ga0495634_0040442 3300046642 Bacteria 3171
532 Ga0495611_0031354 3300046648 Bacteria 2339
533 Ga0495625_0028888 3300046660 Bacteria 4152
534 Ga0495635_0001193 3300046663 Bacteria 17302
535 Ga0495635_0003853 3300046663 Bacteria 10418
536 Ga0495635_0084812 3300046663 Bacteria 2167
537 Ga0495659_0006925 3300046664 Bacteria 3588
538 Ga0495588_0004114 3300046674 Bacteria 6404
539 Ga0495657_0004871 3300046675 Bacteria 10689
540 Ga0495599_0027780 3300046678 Bacteria 3545
541 Ga0495599_0091811 3300046678 Bacteria 1895
542 Ga0495599_0107811 3300046678 Bacteria 1735
543 Ga0495623_0017659 3300046679 Bacteria 4608
544 Ga0495646_0094254 3300046680 Bacteria 1724
545 Ga0495647_0004568 3300046681 Bacteria 4507
546 Ga0495658_0007213 3300046683 Bacteria 5492
547 Ga0495658_0111900 3300046683 Bacteria 1642
548 Ga0495669_0013271 3300046684 Bacteria 3509
549 Ga0495613_0109850 3300046689 Bacteria 1988
550 Ga0495613_0122225 3300046689 Bacteria 1869
551 Ga0495624_0012698 3300046690 Bacteria 5752
552 Ga0495624_0064600 3300046690 Bacteria 2287
553 Ga0495670_0018618 3300046691 Bacteria 3420
554 Ga0495670_0038344 3300046691 Bacteria 2389
555 Ga0495649_0089214 3300046694 Bacteria 1644
556 Ga0495600_0006484 3300046809 Bacteria 7122
557 Ga0495581_0009207 3300047315 Bacteria 5711
558 Ga0495604_0004723 3300047317 Bacteria 10795
559 Ga0495604_0068237 3300047317 Bacteria 2699
560 Ga0495604_0087799 3300047317 Bacteria 2315
561 Ga0495674_0017125 3300047319 Bacteria 6750
562 Ga0495674_0020468 3300047319 Bacteria 6123
563 Ga0495674_0021918 3300047319 Bacteria 5900
564 Ga0495674_0108812 3300047319 Bacteria 2351
565 Ga0495672_0014325 3300047320 Bacteria 5435
566 Ga0495680_0007559 3300047322 Bacteria 9938
567 Ga0495680_0026290 3300047322 Bacteria 4801
568 Ga0495675_0007310 3300047444 Bacteria 6806
569 Ga0495675_0065263 3300047444 Bacteria 2302
570 Ga0495677_0026121 3300047445 Bacteria 2119
571 Ga0495684_0004769 3300047471 Bacteria 10598
572 Ga0495684_0060120 3300047471 Bacteria 2893
573 Ga0495686_0043037 3300047472 Bacteria 2867
574 Ga0495593_0008293 3300047673 Bacteria 6045
575 Ga0495593_0077281 3300047673 Bacteria 1724
576 Ga0495602_0158945 3300048088 Bacteria 1767
577 Ga0496100_0001966 3300048903 Bacteria 10302
578 Ga0496102_0008961 3300048905 Bacteria 8584
579 Ga0496104_0044151 3300048907 Bacteria 4188
580 Ga0496104_0345205 3300048907 Bacteria 1401
581 Ga0496105_0003693 3300048908 Bacteria 11390
582 Ga0496105_0037607 3300048908 Bacteria 3985
583 Ga0496106_0008772 3300048909 Bacteria 7471
584 Ga0496106_0011690 3300048909 Bacteria 6484
585 Ga0496106_0035274 3300048909 Bacteria 3740
586 Ga0496107_0029976 3300048910 Bacteria 3875
587 Ga0496107_0045850 3300048910 Bacteria 3145
588 Ga0496108_0009248 3300048911 Bacteria 7972
589 Ga0496108_0049240 3300048911 Bacteria 3524
590 Ga0496108_0060114 3300048911 Bacteria 3197
591 Ga0496109_0034672 3300048912 Bacteria 4548
592 Ga0496110_0045040 3300048913 Bacteria 3854
593 Ga0496110_0226537 3300048913 Bacteria 1700
594 Ga0496111_0010797 3300048914 Bacteria 6140
595 Ga0496111_0018005 3300048914 Bacteria 4887
596 Ga0496112_0000243 3300048915 Bacteria 34998
597 Ga0496112_0007463 3300048915 Bacteria 9710
598 Ga0496112_0041094 3300048915 Bacteria 4524
599 Ga0496112_0086520 3300048915 Bacteria 3101
600 Ga0496113_0026739 3300048916 Bacteria 4129
601 Ga0496113_0035597 3300048916 Bacteria 3641
602 Ga0496113_0164517 3300048916 Bacteria 1755
603 Ga0496113_0203086 3300048916 Bacteria 1575
604 Ga0496114_0076917 3300048917 Bacteria 2813
605 Ga0496114_0216064 3300048917 Bacteria 1682
606 Ga0496115_0003657 3300048918 Bacteria 11062
607 Ga0496115_0130420 3300048918 Bacteria 2072
608 Ga0496116_0035780 3300048919 Bacteria 3484
609 Ga0496117_0037427 3300048920 Bacteria 3614
610 Ga0496118_0000368 3300048921 Bacteria 75743
611 Ga0496118_0036702 3300048921 Bacteria 3957
612 Ga0496118_0172941 3300048921 Bacteria 1317
613 Ga0496121_0000144 3300048924 Bacteria 156856
614 Ga0496121_0008049 3300048924 Bacteria 12567
615 Ga0496121_0039498 3300048924 Bacteria 4157
616 Ga0496121_0103201 3300048924 Bacteria 2194
617 Ga0496121_0164993 3300048924 Bacteria 1615
618 Ga0496124_0000503 3300048927 Bacteria 67137
619 Ga0496124_0017985 3300048927 Bacteria 6641
620 Ga0496125_0033849 3300048928 Bacteria 4514
621 Ga0496126_0007210 3300048929 Bacteria 12229
622 Ga0496126_0011446 3300048929 Bacteria 9181
623 Ga0496126_0052940 3300048929 Bacteria 3685
624 Ga0496126_0081361 3300048929 Bacteria 2863
625 Ga0496126_0089027 3300048929 Bacteria 2718
626 Ga0496126_0096645 3300048929 Bacteria 2589
627 Ga0496126_0160637 3300048929 Bacteria 1920
628 Ga0501034_0014364 3300049571 Bacteria 8160
629 Ga0501034_0060263 3300049571 Bacteria 3813
630 Ga0501036_0015333 3300049572 Bacteria 6400
631 Ga0501037_0069958 3300049573 Bacteria 2554
632 Ga0501038_0206797 3300049574 Bacteria 1573
633 Ga0501039_0018533 3300049575 Bacteria 5344
634 Ga0501043_0015124 3300049579 Bacteria 6038
635 Ga0501046_0139273 3300049580 Bacteria 1837
636 Ga0501046_0142497 3300049580 Bacteria 1813
637 Ga0501047_0002308 3300049581 Bacteria 18243
638 Ga0501047_0124194 3300049581 Bacteria 2461
639 Ga0501047_0155584 3300049581 Bacteria 2160
640 Ga0501047_0206255 3300049581 Bacteria 1825
641 Ga0501048_0020015 3300049582 Bacteria 4908
642 Ga0501070_0007020 3300049586 Bacteria 9579
643 Ga0501072_0005373 3300049588 Bacteria 9751
644 Ga0501073_0014523 3300049589 Bacteria 5722
645 Ga0501074_0044595 3300049590 Bacteria 3209
646 Ga0501077_0002418 3300049593 Bacteria 11209
647 Ga0501079_0153972 3300049741 Bacteria 1792
648 Ga0501080_0015144 3300049742 Bacteria 7104
649 Ga0501080_0026564 3300049742 Bacteria 5379
650 Ga0501080_0055757 3300049742 Bacteria 3681
651 Ga0501081_0058516 3300049743 Bacteria 2666
652 Ga0501081_0109797 3300049743 Bacteria 1957
653 Ga0501083_0145467 3300049744 Bacteria 1552
654 Ga0501035_0051019 3300049822 Bacteria 3705
655 Ga0501044_0003604 3300049823 Bacteria 17424
656 Ga0501044_0052930 3300049823 Bacteria 4178
657 Ga0501045_0158728 3300049824 Bacteria 1683
658 nmdc:mga03n38_107529_c1 3300050490 Bacteria 1354
659 nmdc:mga03n38_37395_c1 3300050490 Bacteria 2093
660 nmdc:mga00v17_101365_c1 3300050491 Bacteria 1818
661 nmdc:mga00v17_5856_c1 3300050491 Bacteria 6492
662 nmdc:mga0yw44_47602_c1 3300050492 Bacteria 2582
663 nmdc:mga0k408_12201_c1 3300050493 Bacteria 4695
664 nmdc:mga06z11_10424_c1 3300050494 Bacteria 3961
665 nmdc:mga09592_158107_c1 3300050508 Bacteria 1957
666 nmdc:mga08y16_159744_c1 3300050511 Bacteria 2341
667 nmdc:mga08y16_4325_c1 3300050511 Bacteria 14838
668 nmdc:mga0n895_119778_c1 3300050512 Bacteria 2653
669 nmdc:mga0n895_371258_c1 3300050512 Bacteria 1448
670 Ga0495601_0147511 3300053077 Bacteria 1535
671 Ga0495595_0000520 3300053084 Bacteria 14684
672 Ga0495619_0034484 3300053085 Bacteria 3290
673 Ga0500643_002833 3300053087 Bacteria 8658
674 Ga0500647_0048659 3300053091 Bacteria 2038
675 Ga0500647_0067272 3300053091 Bacteria 1723
676 Ga0500583_0085850 3300053092 Bacteria 1526
677 Ga0500651_0022361 3300053093 Bacteria 3949
678 Ga0500566_0000075 3300053094 Bacteria 48255
679 Ga0500566_0000699 3300053094 Bacteria 18900
680 Ga0500566_0005926 3300053094 Bacteria 7269
681 Ga0500641_0031731 3300053096 Bacteria 2085
682 Ga0500594_0005487 3300053118 Bacteria 2815
683 Ga0500595_000003 3300053119 Bacteria 419332
684 Ga0500595_002486 3300053119 Bacteria 9120
685 Ga0500595_003031 3300053119 Bacteria 7980
686 Ga0500595_013526 3300053119 Bacteria 3124
687 Ga0500595_015856 3300053119 Bacteria 2819
688 Ga0500614_000391 3300053123 Bacteria 11388
689 Ga0500652_068947 3300053131 Bacteria 1463
690 Ga0500559_0000245 3300053136 Bacteria 42738
691 Ga0500559_0004273 3300053136 Bacteria 6835
692 Ga0500559_0086454 3300053136 Bacteria 1431
693 Ga0500568_0003807 3300053139 Bacteria 8245
694 Ga0500588_0037202 3300053146 Bacteria 1444
695 Ga0500589_082772 3300053147 Bacteria 1429
696 Ga0500603_000124 3300053150 Bacteria 18201
697 Ga0500603_002939 3300053150 Bacteria 3691
698 Ga0500603_010756 3300053150 Bacteria 2072
699 Ga0500616_0000002 3300053153 Bacteria 1611257
700 Ga0500616_0015249 3300053153 Bacteria 4398
701 Ga0500630_000448 3300053159 Bacteria 17947
702 Ga0500638_028905 3300053162 Bacteria 2665
703 Ga0500638_049242 3300053162 Bacteria 2038
704 Ga0500638_104726 3300053162 Bacteria 1314
705 Ga0500639_000112 3300053163 Bacteria 38789
706 Ga0500636_0032504 3300053177 Bacteria 3088
707 Ga0500636_0073063 3300053177 Bacteria 1987
708 Ga0500637_0044081 3300053178 Bacteria 2526
709 Ga0500645_000078 3300053730 Bacteria 76931
710 Ga0500596_004367 3300053735 Bacteria 2595
711 Ga0500596_009127 3300053735 Bacteria 1556
712 Ga0500599_002740 3300053736 Bacteria 2127
713 Ga0500601_001621 3300053737 Bacteria 2434
714 Ga0501084_0193816 3300054114 Bacteria 1714
715 Ga0500661_001975 3300055283 Bacteria 3871
716 Ga0501082_0000510 3300060353 Bacteria 34491
717 Ga0501082_0005454 3300060353 Bacteria 11046
718 Ga0530510_0037742 3300061734 Bacteria 3486
719 2509148686 2508501128 Bacteria 8613869
720 2513660164 2513237096 Bacteria 8722461
721 2513693624 2513237101 Bacteria 7952346
722 2513862395 2513237137 Bacteria 9558895
723 2513888378 2513237141 Bacteria 8496279
724 2513919408 2513237145 Bacteria 8979722
725 2517105447 2517093001 Bacteria 9002274
726 2524535725 2524023228 Bacteria 10118060
727 2671123976 2667528175 Bacteria 7532676
728 2723847524 2721755755 Bacteria 8322773
729 2728752982 2728368998 Bacteria 8720350
730 2793071361 2791355197 Bacteria 8420563
731 2793081284
732 2834580324 2834578030 Bacteria 3530182
733 2844319547 2844315083 Bacteria 8138177
734 2874611487 2874604998 Bacteria 7834745
735 2876817046 2876808645 Bacteria 8824342
736 2879117569 2879110137 Bacteria 8907982
737 2885376749 2885374607 Bacteria 8927485
738 2885416996 2885409591 Bacteria 9235467
739 2889042288 2889033259 Bacteria 9099371
740 2903734484 2903727486 Bacteria 8281579
741 2903749596 2903748898 Bacteria 9972761
742 2906609279 2906602504 Bacteria 8295279
743 2906611121
744 2906636552 2906635258 Bacteria 8601019
745 2922362910 2922361189 Bacteria 7436256
746 2922390547 2922386360 Bacteria 7017218
747 2922428186
748 3005478171 3005474847 Bacteria 9259049
749 8006932354 8006926726 Bacteria 6749210
750 8006943043 8006933436 Bacteria 10410654
751 8006970152 8006964411 Bacteria 8966052
752 8006982837 8006973647 Bacteria 10679141
753 8006985433 8006984368 Bacteria 9651211
754 8006994510 8006994254 Bacteria 8309700
755 8019558888 8019555841 Bacteria 9642137
756 8019566419 8019565922 Bacteria 9639779
757 8056681246 8056673599 Bacteria 7871253
758 8056694446 8056689827 Bacteria 6712655
759 8056968523 8056967851 Bacteria 9038162
760 nmdc:mga0k408_111902_c1
761 JGI25406J46586_10000427
762 JGI25153J46596_10001468
763 rootH1_10011246
764 JGI25404J52841_10000743
765 Ga0065165_1001530
766 Ga0065715_10144331
767 Ga0070658_10145193
768 Ga0070658_10181543
769 Ga0070683_100001547
770 Ga0070683_100007227
771 Ga0070683_100025184
772 Ga0070683_100229193
773 Ga0070670_100253154
774 Ga0068869_100112053
775 Ga0070680_100004177
776 Ga0070680_100029327
777 Ga0070680_100092866
778 Ga0070682_100089667
779 Ga0068868_100048648
780 Ga0068868_100078090
781 Ga0070660_100004765
782 Ga0070660_100151256
783 Ga0070691_10020669
784 Ga0070687_100028973
785 Ga0070661_100033765
786 Ga0070668_100039747
787 Ga0070668_100058493
788 Ga0070668_100076610
789 Ga0070671_100019364
790 Ga0070671_100029173
791 Ga0070671_100118268
792 Ga0070674_100050645
793 Ga0070674_100284126
794 Ga0070673_100045712
795 Ga0070673_100145708
796 Ga0070659_100065860
797 Ga0070659_100126567
798 Ga0070709_10005541
799 Ga0070709_10187687
800 Ga0070714_100013074
801 Ga0070714_100193326
802 Ga0070713_100027095
803 Ga0070713_100073252
804 Ga0070710_10054823
805 Ga0070701_10142093
806 Ga0070711_100003525
807 Ga0070711_100008622
808 Ga0070708_100181949
809 Ga0070663_100000736
810 Ga0070663_100107000
811 Ga0070678_100073707
812 Ga0070678_100075387
813 Ga0070662_100029622
814 Ga0070662_100043001
815 Ga0070662_100072640
816 Ga0070681_10009108
817 Ga0070681_10046397
818 Ga0070681_10058095
819 Ga0070681_10084622
820 Ga0070685_10024687
821 Ga0070706_100122730
822 Ga0070707_100076183
823 Ga0070679_100003396
824 Ga0070679_100014293
825 Ga0070679_100032807
826 Ga0070684_100002360
827 Ga0070684_100010214
828 Ga0068853_100007764
829 Ga0068853_100016904
830 Ga0068853_100027851
831 Ga0068853_100071086
832 Ga0068853_100194118
833 Ga0070672_100236106
834 Ga0070693_100009703
835 Ga0070665_100025420
836 Ga0070665_100143011
837 Ga0068855_100019998
838 Ga0068855_100063031
839 Ga0068855_100070450
840 Ga0068855_100370998
841 Ga0070664_100025362
842 Ga0068857_100007288
843 Ga0068854_100083207
844 Ga0068856_100000183
845 Ga0068856_100042682
846 Ga0068856_100116406
847 Ga0068852_100008748
848 Ga0068852_100018677
849 Ga0068859_100055884
850 Ga0068864_100015786
851 Ga0068861_100011429
852 Ga0068861_100062787
853 Ga0068861_100202672
854 Ga0068851_10006248
855 Ga0068851_10036850
856 Ga0068863_100075269
857 Ga0068858_100042194
858 Ga0068858_100115231
859 Ga0068862_100116089
860 Ga0068862_100153030
861 Ga0068862_100408332
862 Ga0081455_10000968
863 Ga0081455_10006130
864 Ga0081455_10027486
865 Ga0081455_10043147
866 Ga0081455_10174483
867 Ga0081538_10008625
868 Ga0081538_10027677
869 Ga0081540_1001901
870 Ga0081540_1001903
871 Ga0081540_1008229
872 Ga0081540_1009156
873 Ga0081540_1027395
874 Ga0081540_1028634
875 Ga0081539_10000003
876 Ga0081539_10001264
877 Ga0081539_10009942
878 Ga0081539_10021323
879 Ga0081539_10022414
880 Ga0070717_10000620
881 Ga0070717_10003695
882 Ga0070717_10021656
883 Ga0070717_10064138
884 Ga0075365_10056818
885 Ga0075365_10070940
886 Ga0075365_10180878
887 Ga0075368_10000568
888 Ga0075363_100057360
889 Ga0075364_10026158
890 Ga0070716_100020164
891 Ga0070712_100221595
892 Ga0070712_100258062
893 Ga0075362_10006285
894 Ga0075367_10040317
895 Ga0075367_10064551
896 Ga0075367_10119282
897 Ga0075369_10006424
898 Ga0075366_10010155
899 Ga0075366_10128813
900 Ga0075370_10020093
901 Ga0075370_10049433
902 Ga0068871_100018780
903 Ga0068871_100124261
904 Ga0068871_100220867
905 Ga0068871_100231003
906 Ga0075428_100002217
907 Ga0075428_100199239
908 Ga0075428_100564828
909 Ga0075434_100033237
910 Ga0075429_100045445
911 Ga0097620_100055884
912 Ga0099824_1013434
913 Ga0099822_1002066
914 Ga0099794_10002279
915 Ga0099795_10006177
916 Ga0099795_10018213
917 Ga0105240_10007889
918 Ga0105240_10030954
919 Ga0105240_10057601
920 Ga0105240_10073130
921 Ga0111539_10001244
922 Ga0105245_10006466
923 Ga0105245_10021026
924 Ga0105245_10056619
925 Ga0105245_10110736
926 Ga0105245_10146381
927 Ga0105247_10018512
928 Ga0105243_10308856
929 Ga0105241_10001928
930 Ga0105241_10021404
931 Ga0105241_10122551
932 Ga0105242_10157759
933 Ga0105242_10210905
934 Ga0105248_10010552
935 Ga0105248_10123329
936 Ga0105248_10284802
937 Ga0105237_10002303
938 Ga0105237_10012648
939 Ga0105237_10123552
940 Ga0105237_10186159
941 Ga0105237_10340699
942 Ga0105238_10000813
943 Ga0105238_10002953
944 Ga0105238_10026202
945 Ga0105238_10058304
946 Ga0105238_10146792
947 Ga0105238_10246860
948 Ga0105238_10278384
949 Ga0105238_10320641
950 Ga0105238_10331622
951 Ga0099796_10006594
952 Ga0099796_10032444
953 Ga0105239_10010234
954 Ga0105239_10013645
955 Ga0105239_10016969
956 Ga0105239_10019242
957 Ga0105239_10069197
958 Ga0105239_10237538
959 Ga0105246_10022719
960 Ga0105246_10114055
961 Ga0157370_10059395
962 Ga0157370_10250655
963 Ga0157369_10002453
964 Ga0157369_10003244
965 Ga0157369_10011859
966 Ga0157374_10008339
967 Ga0157374_10017285
968 Ga0157374_10029281
969 Ga0157374_10075141
970 Ga0157378_10004403
971 Ga0163162_10007321
972 Ga0163162_10095815
973 Ga0163162_10166013
974 Ga0157372_10029296
975 Ga0157372_10172243
976 Ga0157375_10073245
977 Ga0157375_10128688
978 Ga0163163_10031547
979 Ga0157377_10023715
980 Ga0157379_10215914
981 Ga0157376_10002079
982 Ga0163161_10119501
983 Ga0163161_10281694
984 Ga0213873_10019393
985 Ga0213876_10005651
986 Ga0213876_10107138
987 Ga0213875_10025026
988 Ga0213871_10008889
989 Ga0209677_102191
990 Ga0209148_1000474
991 Ga0209233_1008616
992 Ga0209455_1002818
993 Ga0209455_1004350
994 Ga0209758_1001548
995 Ga0209758_1001765
996 Ga0209758_1011005
997 Ga0209758_1021808
998 Ga0207426_1002873
999 Ga0207656_10048626
1000 Ga0207682_10015987
1001 Ga0207692_10001623
1002 Ga0207692_10021567
1003 Ga0207642_10014396
1004 Ga0207710_10051580
1005 Ga0207688_10044215
1006 Ga0207680_10132232
1007 Ga0207685_10005573
1008 Ga0207699_10015322
1009 Ga0207699_10093795
1010 Ga0207699_10189401
1011 Ga0207645_10151570
1012 Ga0207705_10154400
1013 Ga0207705_10169442
1014 Ga0207705_10214311
1015 Ga0207684_10126842
1016 Ga0207654_10009050
1017 Ga0207707_10000980
1018 Ga0207707_10026490
1019 Ga0207707_10037766
1020 Ga0207707_10038469
1021 Ga0207707_10078526
1022 Ga0207707_10215303
1023 Ga0207695_10021018
1024 Ga0207695_10064206
1025 Ga0207695_10129357
1026 Ga0207671_10009312
1027 Ga0207671_10013822
1028 Ga0207671_10021988
1029 Ga0207671_10069958
1030 Ga0207671_10233380
1031 Ga0207693_10034827
1032 Ga0207693_10049542
1033 Ga0207663_10012650
1034 Ga0207663_10028886
1035 Ga0207663_10095432
1036 Ga0207660_10001768
1037 Ga0207660_10156058
1038 Ga0207662_10047034
1039 Ga0207662_10053271
1040 Ga0207657_10001056
1041 Ga0207652_10002280
1042 Ga0207652_10033130
1043 Ga0207652_10065044
1044 Ga0207646_10178565
1045 Ga0207694_10012836
1046 Ga0207694_10015467
1047 Ga0207694_10015474
1048 Ga0207694_10021451
1049 Ga0207694_10024414
1050 Ga0207694_10130653
1051 Ga0207659_10254608
1052 Ga0207687_10006448
1053 Ga0207687_10123287
1054 Ga0207700_10022695
1055 Ga0207700_10049586
1056 Ga0207700_10207392
1057 Ga0207664_10054592
1058 Ga0207644_10014914
1059 Ga0207644_10077364
1060 Ga0207690_10289196
1061 Ga0207706_10012032
1062 Ga0207706_10037923
1063 Ga0207686_10180445
1064 Ga0207709_10036338
1065 Ga0207709_10038706
1066 Ga0207709_10106369
1067 Ga0207670_10080719
1068 Ga0207670_10088002
1069 Ga0207670_10199916
1070 Ga0207669_10009224
1071 Ga0207669_10129670
1072 Ga0207665_10017990
1073 Ga0207665_10033418
1074 Ga0207665_10068810
1075 Ga0207691_10098671
1076 Ga0207711_10018668
1077 Ga0207711_10115615
1078 Ga0207689_10038905
1079 Ga0207661_10000978
1080 Ga0207661_10004599
1081 Ga0207661_10104511
1082 Ga0207667_10017021
1083 Ga0207667_10021904
1084 Ga0207667_10071137
1085 Ga0207667_10186153
1086 Ga0207667_10298888
1087 Ga0207651_10063868
1088 Ga0207640_10075807
1089 Ga0207640_10098130
1090 Ga0207677_10026223
1091 Ga0207677_10090680
1092 Ga0207677_10209149
1093 Ga0207703_10030499
1094 Ga0207703_10040078
1095 Ga0207639_10057754
1096 Ga0207639_10155818
1097 Ga0207639_10164289
1098 Ga0207678_10025052
1099 Ga0207678_10049544
1100 Ga0207678_10069217
1101 Ga0207678_10122266
1102 Ga0207702_10000931
1103 Ga0207702_10019880
1104 Ga0207702_10180758
1105 Ga0207641_10033308
1106 Ga0207641_10107502
1107 Ga0207648_10024498
1108 Ga0207648_10120474
1109 Ga0207674_10109712
1110 Ga0207675_100017977
1111 Ga0207683_10030688
1112 Ga0207683_10059906
1113 Ga0207683_10215239
1114 Ga0207683_10405756
1115 Ga0207698_10065235
1116 Ga0207698_10084629
1117 Ga0207698_10230811
1118 Ga0209589_1000004
1119 Ga0209489_100004
1120 Ga0209700_100004
1121 Ga0209179_1006316
1122 Ga0209179_1010413
1123 Ga0209968_1012748
1124 Ga0209588_1012945
1125 Ga0209813_10004076
1126 Ga0207428_10144870
1127 Ga0268266_10014979
1128 Ga0268266_10035979
1129 Ga0268266_10081876
1130 Ga0268266_10128937
1131 Ga0268265_10135733
1132 Ga0268264_10000073
1133 Ga0265318_10010442
1134 Ga0307517_10000756
1135 Ga0307515_10016019
1136 Ga0307511_10064493
1137 Ga0265330_10008288
1138 Ga0265330_10033498
1139 Ga0265328_10005665
1140 Ga0265320_10017383
1141 Ga0265325_10022559
1142 Ga0265340_10023117
1143 Ga0265340_10032140
1144 Ga0265340_10039366
1145 Ga0265331_10001606
1146 Ga0265331_10010603
1147 Ga0265316_10097225
1148 Ga0265316_10158652
1149 Ga0265316_10212618
1150 Ga0307513_10030795
1151 Ga0307509_10170678
1152 Ga0265313_10030548
1153 Ga0307508_10000025
1154 Ga0307508_10053562
1155 Ga0265314_10000895
1156 Ga0265314_10001458
1157 Ga0265314_10014289
1158 Ga0265314_10110193
1159 Ga0265342_10028079
1160 Ga0265342_10082351
1161 Ga0307516_10004702
1162 Ga0307516_10012948
1163 Ga0307406_10053043
1164 Ga0307416_100330771
1165 Ga0307507_10023208
1166 Ga0307510_10042569
1167 Ga0315911_1000014
1168 Ga0316215_1001396
1169 Ga0373926_0030460
1170 Ga0373923_0008211
1171 Ga0373923_0032949
1172 Ga0373923_0064237
1173 Ga0373945_0044619
1174 Ga0373954_0017812
1175 Ga0373954_0038713
1176 Ga0373954_0045823
1177 Ga0373943_0012642
1178 Ga0373943_0021171
1179 Ga0373943_0093375
1180 Ga0373946_0011389
1181 Ga0373946_0051175
1182 Ga0373946_0096291
1183 Ga0373924_0000771
1184 Ga0373924_0005907
1185 Ga0373935_0009037
1186 Ga0373935_0037992
1187 Ga0373927_0060396
1188 Ga0373933_0000052
1189 Ga0373933_0071185
1190 Ga0373947_0010219
1191 Ga0373947_0016342
1192 Ga0373947_0021732
1193 Ga0373947_0029897
1194 Ga0373937_0034113
1195 Ga0373937_0097601
1196 Ga0373925_0011826
1197 Ga0373925_0028774
1198 Ga0373925_0078961
1199 Ga0373925_0197097
1200 Ga0395900_0001158
1201 Ga0395900_0015185
1202 Ga0395900_0439525
1203 Ga0395898_0005716
1204 Ga0395898_0081582
1205 Ga0395905_0023969
1206 Ga0436364_0048275
1207 Ga0436364_0937856
1208 Ga0395901_0005474
1209 Ga0400483_017169
1210 Ga0436365_0956137
1211 Ga0436365_1324557
1212 Ga0436360_0023881
1213 Ga0436360_1175566
1214 Ga0436362_0103639
1215 Ga0439453_0001175
1216 Ga0439453_0003715
1217 Ga0439465_0043109
1218 Ga0466969_0099216
1219 Ga0466966_0094141
1220 Ga0466963_0004084
1221 Ga0466970_0064020
1222 Ga0466957_0026868
1223 Ga0466957_0166155
1224 Ga0466959_0007200
1225 Ga0466967_0014366
1226 Ga0466967_0054589
1227 Ga0466967_0252422
1228 Ga0495617_019542
1229 Ga0495592_0011943
1230 Ga0495592_0015839
1231 Ga0495603_0015901
1232 Ga0495603_0018380
1233 Ga0495603_0023108
1234 Ga0495603_0032472
1235 Ga0495629_0009351
1236 Ga0495629_0012019
1237 Ga0495629_0082205
1238 Ga0495641_0009000
1239 Ga0495651_0023234
1240 Ga0495651_0082483
1241 Ga0495653_0057124
1242 Ga0495653_0078018
1243 Ga0495650_0062956
1244 Ga0495580_0040719
1245 Ga0495582_0003004
1246 Ga0495582_0008385
1247 Ga0495605_0090647
1248 Ga0495639_0004634
1249 Ga0495639_0043441
1250 Ga0495662_0007517
1251 Ga0495664_0002577
1252 Ga0495584_0031570
1253 Ga0495585_0145750
1254 Ga0495606_0082627
1255 Ga0495608_0050947
1256 Ga0495618_0105816
1257 Ga0495628_0012582
1258 Ga0495628_0023124
1259 Ga0495628_0071401
1260 Ga0495630_0027243
1261 Ga0495630_0060592
1262 Ga0495631_0013200
1263 Ga0495632_0118032
1264 Ga0495643_0056053
1265 Ga0495644_0013365
1266 Ga0495648_0015937
1267 Ga0495663_0024903
1268 Ga0495666_0009204
1269 Ga0495652_0011406
1270 Ga0495652_0031142
1271 Ga0495652_0083201
1272 Ga0495652_0122414
1273 Ga0495665_0002362
1274 Ga0495665_0041711
1275 Ga0495640_0012751
1276 Ga0495640_0013691
1277 Ga0495587_0013010
1278 Ga0495597_0079643
1279 Ga0495622_0008474
1280 Ga0495622_0029181
1281 Ga0495633_0083672
1282 Ga0495667_0017709
1283 Ga0495667_0024177
1284 Ga0495667_0032132
1285 Ga0495667_0043144
1286 Ga0495656_0004457
1287 Ga0495656_0007675
1288 Ga0495668_0072328
1289 Ga0495634_0006174
1290 Ga0495634_0040442
1291 Ga0495611_0031354
1292 Ga0495625_0028888
1293 Ga0495635_0001193
1294 Ga0495635_0003853
1295 Ga0495635_0084812
1296 Ga0495659_0006925
1297 Ga0495588_0004114
1298 Ga0495657_0004871
1299 Ga0495599_0027780
1300 Ga0495599_0091811
1301 Ga0495599_0107811
1302 Ga0495623_0017659
1303 Ga0495646_0094254
1304 Ga0495647_0004568
1305 Ga0495658_0007213
1306 Ga0495658_0111900
1307 Ga0495669_0013271
1308 Ga0495613_0109850
1309 Ga0495613_0122225
1310 Ga0495624_0012698
1311 Ga0495624_0064600
1312 Ga0495670_0018618
1313 Ga0495670_0038344
1314 Ga0495649_0089214
1315 Ga0495600_0006484
1316 Ga0495581_0009207
1317 Ga0495604_0004723
1318 Ga0495604_0068237
1319 Ga0495604_0087799
1320 Ga0495674_0017125
1321 Ga0495674_0020468
1322 Ga0495674_0021918
1323 Ga0495674_0108812
1324 Ga0495672_0014325
1325 Ga0495680_0007559
1326 Ga0495680_0026290
1327 Ga0495675_0007310
1328 Ga0495675_0065263
1329 Ga0495677_0026121
1330 Ga0495684_0004769
1331 Ga0495684_0060120
1332 Ga0495686_0043037
1333 Ga0495593_0008293
1334 Ga0495593_0077281
1335 Ga0495602_0158945
1336 Ga0496100_0001966
1337 Ga0496102_0008961
1338 Ga0496104_0044151
1339 Ga0496104_0345205
1340 Ga0496105_0003693
1341 Ga0496105_0037607
1342 Ga0496106_0008772
1343 Ga0496106_0011690
1344 Ga0496106_0035274
1345 Ga0496107_0029976
1346 Ga0496107_0045850
1347 Ga0496108_0009248
1348 Ga0496108_0049240
1349 Ga0496108_0060114
1350 Ga0496109_0034672
1351 Ga0496110_0045040
1352 Ga0496110_0226537
1353 Ga0496111_0010797
1354 Ga0496111_0018005
1355 Ga0496112_0000243
1356 Ga0496112_0007463
1357 Ga0496112_0041094
1358 Ga0496112_0086520
1359 Ga0496113_0026739
1360 Ga0496113_0035597
1361 Ga0496113_0164517
1362 Ga0496113_0203086
1363 Ga0496114_0076917
1364 Ga0496114_0216064
1365 Ga0496115_0003657
1366 Ga0496115_0130420
1367 Ga0496116_0035780
1368 Ga0496117_0037427
1369 Ga0496118_0000368
1370 Ga0496118_0036702
1371 Ga0496118_0172941
1372 Ga0496121_0000144
1373 Ga0496121_0008049
1374 Ga0496121_0039498
1375 Ga0496121_0103201
1376 Ga0496121_0164993
1377 Ga0496124_0000503
1378 Ga0496124_0017985
1379 Ga0496125_0033849
1380 Ga0496126_0007210
1381 Ga0496126_0011446
1382 Ga0496126_0052940
1383 Ga0496126_0081361
1384 Ga0496126_0089027
1385 Ga0496126_0096645
1386 Ga0496126_0160637
1387 Ga0501034_0014364
1388 Ga0501034_0060263
1389 Ga0501036_0015333
1390 Ga0501037_0069958
1391 Ga0501038_0206797
1392 Ga0501039_0018533
1393 Ga0501043_0015124
1394 Ga0501046_0139273
1395 Ga0501046_0142497
1396 Ga0501047_0002308
1397 Ga0501047_0124194
1398 Ga0501047_0155584
1399 Ga0501047_0206255
1400 Ga0501048_0020015
1401 Ga0501070_0007020
1402 Ga0501072_0005373
1403 Ga0501073_0014523
1404 Ga0501074_0044595
1405 Ga0501077_0002418
1406 Ga0501079_0153972
1407 Ga0501080_0015144
1408 Ga0501080_0026564
1409 Ga0501080_0055757
1410 Ga0501081_0058516
1411 Ga0501081_0109797
1412 Ga0501083_0145467
1413 Ga0501035_0051019
1414 Ga0501044_0003604
1415 Ga0501044_0052930
1416 Ga0501045_0158728
1417 nmdc:mga03n38_107529_c1
1418 nmdc:mga03n38_37395_c1
1419 nmdc:mga00v17_101365_c1
1420 nmdc:mga00v17_5856_c1
1421 nmdc:mga0yw44_47602_c1
1422 nmdc:mga0k408_12201_c1
1423 nmdc:mga06z11_10424_c1
1424 nmdc:mga09592_158107_c1
1425 nmdc:mga08y16_159744_c1
1426 nmdc:mga08y16_4325_c1
1427 nmdc:mga0n895_119778_c1
1428 nmdc:mga0n895_371258_c1
1429 Ga0495601_0147511
1430 Ga0495595_0000520
1431 Ga0495619_0034484
1432 Ga0500643_002833
1433 Ga0500647_0048659
1434 Ga0500647_0067272
1435 Ga0500583_0085850
1436 Ga0500651_0022361
1437 Ga0500566_0000075
1438 Ga0500566_0000699
1439 Ga0500566_0005926
1440 Ga0500641_0031731
1441 Ga0500594_0005487
1442 Ga0500595_000003
1443 Ga0500595_002486
1444 Ga0500595_003031
1445 Ga0500595_013526
1446 Ga0500595_015856
1447 Ga0500614_000391
1448 Ga0500652_068947
1449 Ga0500559_0000245
1450 Ga0500559_0004273
1451 Ga0500559_0086454
1452 Ga0500568_0003807
1453 Ga0500588_0037202
1454 Ga0500589_082772
1455 Ga0500603_000124
1456 Ga0500603_002939
1457 Ga0500603_010756
1458 Ga0500616_0000002
1459 Ga0500616_0015249
1460 Ga0500630_000448
1461 Ga0500638_028905
1462 Ga0500638_049242
1463 Ga0500638_104726
1464 Ga0500639_000112
1465 Ga0500636_0032504
1466 Ga0500636_0073063
1467 Ga0500637_0044081
1468 Ga0500645_000078
1469 Ga0500596_004367
1470 Ga0500596_009127
1471 Ga0500599_002740
1472 Ga0500601_001621
1473 Ga0501084_0193816
1474 Ga0500661_001975
1475 Ga0501082_0000510
1476 Ga0501082_0005454
1477 Ga0530510_0037742
1478 2509148686
1479 2513660164
1480 2513693624
1481 2513862395
1482 2513888378
1483 2513919408
1484 2517105447
1485 2524535725
1486 2671123976
1487 2723847524
1488 2728752982
1489 2793071361
1490 2793081284
1491 2834580324
1492 2844319547
1493 2874611487
1494 2876817046
1495 2879117569
1496 2885376749
1497 2885416996
1498 2889042288
1499 2903734484
1500 2903749596
1501 2906609279
1502 2906611121
1503 2906636552
1504 2922362910
1505 2922390547
1506 2922428186
1507 3005478171
1508 8006932354
1509 8006943043
1510 8006970152
1511 8006982837
1512 8006985433
1513 8006994510
1514 8019558888
1515 8019566419
1516 8056681246
1517 8056694446
1518 8056968523

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

83

406

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5aec-assembly1.cif.gz_A type ii baeyer-villiger monooxygenase.the oxygenating constituent of 3,6-diketocamphane monooxygenase from cam plasmid of pseudomonas putida in complex with fmn. 0.8893 1 356
5aec-assembly1.cif.gz_B type ii baeyer-villiger monooxygenase.the oxygenating constituent of 3,6-diketocamphane monooxygenase from cam plasmid of pseudomonas putida in complex with fmn. 0.8881 1 356
4uwm-assembly1.cif.gz_A type ii baeyer-villiger monooxygenase.the oxygenating constituent of 3,6-diketocamphane monooxygenase from cam plasmid of pseudomonas putida in complex with fmn. 0.8866 1 356
4uwm-assembly1.cif.gz_B type ii baeyer-villiger monooxygenase.the oxygenating constituent of 3,6-diketocamphane monooxygenase from cam plasmid of pseudomonas putida in complex with fmn. 0.8858 1 356
7bip-assembly1.cif.gz_B crystal structure of monooxygenase rslo1 from streptomyces bottropensis 0.8797 1 355
ID Description Score Start End Superfamily
af_P95278_1_358_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9193 1 357 3.20.20.30
af_P95278_1_358_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9144 1 357 3.20.20.30
4uwmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8866 1 356 3.20.20.30
4uwmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8704 1 356 3.20.20.30
af_I6X7W8_4_352_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8426 1 357 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A345ZWQ3-F1-model_v4 Flavin-dependent oxidoreductase 0.9969 1 361 GO:0004497
GO:0005829
GO:0016705
AF-A0A345ZWQ3-F1-model_v4 Flavin-dependent oxidoreductase 0.9915 1 361 GO:0004497
GO:0005829
GO:0016705
AF-A0A3N5MLU4-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9878 1 208 GO:0004497
GO:0005829
GO:0016705
AF-A0A1J5PDR7-F1-model_v4 Luciferase-like domain-containing protein 0.9832 221 368 GO:0016705
AF-A0A3N5MLU4-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9831 1 208 GO:0004497
GO:0005829
GO:0016705

Map