F479581
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 761 | 372 | 757 | 421 |
Family's Representative Sequence
| Representative Sequence | 3300036401|Ga0373937_0132067|Ga0373937_0132067_918_2297 |
| Length | 452 |
| Sequence | MMTAQSLPRKKKLPWADERSALRWCGRHNDNNSFGEEPMTRGGILASSAAGALGLAADAHAQAKGKEAPLELKGDASVRPWKRYSGWPARDESKFNTLANLASPVAPKQPRKIGPITGDTANGAKLVADRNRGGSCLACHVMGQAGNADLPGNVGPDLSEIGNGGRTDEWLFNYIYDARVYNPDTVMPPWGSHGVFTDGEINDMVAFLKTLKKPAVFKTELDDPNKRPAPVEKRENLDAIENPGMWALDMAAELWKTRGSDGFSCNTCHSDPKAAFKTWAASMPKWEPRLNKVLGVEEFVTRHAKATTGLSWLMETDENRNMSVYLHNLANGEPIAVDTTSAEAKAAIERGKALASRKLGELNFACTDCHGNSANHWIRGQWLGEPKGQYDHFPTWRTSLLAIWDIRQRFQWCQVNIRADELPPDAKEYGDLELYLASLNDGQKLSVPGIRH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 3 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 4 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 5 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 6 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 12 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 13 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 14 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 15 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 16 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 17 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 18 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 19 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 20 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 21 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 24 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 75 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 77 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 85 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 91 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 92 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 93 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 95 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 96 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 97 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 100 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 101 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 102 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 104 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 105 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 106 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 107 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 108 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 109 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 110 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 112 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 216 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 219 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 220 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 221 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 222 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 225 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 226 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 228 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 229 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 230 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 231 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 232 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 233 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 234 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 235 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 236 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 237 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 239 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 241 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 243 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 244 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 246 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 247 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 248 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 249 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 251 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 254 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 255 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 256 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 257 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 258 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 259 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 260 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 263 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 264 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 320 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 321 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 322 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 323 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 324 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 325 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 328 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 329 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 330 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 331 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 332 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 333 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 347 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 348 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 357 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 362 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 363 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 364 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 365 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 366 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 367 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 368 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 369 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 370 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 371 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.34 |
| Metatranscriptomes | 0.13 |
| Isolates | 0.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.5 |
| Nodule | 0.39 |
| Rhizoplane | 5.52 |
| Rhizosphere | 91.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214745219 | 2209111006 | Bacteria | 14065 |
| 2 | ARcpr5oldR_c000117 | 3300000041 | Bacteria | 14388 |
| 3 | ARCol0yngRDRAFT_1000003 | 3300000652 | Bacteria | 53041 |
| 4 | JGI24739J22299_10002682 | 3300001989 | Bacteria | 6851 |
| 5 | JGI24737J22298_10000992 | 3300001990 | Bacteria | 10058 |
| 6 | JGI24737J22298_10003261 | 3300001990 | Bacteria | 5753 |
| 7 | JGI24750J21931_1000480 | 3300002070 | Bacteria | 6356 |
| 8 | JGI24745J21846_1002842 | 3300002073 | Bacteria | 1792 |
| 9 | JGI24748J21848_1000438 | 3300002074 | Bacteria | 4619 |
| 10 | JGI24738J21930_10001848 | 3300002075 | Bacteria | 5737 |
| 11 | JGI24749J21850_1000392 | 3300002076 | Bacteria | 6511 |
| 12 | JGI24744J21845_10004046 | 3300002077 | Bacteria | 3024 |
| 13 | JGI24035J26624_1000144 | 3300002126 | Bacteria | 6361 |
| 14 | JGI24034J26672_10000590 | 3300002239 | Bacteria | 4637 |
| 15 | JGI24742J22300_10000041 | 3300002244 | Bacteria | 18966 |
| 16 | JGI25404J52841_10000210 | 3300003659 | Bacteria | 7064 |
| 17 | JGI25404J52841_10001193 | 3300003659 | Unclassified | 4457 |
| 18 | JGI25404J52841_10005069 | 3300003659 | Unclassified | 2709 |
| 19 | JGI25405J52794_10001495 | 3300003911 | Bacteria | 3858 |
| 20 | Ga0065716_1001888 | 3300005277 | Bacteria | 2864 |
| 21 | Ga0065704_10080219 | 3300005289 | Bacteria | 3988 |
| 22 | Ga0065712_10000247 | 3300005290 | Bacteria | 16703 |
| 23 | Ga0065712_10113325 | 3300005290 | Bacteria | 1785 |
| 24 | Ga0065715_10003780 | 3300005293 | Bacteria | 5282 |
| 25 | Ga0065715_10089103 | 3300005293 | Bacteria | 14332 |
| 26 | Ga0065715_10145512 | 3300005293 | Bacteria | 1794 |
| 27 | Ga0070658_10028026 | 3300005327 | Bacteria | 4521 |
| 28 | Ga0070658_10059506 | 3300005327 | Bacteria | 3111 |
| 29 | Ga0070676_10000036 | 3300005328 | Bacteria | 40368 |
| 30 | Ga0070676_10066362 | 3300005328 | Bacteria | 2156 |
| 31 | Ga0070683_100000695 | 3300005329 | Bacteria | 24431 |
| 32 | Ga0070683_100000898 | 3300005329 | Bacteria | 22112 |
| 33 | Ga0070683_100026861 | 3300005329 | Bacteria | 5188 |
| 34 | Ga0070683_100161317 | 3300005329 | Bacteria | 2127 |
| 35 | Ga0070683_100320775 | 3300005329 | Bacteria | 1474 |
| 36 | Ga0070690_100000402 | 3300005330 | Bacteria | 21886 |
| 37 | Ga0070690_100023814 | 3300005330 | Bacteria | 3760 |
| 38 | Ga0070690_100035779 | 3300005330 | Bacteria | 3118 |
| 39 | Ga0070690_100144204 | 3300005330 | Bacteria | 1619 |
| 40 | Ga0070670_100000442 | 3300005331 | Bacteria | 33887 |
| 41 | Ga0070670_100016727 | 3300005331 | Bacteria | 6295 |
| 42 | Ga0070670_100072582 | 3300005331 | Bacteria | 2956 |
| 43 | Ga0070670_100085242 | 3300005331 | Bacteria | 2714 |
| 44 | Ga0070677_10000124 | 3300005333 | Bacteria | 25567 |
| 45 | Ga0068869_100000087 | 3300005334 | Bacteria | 42211 |
| 46 | Ga0070666_10044947 | 3300005335 | Bacteria | 2960 |
| 47 | Ga0070680_100066910 | 3300005336 | Bacteria | 2947 |
| 48 | Ga0070680_100073406 | 3300005336 | Bacteria | 2814 |
| 49 | Ga0070682_100000341 | 3300005337 | Bacteria | 32124 |
| 50 | Ga0070682_100022461 | 3300005337 | Bacteria | 3737 |
| 51 | Ga0070682_100132866 | 3300005337 | Bacteria | 1686 |
| 52 | Ga0068868_100000127 | 3300005338 | Bacteria | 48790 |
| 53 | Ga0068868_100007585 | 3300005338 | Bacteria | 7731 |
| 54 | Ga0068868_100023195 | 3300005338 | Bacteria | 4694 |
| 55 | Ga0070660_100076282 | 3300005339 | Bacteria | 2625 |
| 56 | Ga0070689_100002790 | 3300005340 | Bacteria | 11470 |
| 57 | Ga0070691_10004809 | 3300005341 | Bacteria | 6147 |
| 58 | Ga0070691_10008048 | 3300005341 | Bacteria | 4823 |
| 59 | Ga0070687_100005901 | 3300005343 | Bacteria | 4979 |
| 60 | Ga0070661_100000017 | 3300005344 | Bacteria | 153232 |
| 61 | Ga0070661_100000589 | 3300005344 | Bacteria | 27482 |
| 62 | Ga0070661_100063833 | 3300005344 | Bacteria | 2705 |
| 63 | Ga0070692_10000018 | 3300005345 | Bacteria | 33825 |
| 64 | Ga0070668_100001356 | 3300005347 | Bacteria | 17522 |
| 65 | Ga0070668_100111063 | 3300005347 | Bacteria | 2182 |
| 66 | Ga0070669_100000217 | 3300005353 | Bacteria | 47833 |
| 67 | Ga0070675_100000082 | 3300005354 | Bacteria | 56027 |
| 68 | Ga0070675_100000088 | 3300005354 | Bacteria | 53698 |
| 69 | Ga0070675_100060091 | 3300005354 | Bacteria | 3137 |
| 70 | Ga0070671_100000405 | 3300005355 | Bacteria | 29748 |
| 71 | Ga0070671_100011124 | 3300005355 | Bacteria | 7227 |
| 72 | Ga0070671_100020068 | 3300005355 | Bacteria | 5445 |
| 73 | Ga0070671_100075228 | 3300005355 | Bacteria | 2821 |
| 74 | Ga0070673_100000239 | 3300005364 | Bacteria | 27611 |
| 75 | Ga0070673_100002161 | 3300005364 | Bacteria | 11909 |
| 76 | Ga0070673_100031259 | 3300005364 | Bacteria | 3993 |
| 77 | Ga0070688_100000084 | 3300005365 | Bacteria | 47194 |
| 78 | Ga0070688_100003883 | 3300005365 | Bacteria | 7746 |
| 79 | Ga0070688_100016483 | 3300005365 | Bacteria | 4225 |
| 80 | Ga0070667_100003023 | 3300005367 | Bacteria | 14455 |
| 81 | Ga0070667_100094121 | 3300005367 | Bacteria | 2581 |
| 82 | Ga0070667_100096956 | 3300005367 | Bacteria | 2543 |
| 83 | Ga0070667_100108839 | 3300005367 | Bacteria | 2401 |
| 84 | Ga0070703_10016932 | 3300005406 | Bacteria | 2097 |
| 85 | Ga0070709_10000855 | 3300005434 | Bacteria | 17027 |
| 86 | Ga0070709_10004300 | 3300005434 | Bacteria | 7681 |
| 87 | Ga0070709_10124055 | 3300005434 | Bacteria | 1755 |
| 88 | Ga0070713_100002359 | 3300005436 | Bacteria | 12318 |
| 89 | Ga0070713_100004066 | 3300005436 | Bacteria | 9738 |
| 90 | Ga0070713_100031837 | 3300005436 | Bacteria | 4205 |
| 91 | Ga0070713_100149309 | 3300005436 | Bacteria | 2077 |
| 92 | Ga0070710_10003385 | 3300005437 | Bacteria | 7554 |
| 93 | Ga0070710_10021169 | 3300005437 | Bacteria | 3384 |
| 94 | Ga0070710_10029684 | 3300005437 | Bacteria | 2935 |
| 95 | Ga0070710_10087694 | 3300005437 | Bacteria | 1829 |
| 96 | Ga0070701_10019817 | 3300005438 | Bacteria | 3182 |
| 97 | Ga0070711_100077069 | 3300005439 | Bacteria | 2365 |
| 98 | Ga0070711_100101812 | 3300005439 | Bacteria | 2091 |
| 99 | Ga0070711_100137381 | 3300005439 | Bacteria | 1829 |
| 100 | Ga0070705_100000425 | 3300005440 | Bacteria | 24231 |
| 101 | Ga0070705_100076457 | 3300005440 | Bacteria | 2042 |
| 102 | Ga0070700_100000430 | 3300005441 | Bacteria | 21259 |
| 103 | Ga0070700_100034968 | 3300005441 | Bacteria | 3037 |
| 104 | Ga0070694_100000401 | 3300005444 | Bacteria | 23534 |
| 105 | Ga0070694_100010745 | 3300005444 | Bacteria | 5661 |
| 106 | Ga0070694_100216330 | 3300005444 | Bacteria | 1435 |
| 107 | Ga0070708_100026428 | 3300005445 | Bacteria | 4969 |
| 108 | Ga0070663_100032570 | 3300005455 | Bacteria | 3594 |
| 109 | Ga0070678_100000014 | 3300005456 | Bacteria | 55438 |
| 110 | Ga0070678_100000053 | 3300005456 | Bacteria | 40418 |
| 111 | Ga0070678_100022259 | 3300005456 | Bacteria | 4195 |
| 112 | Ga0070678_100030073 | 3300005456 | Bacteria | 3728 |
| 113 | Ga0070681_10000493 | 3300005458 | Bacteria | 32198 |
| 114 | Ga0070681_10009120 | 3300005458 | Bacteria | 9749 |
| 115 | Ga0070681_10013271 | 3300005458 | Bacteria | 8185 |
| 116 | Ga0070681_10090702 | 3300005458 | Bacteria | 3006 |
| 117 | Ga0070681_10091827 | 3300005458 | Bacteria | 2986 |
| 118 | Ga0068867_100002202 | 3300005459 | Bacteria | 13675 |
| 119 | Ga0068867_100015926 | 3300005459 | Bacteria | 5337 |
| 120 | Ga0070685_10001195 | 3300005466 | Bacteria | 13859 |
| 121 | Ga0070707_100013936 | 3300005468 | Bacteria | 7530 |
| 122 | Ga0070679_100000679 | 3300005530 | Bacteria | 29087 |
| 123 | Ga0070679_100042532 | 3300005530 | Bacteria | 4525 |
| 124 | Ga0070679_100122492 | 3300005530 | Bacteria | 2584 |
| 125 | Ga0070679_100143328 | 3300005530 | Bacteria | 2368 |
| 126 | Ga0070684_100000144 | 3300005535 | Bacteria | 47665 |
| 127 | Ga0070684_100007137 | 3300005535 | Bacteria | 8679 |
| 128 | Ga0070684_100174444 | 3300005535 | Bacteria | 1953 |
| 129 | Ga0070672_100000014 | 3300005543 | Bacteria | 72627 |
| 130 | Ga0070672_100000029 | 3300005543 | Bacteria | 63114 |
| 131 | Ga0070686_100002767 | 3300005544 | Bacteria | 9659 |
| 132 | Ga0070695_100000743 | 3300005545 | Bacteria | 17429 |
| 133 | Ga0070695_100003239 | 3300005545 | Bacteria | 9500 |
| 134 | Ga0070695_100007870 | 3300005545 | Bacteria | 6313 |
| 135 | Ga0070695_100065695 | 3300005545 | Bacteria | 2363 |
| 136 | Ga0070696_100000918 | 3300005546 | Bacteria | 19157 |
| 137 | Ga0070693_100000141 | 3300005547 | Bacteria | 32426 |
| 138 | Ga0070693_100058059 | 3300005547 | Bacteria | 2239 |
| 139 | Ga0070693_100140072 | 3300005547 | Bacteria | 1521 |
| 140 | Ga0070665_100069877 | 3300005548 | Bacteria | 3519 |
| 141 | Ga0070665_100070658 | 3300005548 | Unclassified | 3498 |
| 142 | Ga0070665_100116586 | 3300005548 | Unclassified | 2673 |
| 143 | Ga0070704_100008824 | 3300005549 | Bacteria | 6068 |
| 144 | Ga0070704_100014935 | 3300005549 | Bacteria | 4861 |
| 145 | Ga0068855_100201967 | 3300005563 | Bacteria | 2237 |
| 146 | Ga0070664_100000124 | 3300005564 | Bacteria | 51361 |
| 147 | Ga0070664_100038514 | 3300005564 | Bacteria | 4024 |
| 148 | Ga0070664_100040344 | 3300005564 | Bacteria | 3935 |
| 149 | Ga0068857_100001474 | 3300005577 | Bacteria | 18724 |
| 150 | Ga0068854_100000168 | 3300005578 | Bacteria | 44522 |
| 151 | Ga0068856_100000932 | 3300005614 | Bacteria | 31354 |
| 152 | Ga0070702_100008129 | 3300005615 | Bacteria | 5070 |
| 153 | Ga0070702_100019143 | 3300005615 | Bacteria | 3563 |
| 154 | Ga0068852_100000016 | 3300005616 | Bacteria | 132773 |
| 155 | Ga0068859_100071001 | 3300005617 | Bacteria | 3517 |
| 156 | Ga0068859_100093040 | 3300005617 | Bacteria | 3066 |
| 157 | Ga0068864_100000823 | 3300005618 | Bacteria | 26121 |
| 158 | Ga0068864_100062981 | 3300005618 | Bacteria | 3214 |
| 159 | Ga0068864_100088136 | 3300005618 | Bacteria | 2733 |
| 160 | Ga0068861_100000315 | 3300005719 | Bacteria | 27094 |
| 161 | Ga0068851_10001223 | 3300005834 | Bacteria | 11165 |
| 162 | Ga0068870_10000002 | 3300005840 | Bacteria | 91107 |
| 163 | Ga0068863_100013344 | 3300005841 | Bacteria | 7922 |
| 164 | Ga0068863_100067439 | 3300005841 | Bacteria | 3384 |
| 165 | Ga0068858_100000356 | 3300005842 | Bacteria | 48189 |
| 166 | Ga0068858_100059299 | 3300005842 | Bacteria | 3537 |
| 167 | Ga0068860_100000747 | 3300005843 | Bacteria | 36976 |
| 168 | Ga0068860_100315126 | 3300005843 | Bacteria | 1534 |
| 169 | Ga0068862_100000671 | 3300005844 | Bacteria | 35004 |
| 170 | Ga0068862_100067930 | 3300005844 | Bacteria | 3074 |
| 171 | Ga0081455_10000048 | 3300005937 | Bacteria | 126551 |
| 172 | Ga0081455_10010063 | 3300005937 | Bacteria | 9654 |
| 173 | Ga0081455_10014701 | 3300005937 | Bacteria | 7645 |
| 174 | Ga0081540_1000293 | 3300005983 | Bacteria | 52532 |
| 175 | Ga0081540_1000397 | 3300005983 | Bacteria | 43084 |
| 176 | Ga0081540_1000518 | 3300005983 | Bacteria | 37819 |
| 177 | Ga0081540_1004355 | 3300005983 | Bacteria | 10828 |
| 178 | Ga0081540_1005808 | 3300005983 | Bacteria | 9133 |
| 179 | Ga0081540_1009059 | 3300005983 | Bacteria | 6878 |
| 180 | Ga0081540_1009145 | 3300005983 | Bacteria | 6837 |
| 181 | Ga0081540_1029140 | 3300005983 | Bacteria | 3082 |
| 182 | Ga0081540_1041402 | 3300005983 | Bacteria | 2389 |
| 183 | Ga0081539_10002257 | 3300005985 | Bacteria | 28023 |
| 184 | Ga0081539_10015916 | 3300005985 | Bacteria | 5420 |
| 185 | Ga0070717_10003328 | 3300006028 | Bacteria | 11477 |
| 186 | Ga0075368_10033949 | 3300006042 | Bacteria | 1986 |
| 187 | Ga0075363_100018321 | 3300006048 | Bacteria | 3487 |
| 188 | Ga0075432_10031917 | 3300006058 | Bacteria | 1824 |
| 189 | Ga0070716_100002233 | 3300006173 | Bacteria | 8923 |
| 190 | Ga0070716_100031117 | 3300006173 | Bacteria | 2900 |
| 191 | Ga0070712_100046610 | 3300006175 | Bacteria | 2997 |
| 192 | Ga0075362_10020225 | 3300006177 | Bacteria | 2779 |
| 193 | Ga0075367_10102230 | 3300006178 | Bacteria | 1753 |
| 194 | Ga0075369_10012498 | 3300006186 | Bacteria | 3356 |
| 195 | Ga0097621_100000144 | 3300006237 | Bacteria | 43169 |
| 196 | Ga0097621_100000482 | 3300006237 | Bacteria | 27827 |
| 197 | Ga0097621_100008876 | 3300006237 | Bacteria | 7268 |
| 198 | Ga0097621_100026444 | 3300006237 | Bacteria | 4552 |
| 199 | Ga0068871_100000050 | 3300006358 | Bacteria | 64862 |
| 200 | Ga0068871_100000110 | 3300006358 | Bacteria | 49756 |
| 201 | Ga0068871_100015537 | 3300006358 | Bacteria | 5702 |
| 202 | Ga0068871_100108543 | 3300006358 | Bacteria | 2333 |
| 203 | Ga0075430_100000627 | 3300006846 | Bacteria | 26908 |
| 204 | Ga0075433_10000615 | 3300006852 | Bacteria | 23766 |
| 205 | Ga0075433_10179981 | 3300006852 | Bacteria | 1881 |
| 206 | Ga0075434_100000084 | 3300006871 | Bacteria | 50928 |
| 207 | Ga0075434_100134451 | 3300006871 | Bacteria | 2492 |
| 208 | Ga0075429_100000877 | 3300006880 | Bacteria | 23746 |
| 209 | Ga0068865_100000066 | 3300006881 | Bacteria | 54564 |
| 210 | Ga0068865_100009015 | 3300006881 | Bacteria | 6171 |
| 211 | Ga0075436_100007051 | 3300006914 | Bacteria | 7695 |
| 212 | Ga0075436_100031219 | 3300006914 | Bacteria | 3668 |
| 213 | Ga0097620_100071001 | 3300006931 | Bacteria | 3517 |
| 214 | Ga0097620_100093043 | 3300006931 | Bacteria | 3066 |
| 215 | Ga0075435_100001540 | 3300007076 | Bacteria | 14850 |
| 216 | Ga0075435_100180757 | 3300007076 | Bacteria | 1782 |
| 217 | Ga0105251_10012262 | 3300009011 | Bacteria | 4857 |
| 218 | Ga0111539_10000423 | 3300009094 | Bacteria | 53050 |
| 219 | Ga0111539_10000652 | 3300009094 | Bacteria | 44828 |
| 220 | Ga0111539_10001255 | 3300009094 | Bacteria | 33804 |
| 221 | Ga0105245_10000287 | 3300009098 | Bacteria | 48204 |
| 222 | Ga0105245_10002287 | 3300009098 | Bacteria | 17339 |
| 223 | Ga0105245_10038270 | 3300009098 | Bacteria | 4268 |
| 224 | Ga0105245_10213849 | 3300009098 | Unclassified | 1857 |
| 225 | Ga0105247_10001223 | 3300009101 | Bacteria | 19057 |
| 226 | Ga0105247_10007491 | 3300009101 | Bacteria | 6691 |
| 227 | Ga0105247_10086615 | 3300009101 | Bacteria | 1982 |
| 228 | Ga0105243_10000695 | 3300009148 | Bacteria | 32613 |
| 229 | Ga0105243_10013699 | 3300009148 | Bacteria | 6135 |
| 230 | Ga0105241_10002331 | 3300009174 | Bacteria | 14262 |
| 231 | Ga0105241_10037102 | 3300009174 | Bacteria | 3671 |
| 232 | Ga0105242_10000792 | 3300009176 | Bacteria | 24525 |
| 233 | Ga0105242_10006274 | 3300009176 | Bacteria | 9156 |
| 234 | Ga0105242_10026443 | 3300009176 | Bacteria | 4600 |
| 235 | Ga0105242_10059085 | 3300009176 | Bacteria | 3145 |
| 236 | Ga0105242_10127768 | 3300009176 | Bacteria | 2190 |
| 237 | Ga0105248_10000535 | 3300009177 | Bacteria | 43210 |
| 238 | Ga0105248_10009137 | 3300009177 | Bacteria | 10900 |
| 239 | Ga0105248_10031579 | 3300009177 | Bacteria | 5918 |
| 240 | Ga0105248_10065160 | 3300009177 | Bacteria | 4090 |
| 241 | Ga0105248_10065290 | 3300009177 | Bacteria | 4086 |
| 242 | Ga0105248_10094971 | 3300009177 | Unclassified | 3357 |
| 243 | Ga0105237_10002795 | 3300009545 | Bacteria | 21203 |
| 244 | Ga0105238_10157027 | 3300009551 | Bacteria | 2250 |
| 245 | Ga0105249_10000279 | 3300009553 | Bacteria | 53594 |
| 246 | Ga0105249_10003839 | 3300009553 | Bacteria | 12962 |
| 247 | Ga0105249_10361945 | 3300009553 | Bacteria | 1472 |
| 248 | Ga0105239_10001686 | 3300010375 | Bacteria | 29130 |
| 249 | Ga0105239_10044533 | 3300010375 | Bacteria | 4864 |
| 250 | Ga0105239_10074149 | 3300010375 | Bacteria | 3742 |
| 251 | Ga0105239_10288996 | 3300010375 | Bacteria | 1846 |
| 252 | Ga0105246_10000095 | 3300011119 | Bacteria | 38417 |
| 253 | Ga0157373_10232834 | 3300013100 | Bacteria | 1301 |
| 254 | Ga0157371_10011031 | 3300013102 | Bacteria | 7000 |
| 255 | Ga0157370_10033080 | 3300013104 | Bacteria | 5042 |
| 256 | Ga0157369_10209362 | 3300013105 | Unclassified | 2044 |
| 257 | Ga0157374_10000321 | 3300013296 | Bacteria | 44720 |
| 258 | Ga0157374_10001348 | 3300013296 | Bacteria | 20895 |
| 259 | Ga0157374_10326059 | 3300013296 | Bacteria | 1522 |
| 260 | Ga0157378_10000956 | 3300013297 | Bacteria | 26502 |
| 261 | Ga0157378_10005246 | 3300013297 | Bacteria | 11380 |
| 262 | Ga0157378_10052863 | 3300013297 | Bacteria | 3615 |
| 263 | Ga0157378_10094941 | 3300013297 | Bacteria | 2716 |
| 264 | Ga0163162_10002192 | 3300013306 | Bacteria | 18324 |
| 265 | Ga0163162_10003795 | 3300013306 | Bacteria | 14493 |
| 266 | Ga0157372_10009222 | 3300013307 | Bacteria | 10491 |
| 267 | Ga0157372_10134988 | 3300013307 | Bacteria | 2841 |
| 268 | Ga0157375_10000135 | 3300013308 | Bacteria | 73281 |
| 269 | Ga0157375_10000627 | 3300013308 | Bacteria | 31374 |
| 270 | Ga0157375_10135433 | 3300013308 | Bacteria | 2586 |
| 271 | Ga0163163_10004844 | 3300014325 | Bacteria | 11564 |
| 272 | Ga0163163_10124732 | 3300014325 | Bacteria | 2612 |
| 273 | Ga0157380_10000052 | 3300014326 | Bacteria | 67030 |
| 274 | Ga0157377_10000076 | 3300014745 | Bacteria | 75835 |
| 275 | Ga0157379_10000060 | 3300014968 | Bacteria | 69312 |
| 276 | Ga0157379_10007831 | 3300014968 | Bacteria | 9252 |
| 277 | Ga0157379_10026823 | 3300014968 | Bacteria | 5128 |
| 278 | Ga0157379_10185697 | 3300014968 | Unclassified | 1879 |
| 279 | Ga0157376_10000141 | 3300014969 | Bacteria | 49288 |
| 280 | Ga0163161_10026256 | 3300017792 | Bacteria | 4126 |
| 281 | Ga0206356_10402258 | 3300020070 | Bacteria | 1684 |
| 282 | Ga0207666_1000005 | 3300025271 | Bacteria | 54011 |
| 283 | Ga0207666_1000330 | 3300025271 | Bacteria | 6509 |
| 284 | Ga0207673_1000002 | 3300025290 | Bacteria | 18299 |
| 285 | Ga0207697_10000011 | 3300025315 | Bacteria | 65035 |
| 286 | Ga0207697_10003212 | 3300025315 | Bacteria | 8131 |
| 287 | Ga0207656_10002239 | 3300025321 | Bacteria | 6483 |
| 288 | Ga0207653_10007931 | 3300025885 | Bacteria | 3309 |
| 289 | Ga0207682_10000051 | 3300025893 | Bacteria | 49249 |
| 290 | Ga0207682_10009271 | 3300025893 | Bacteria | 3888 |
| 291 | Ga0207692_10005372 | 3300025898 | Bacteria | 5131 |
| 292 | Ga0207692_10028543 | 3300025898 | Bacteria | 2641 |
| 293 | Ga0207642_10000229 | 3300025899 | Bacteria | 16538 |
| 294 | Ga0207710_10001284 | 3300025900 | Bacteria | 12696 |
| 295 | Ga0207710_10021318 | 3300025900 | Bacteria | 2776 |
| 296 | Ga0207688_10000001 | 3300025901 | Bacteria | 107505 |
| 297 | Ga0207688_10009124 | 3300025901 | Bacteria | 5400 |
| 298 | Ga0207680_10029075 | 3300025903 | Bacteria | 3100 |
| 299 | Ga0207647_10001714 | 3300025904 | Bacteria | 16833 |
| 300 | Ga0207647_10007690 | 3300025904 | Bacteria | 7763 |
| 301 | Ga0207685_10004129 | 3300025905 | Bacteria | 3644 |
| 302 | Ga0207699_10001161 | 3300025906 | Bacteria | 12456 |
| 303 | Ga0207699_10097860 | 3300025906 | Unclassified | 1855 |
| 304 | Ga0207645_10000121 | 3300025907 | Bacteria | 58999 |
| 305 | Ga0207645_10013754 | 3300025907 | Bacteria | 5433 |
| 306 | Ga0207645_10023325 | 3300025907 | Bacteria | 4022 |
| 307 | Ga0207645_10086216 | 3300025907 | Bacteria | 2017 |
| 308 | Ga0207643_10000009 | 3300025908 | Bacteria | 160496 |
| 309 | Ga0207705_10030075 | 3300025909 | Bacteria | 3874 |
| 310 | Ga0207654_10043742 | 3300025911 | Bacteria | 2540 |
| 311 | Ga0207707_10000840 | 3300025912 | Bacteria | 30189 |
| 312 | Ga0207707_10026208 | 3300025912 | Bacteria | 5096 |
| 313 | Ga0207693_10003131 | 3300025915 | Bacteria | 14229 |
| 314 | Ga0207693_10011496 | 3300025915 | Bacteria | 7161 |
| 315 | Ga0207693_10058351 | 3300025915 | Bacteria | 3024 |
| 316 | Ga0207663_10015462 | 3300025916 | Bacteria | 4210 |
| 317 | Ga0207660_10021268 | 3300025917 | Bacteria | 4361 |
| 318 | Ga0207660_10114085 | 3300025917 | Bacteria | 2037 |
| 319 | Ga0207660_10180614 | 3300025917 | Unclassified | 1639 |
| 320 | Ga0207662_10000120 | 3300025918 | Bacteria | 37721 |
| 321 | Ga0207662_10001791 | 3300025918 | Bacteria | 10543 |
| 322 | Ga0207657_10002826 | 3300025919 | Bacteria | 18663 |
| 323 | Ga0207657_10004971 | 3300025919 | Bacteria | 13989 |
| 324 | Ga0207657_10081532 | 3300025919 | Bacteria | 2717 |
| 325 | Ga0207649_10000052 | 3300025920 | Bacteria | 106800 |
| 326 | Ga0207649_10001315 | 3300025920 | Bacteria | 14788 |
| 327 | Ga0207652_10000508 | 3300025921 | Bacteria | 39568 |
| 328 | Ga0207652_10016692 | 3300025921 | Bacteria | 6000 |
| 329 | Ga0207652_10098796 | 3300025921 | Bacteria | 2575 |
| 330 | Ga0207652_10111632 | 3300025921 | Bacteria | 2425 |
| 331 | Ga0207646_10069016 | 3300025922 | Bacteria | 3157 |
| 332 | Ga0207681_10000035 | 3300025923 | Bacteria | 161792 |
| 333 | Ga0207694_10172192 | 3300025924 | Bacteria | 1753 |
| 334 | Ga0207650_10000843 | 3300025925 | Bacteria | 23231 |
| 335 | Ga0207650_10001028 | 3300025925 | Bacteria | 20946 |
| 336 | Ga0207650_10078480 | 3300025925 | Bacteria | 2498 |
| 337 | Ga0207659_10000027 | 3300025926 | Bacteria | 135454 |
| 338 | Ga0207659_10001108 | 3300025926 | Bacteria | 15972 |
| 339 | Ga0207687_10000231 | 3300025927 | Bacteria | 38087 |
| 340 | Ga0207687_10012582 | 3300025927 | Bacteria | 5527 |
| 341 | Ga0207687_10012658 | 3300025927 | Bacteria | 5512 |
| 342 | Ga0207700_10000917 | 3300025928 | Bacteria | 16892 |
| 343 | Ga0207700_10021942 | 3300025928 | Bacteria | 4372 |
| 344 | Ga0207700_10053149 | 3300025928 | Bacteria | 3033 |
| 345 | Ga0207644_10000157 | 3300025931 | Bacteria | 49224 |
| 346 | Ga0207644_10007559 | 3300025931 | Bacteria | 7084 |
| 347 | Ga0207690_10000056 | 3300025932 | Bacteria | 101387 |
| 348 | Ga0207690_10017319 | 3300025932 | Bacteria | 4397 |
| 349 | Ga0207706_10000261 | 3300025933 | Bacteria | 57530 |
| 350 | Ga0207706_10004416 | 3300025933 | Bacteria | 13214 |
| 351 | Ga0207706_10014945 | 3300025933 | Bacteria | 7030 |
| 352 | Ga0207706_10015924 | 3300025933 | Bacteria | 6794 |
| 353 | Ga0207686_10000171 | 3300025934 | Bacteria | 49624 |
| 354 | Ga0207686_10011564 | 3300025934 | Bacteria | 4836 |
| 355 | Ga0207686_10032093 | 3300025934 | Unclassified | 3123 |
| 356 | Ga0207709_10000087 | 3300025935 | Bacteria | 155019 |
| 357 | Ga0207670_10000169 | 3300025936 | Bacteria | 43470 |
| 358 | Ga0207670_10017561 | 3300025936 | Bacteria | 4326 |
| 359 | Ga0207669_10000351 | 3300025937 | Bacteria | 20924 |
| 360 | Ga0207704_10000134 | 3300025938 | Bacteria | 40098 |
| 361 | Ga0207665_10000333 | 3300025939 | Bacteria | 32450 |
| 362 | Ga0207691_10000106 | 3300025940 | Bacteria | 74290 |
| 363 | Ga0207691_10000212 | 3300025940 | Bacteria | 56413 |
| 364 | Ga0207691_10077212 | 3300025940 | Bacteria | 3001 |
| 365 | Ga0207711_10032883 | 3300025941 | Bacteria | 4387 |
| 366 | Ga0207711_10066716 | 3300025941 | Bacteria | 3112 |
| 367 | Ga0207711_10086244 | 3300025941 | Bacteria | 2752 |
| 368 | Ga0207711_10107904 | 3300025941 | Bacteria | 2472 |
| 369 | Ga0207689_10000031 | 3300025942 | Bacteria | 97131 |
| 370 | Ga0207689_10031849 | 3300025942 | Bacteria | 4386 |
| 371 | Ga0207689_10036829 | 3300025942 | Bacteria | 4060 |
| 372 | Ga0207661_10000219 | 3300025944 | Bacteria | 37298 |
| 373 | Ga0207661_10002054 | 3300025944 | Bacteria | 13858 |
| 374 | Ga0207661_10044792 | 3300025944 | Bacteria | 3499 |
| 375 | Ga0207679_10001608 | 3300025945 | Bacteria | 14055 |
| 376 | Ga0207679_10036844 | 3300025945 | Bacteria | 3473 |
| 377 | Ga0207667_10039261 | 3300025949 | Bacteria | 5047 |
| 378 | Ga0207651_10002529 | 3300025960 | Bacteria | 8730 |
| 379 | Ga0207651_10010392 | 3300025960 | Bacteria | 5158 |
| 380 | Ga0207651_10072873 | 3300025960 | Bacteria | 2440 |
| 381 | Ga0207651_10099361 | 3300025960 | Bacteria | 2155 |
| 382 | Ga0207651_10101216 | 3300025960 | Bacteria | 2138 |
| 383 | Ga0207651_10112640 | 3300025960 | Bacteria | 2045 |
| 384 | Ga0207712_10000176 | 3300025961 | Bacteria | 66116 |
| 385 | Ga0207712_10012238 | 3300025961 | Bacteria | 5482 |
| 386 | Ga0207712_10102257 | 3300025961 | Bacteria | 2133 |
| 387 | Ga0207668_10000191 | 3300025972 | Bacteria | 41901 |
| 388 | Ga0207668_10115042 | 3300025972 | Bacteria | 2026 |
| 389 | Ga0207640_10000126 | 3300025981 | Bacteria | 58432 |
| 390 | Ga0207658_10001331 | 3300025986 | Bacteria | 19354 |
| 391 | Ga0207658_10028749 | 3300025986 | Bacteria | 3919 |
| 392 | Ga0207658_10047022 | 3300025986 | Bacteria | 3155 |
| 393 | Ga0207658_10071512 | 3300025986 | Bacteria | 2627 |
| 394 | Ga0207658_10074481 | 3300025986 | Bacteria | 2580 |
| 395 | Ga0207677_10001004 | 3300026023 | Bacteria | 15580 |
| 396 | Ga0207677_10004460 | 3300026023 | Bacteria | 7516 |
| 397 | Ga0207703_10007278 | 3300026035 | Bacteria | 8798 |
| 398 | Ga0207703_10060365 | 3300026035 | Bacteria | 3100 |
| 399 | Ga0207639_10000515 | 3300026041 | Bacteria | 26655 |
| 400 | Ga0207639_10107499 | 3300026041 | Bacteria | 2266 |
| 401 | Ga0207678_10000137 | 3300026067 | Bacteria | 60700 |
| 402 | Ga0207678_10019341 | 3300026067 | Bacteria | 5982 |
| 403 | Ga0207678_10097972 | 3300026067 | Bacteria | 2505 |
| 404 | Ga0207708_10000250 | 3300026075 | Bacteria | 42228 |
| 405 | Ga0207708_10004369 | 3300026075 | Bacteria | 10414 |
| 406 | Ga0207708_10010877 | 3300026075 | Bacteria | 6769 |
| 407 | Ga0207702_10001067 | 3300026078 | Bacteria | 28056 |
| 408 | Ga0207641_10000937 | 3300026088 | Bacteria | 30095 |
| 409 | Ga0207641_10150637 | 3300026088 | Unclassified | 2106 |
| 410 | Ga0207648_10000125 | 3300026089 | Bacteria | 75547 |
| 411 | Ga0207648_10008450 | 3300026089 | Bacteria | 9969 |
| 412 | Ga0207648_10012120 | 3300026089 | Bacteria | 8085 |
| 413 | Ga0207676_10001547 | 3300026095 | Bacteria | 16966 |
| 414 | Ga0207676_10010020 | 3300026095 | Bacteria | 6744 |
| 415 | Ga0207674_10000095 | 3300026116 | Bacteria | 99278 |
| 416 | Ga0207674_10197434 | 3300026116 | Bacteria | 1962 |
| 417 | Ga0207675_100000140 | 3300026118 | Bacteria | 62058 |
| 418 | Ga0207675_100010192 | 3300026118 | Bacteria | 8808 |
| 419 | Ga0207675_100163364 | 3300026118 | Bacteria | 2126 |
| 420 | Ga0207683_10000010 | 3300026121 | Bacteria | 150106 |
| 421 | Ga0207683_10000178 | 3300026121 | Bacteria | 54648 |
| 422 | Ga0207683_10001447 | 3300026121 | Bacteria | 21461 |
| 423 | Ga0207698_10000086 | 3300026142 | Bacteria | 61523 |
| 424 | Ga0207698_10001736 | 3300026142 | Bacteria | 12713 |
| 425 | Ga0210002_1002682 | 3300027617 | Bacteria | 2576 |
| 426 | Ga0209971_1003367 | 3300027682 | Bacteria | 3795 |
| 427 | Ga0209998_10000790 | 3300027717 | Bacteria | 8188 |
| 428 | Ga0209998_10001828 | 3300027717 | Bacteria | 5040 |
| 429 | Ga0209974_10005676 | 3300027876 | Bacteria | 4379 |
| 430 | Ga0209974_10019463 | 3300027876 | Bacteria | 2251 |
| 431 | Ga0207428_10000037 | 3300027907 | Bacteria | 218857 |
| 432 | Ga0207428_10000188 | 3300027907 | Bacteria | 85820 |
| 433 | Ga0207428_10001468 | 3300027907 | Bacteria | 24676 |
| 434 | Ga0268266_10025953 | 3300028379 | Bacteria | 4984 |
| 435 | Ga0268266_10272953 | 3300028379 | Unclassified | 1570 |
| 436 | Ga0268265_10000774 | 3300028380 | Bacteria | 30835 |
| 437 | Ga0268264_10000467 | 3300028381 | Bacteria | 54925 |
| 438 | Ga0265318_10001682 | 3300028577 | Bacteria | 12704 |
| 439 | Ga0265330_10026680 | 3300031235 | Bacteria | 2611 |
| 440 | Ga0265332_10000899 | 3300031238 | Bacteria | 17859 |
| 441 | Ga0265332_10003866 | 3300031238 | Bacteria | 7149 |
| 442 | Ga0265328_10002574 | 3300031239 | Bacteria | 8123 |
| 443 | Ga0265320_10042060 | 3300031240 | Bacteria | 2269 |
| 444 | Ga0265325_10000049 | 3300031241 | Bacteria | 80854 |
| 445 | Ga0265340_10005195 | 3300031247 | Bacteria | 7235 |
| 446 | Ga0265339_10058197 | 3300031249 | Bacteria | 2087 |
| 447 | Ga0265331_10009401 | 3300031250 | Bacteria | 5486 |
| 448 | Ga0265316_10027190 | 3300031344 | Bacteria | 4742 |
| 449 | Ga0265313_10036282 | 3300031595 | Bacteria | 2476 |
| 450 | Ga0265313_10036963 | 3300031595 | Bacteria | 2447 |
| 451 | Ga0265314_10000784 | 3300031711 | Bacteria | 37699 |
| 452 | Ga0265314_10006115 | 3300031711 | Bacteria | 10696 |
| 453 | Ga0265342_10000392 | 3300031712 | Bacteria | 48362 |
| 454 | Ga0307516_10009407 | 3300031730 | Bacteria | 10903 |
| 455 | Ga0307516_10043262 | 3300031730 | Bacteria | 4464 |
| 456 | Ga0373930_0000027 | 3300034816 | Bacteria | 13519 |
| 457 | Ga0373948_0000240 | 3300034817 | Bacteria | 6536 |
| 458 | Ga0373950_0001487 | 3300034818 | Bacteria | 3063 |
| 459 | Ga0373958_0000799 | 3300034819 | Bacteria | 4043 |
| 460 | Ga0373958_0001378 | 3300034819 | Bacteria | 3255 |
| 461 | Ga0373938_0000020 | 3300034957 | Bacteria | 20855 |
| 462 | Ga0373938_0000482 | 3300034957 | Bacteria | 6452 |
| 463 | Ga0373926_0006103 | 3300035083 | Bacteria | 3991 |
| 464 | Ga0373928_0001620 | 3300035084 | Bacteria | 4359 |
| 465 | Ga0373928_0003098 | 3300035084 | Bacteria | 3191 |
| 466 | Ga0373928_0004039 | 3300035084 | Bacteria | 2800 |
| 467 | Ga0373929_0001458 | 3300035085 | Bacteria | 4511 |
| 468 | Ga0373934_0021715 | 3300035086 | Bacteria | 2474 |
| 469 | Ga0373949_0000753 | 3300035090 | Bacteria | 10447 |
| 470 | Ga0373949_0004305 | 3300035090 | Bacteria | 3273 |
| 471 | Ga0373951_0001531 | 3300035091 | Bacteria | 6048 |
| 472 | Ga0373951_0006562 | 3300035091 | Bacteria | 2660 |
| 473 | Ga0373952_0000597 | 3300035092 | Bacteria | 6378 |
| 474 | Ga0373952_0001351 | 3300035092 | Bacteria | 4489 |
| 475 | Ga0373932_0000316 | 3300035112 | Bacteria | 14729 |
| 476 | Ga0373936_0002157 | 3300035113 | Bacteria | 7328 |
| 477 | Ga0373936_0055452 | 3300035113 | Bacteria | 1609 |
| 478 | Ga0373939_0000429 | 3300035114 | Bacteria | 10556 |
| 479 | Ga0373941_0000341 | 3300035115 | Bacteria | 9139 |
| 480 | Ga0373941_0001140 | 3300035115 | Bacteria | 5543 |
| 481 | Ga0373953_0006441 | 3300035117 | Bacteria | 3868 |
| 482 | Ga0373954_0008900 | 3300035118 | Bacteria | 4417 |
| 483 | Ga0373956_0005690 | 3300035119 | Bacteria | 4984 |
| 484 | Ga0373960_0000127 | 3300035121 | Bacteria | 12399 |
| 485 | Ga0373960_0000335 | 3300035121 | Bacteria | 9006 |
| 486 | Ga0373960_0004580 | 3300035121 | Bacteria | 3174 |
| 487 | Ga0373946_0033500 | 3300035171 | Bacteria | 2068 |
| 488 | Ga0373955_0001110 | 3300035172 | Bacteria | 11430 |
| 489 | Ga0373955_0003230 | 3300035172 | Bacteria | 7142 |
| 490 | Ga0373955_0113162 | 3300035172 | Unclassified | 1571 |
| 491 | Ga0373942_0000054 | 3300035207 | Bacteria | 23047 |
| 492 | Ga0373942_0015211 | 3300035207 | Bacteria | 1872 |
| 493 | Ga0373961_0000807 | 3300035241 | Bacteria | 10698 |
| 494 | Ga0373961_0004284 | 3300035241 | Bacteria | 3455 |
| 495 | Ga0373962_0000497 | 3300035242 | Bacteria | 8747 |
| 496 | Ga0373962_0001528 | 3300035242 | Bacteria | 5469 |
| 497 | Ga0373924_0001227 | 3300035410 | Bacteria | 8212 |
| 498 | Ga0373924_0008024 | 3300035410 | Bacteria | 3821 |
| 499 | Ga0373931_0001604 | 3300035691 | Bacteria | 9784 |
| 500 | Ga0373931_0003983 | 3300035691 | Bacteria | 6694 |
| 501 | Ga0373931_0004569 | 3300035691 | Bacteria | 6331 |
| 502 | Ga0373935_0000208 | 3300035692 | Bacteria | 28198 |
| 503 | Ga0373935_0004548 | 3300035692 | Bacteria | 8158 |
| 504 | Ga0373935_0015490 | 3300035692 | Bacteria | 4609 |
| 505 | Ga0373935_0035574 | 3300035692 | Bacteria | 3109 |
| 506 | Ga0373927_0001804 | 3300035695 | Bacteria | 15970 |
| 507 | Ga0373927_0017601 | 3300035695 | Bacteria | 4702 |
| 508 | Ga0373933_0002449 | 3300035724 | Bacteria | 10458 |
| 509 | Ga0373933_0020736 | 3300035724 | Bacteria | 3726 |
| 510 | Ga0373933_0023745 | 3300035724 | Bacteria | 3505 |
| 511 | Ga0373947_0005403 | 3300035725 | Bacteria | 7458 |
| 512 | Ga0373947_0006947 | 3300035725 | Bacteria | 6560 |
| 513 | Ga0373947_0018365 | 3300035725 | Bacteria | 4024 |
| 514 | Ga0373937_0000031 | 3300036401 | Bacteria | 120533 |
| 515 | Ga0373937_0002996 | 3300036401 | Bacteria | 14164 |
| 516 | Ga0373937_0132067 | 3300036401 | Bacteria | 2332 |
| 517 | Ga0373925_0000063 | 3300037068 | Bacteria | 114809 |
| 518 | Ga0373925_0025234 | 3300037068 | Bacteria | 4340 |
| 519 | Ga0436360_0097535 | 3300039438 | Bacteria | 1808 |
| 520 | Ga0451576_0010925 | 3300045051 | Bacteria | 10379 |
| 521 | Ga0495592_0000072 | 3300046454 | Bacteria | 91917 |
| 522 | Ga0495592_0001840 | 3300046454 | Bacteria | 14914 |
| 523 | Ga0495592_0010619 | 3300046454 | Bacteria | 6945 |
| 524 | Ga0495603_0011026 | 3300046455 | Bacteria | 5480 |
| 525 | Ga0495603_0037807 | 3300046455 | Bacteria | 2895 |
| 526 | Ga0495603_0051357 | 3300046455 | Bacteria | 2450 |
| 527 | Ga0495629_0000269 | 3300046459 | Bacteria | 45206 |
| 528 | Ga0495629_0041363 | 3300046459 | Bacteria | 3243 |
| 529 | Ga0495629_0089738 | 3300046459 | Bacteria | 2144 |
| 530 | Ga0495638_0040160 | 3300046460 | Bacteria | 2966 |
| 531 | Ga0495651_0001167 | 3300046462 | Bacteria | 20291 |
| 532 | Ga0495651_0005718 | 3300046462 | Bacteria | 9477 |
| 533 | Ga0495651_0010406 | 3300046462 | Bacteria | 7147 |
| 534 | Ga0495651_0014281 | 3300046462 | Bacteria | 6138 |
| 535 | Ga0495653_0000020 | 3300046463 | Bacteria | 175274 |
| 536 | Ga0495653_0010063 | 3300046463 | Bacteria | 7736 |
| 537 | Ga0495653_0030364 | 3300046463 | Bacteria | 4306 |
| 538 | Ga0495653_0038789 | 3300046463 | Bacteria | 3737 |
| 539 | Ga0495580_0175931 | 3300046472 | Bacteria | 1478 |
| 540 | Ga0495582_0003928 | 3300046473 | Bacteria | 8349 |
| 541 | Ga0495662_0025797 | 3300046476 | Bacteria | 2838 |
| 542 | Ga0495662_0032474 | 3300046476 | Bacteria | 2521 |
| 543 | Ga0495664_0000006 | 3300046477 | Bacteria | 407031 |
| 544 | Ga0495664_0010264 | 3300046477 | Bacteria | 5254 |
| 545 | Ga0495664_0012784 | 3300046477 | Bacteria | 4754 |
| 546 | Ga0495664_0021710 | 3300046477 | Bacteria | 3709 |
| 547 | Ga0495584_0021696 | 3300046491 | Bacteria | 3261 |
| 548 | Ga0495585_0001825 | 3300046492 | Bacteria | 16125 |
| 549 | Ga0495594_0009788 | 3300046499 | Bacteria | 4963 |
| 550 | Ga0495607_0040121 | 3300046501 | Bacteria | 2790 |
| 551 | Ga0495608_0000002 | 3300046511 | Bacteria | 376403 |
| 552 | Ga0495608_0001268 | 3300046511 | Bacteria | 17936 |
| 553 | Ga0495608_0006562 | 3300046511 | Bacteria | 8253 |
| 554 | Ga0495608_0016256 | 3300046511 | Bacteria | 5147 |
| 555 | Ga0495618_0000017 | 3300046514 | Bacteria | 143326 |
| 556 | Ga0495618_0088979 | 3300046514 | Bacteria | 1974 |
| 557 | Ga0495628_0000004 | 3300046516 | Bacteria | 462184 |
| 558 | Ga0495628_0005226 | 3300046516 | Bacteria | 11394 |
| 559 | Ga0495628_0007947 | 3300046516 | Bacteria | 9137 |
| 560 | Ga0495628_0012576 | 3300046516 | Bacteria | 7132 |
| 561 | Ga0495630_0002120 | 3300046517 | Bacteria | 13798 |
| 562 | Ga0495630_0025455 | 3300046517 | Bacteria | 4376 |
| 563 | Ga0495644_0000494 | 3300046523 | Bacteria | 16842 |
| 564 | Ga0495666_0019704 | 3300046526 | Bacteria | 3345 |
| 565 | Ga0495666_0070652 | 3300046526 | Bacteria | 1660 |
| 566 | Ga0495652_0000007 | 3300046529 | Bacteria | 418163 |
| 567 | Ga0495652_0061818 | 3300046529 | Bacteria | 3160 |
| 568 | Ga0495652_0077885 | 3300046529 | Bacteria | 2746 |
| 569 | Ga0495652_0118954 | 3300046529 | Bacteria | 2111 |
| 570 | Ga0495665_0091746 | 3300046531 | Bacteria | 1596 |
| 571 | Ga0495640_0000004 | 3300046533 | Bacteria | 357515 |
| 572 | Ga0495640_0006352 | 3300046533 | Bacteria | 9365 |
| 573 | Ga0495586_0011910 | 3300046535 | Bacteria | 4619 |
| 574 | Ga0495587_0000002 | 3300046536 | Bacteria | 425485 |
| 575 | Ga0495587_0000620 | 3300046536 | Bacteria | 24097 |
| 576 | Ga0495587_0010054 | 3300046536 | Bacteria | 6041 |
| 577 | Ga0495645_0000008 | 3300046543 | Bacteria | 331530 |
| 578 | Ga0495645_0000848 | 3300046543 | Bacteria | 20818 |
| 579 | Ga0495645_0008343 | 3300046543 | Bacteria | 7232 |
| 580 | Ga0495622_0028312 | 3300046557 | Bacteria | 2616 |
| 581 | Ga0495633_0001631 | 3300046558 | Bacteria | 16927 |
| 582 | Ga0495667_0000010 | 3300046559 | Bacteria | 222698 |
| 583 | Ga0495667_0001254 | 3300046559 | Bacteria | 16638 |
| 584 | Ga0495667_0104514 | 3300046559 | Bacteria | 1831 |
| 585 | Ga0495667_0113573 | 3300046559 | Unclassified | 1750 |
| 586 | Ga0495656_0000749 | 3300046615 | Bacteria | 10508 |
| 587 | Ga0495634_0000603 | 3300046642 | Bacteria | 34766 |
| 588 | Ga0495634_0019712 | 3300046642 | Bacteria | 4790 |
| 589 | Ga0495635_0000004 | 3300046663 | Bacteria | 388068 |
| 590 | Ga0495635_0005437 | 3300046663 | Bacteria | 8861 |
| 591 | Ga0495635_0036531 | 3300046663 | Bacteria | 3405 |
| 592 | Ga0495635_0090897 | 3300046663 | Bacteria | 2088 |
| 593 | Ga0495635_0091274 | 3300046663 | Bacteria | 2083 |
| 594 | Ga0495635_0121632 | 3300046663 | Unclassified | 1780 |
| 595 | Ga0495659_0018184 | 3300046664 | Bacteria | 2339 |
| 596 | Ga0495661_0050032 | 3300046665 | Bacteria | 2532 |
| 597 | Ga0495588_0007720 | 3300046674 | Bacteria | 4912 |
| 598 | Ga0495657_0000051 | 3300046675 | Bacteria | 101587 |
| 599 | Ga0495657_0002939 | 3300046675 | Bacteria | 14124 |
| 600 | Ga0495599_0000003 | 3300046678 | Bacteria | 319085 |
| 601 | Ga0495599_0003832 | 3300046678 | Bacteria | 8833 |
| 602 | Ga0495623_0000009 | 3300046679 | Bacteria | 127758 |
| 603 | Ga0495623_0026867 | 3300046679 | Bacteria | 3703 |
| 604 | Ga0495646_0000001 | 3300046680 | Bacteria | 403396 |
| 605 | Ga0495646_0000856 | 3300046680 | Bacteria | 17244 |
| 606 | Ga0495647_0012435 | 3300046681 | Bacteria | 2931 |
| 607 | Ga0495658_0004553 | 3300046683 | Bacteria | 6816 |
| 608 | Ga0495658_0018082 | 3300046683 | Bacteria | 3658 |
| 609 | Ga0495658_0139104 | 3300046683 | Unclassified | 1483 |
| 610 | Ga0495613_0015225 | 3300046689 | Bacteria | 5716 |
| 611 | Ga0495613_0038188 | 3300046689 | Bacteria | 3559 |
| 612 | Ga0495624_0040542 | 3300046690 | Bacteria | 2982 |
| 613 | Ga0495624_0042593 | 3300046690 | Bacteria | 2901 |
| 614 | Ga0495670_0001311 | 3300046691 | Bacteria | 12116 |
| 615 | Ga0495600_0000008 | 3300046809 | Bacteria | 147902 |
| 616 | Ga0495600_0019144 | 3300046809 | Bacteria | 4367 |
| 617 | Ga0495600_0052308 | 3300046809 | Bacteria | 2667 |
| 618 | Ga0495600_0058956 | 3300046809 | Bacteria | 2508 |
| 619 | Ga0495604_0000003 | 3300047317 | Bacteria | 464246 |
| 620 | Ga0495604_0005959 | 3300047317 | Bacteria | 9671 |
| 621 | Ga0495604_0027617 | 3300047317 | Bacteria | 4512 |
| 622 | Ga0495674_0000021 | 3300047319 | Bacteria | 174056 |
| 623 | Ga0495674_0005637 | 3300047319 | Bacteria | 11992 |
| 624 | Ga0495674_0257984 | 3300047319 | Bacteria | 1433 |
| 625 | Ga0495676_0034516 | 3300047321 | Bacteria | 4244 |
| 626 | Ga0495676_0120584 | 3300047321 | Bacteria | 1908 |
| 627 | Ga0495680_0000505 | 3300047322 | Bacteria | 44019 |
| 628 | Ga0495680_0001472 | 3300047322 | Bacteria | 25404 |
| 629 | Ga0495680_0006777 | 3300047322 | Bacteria | 10581 |
| 630 | Ga0495680_0017612 | 3300047322 | Bacteria | 6090 |
| 631 | Ga0495680_0018210 | 3300047322 | Bacteria | 5971 |
| 632 | Ga0495680_0022232 | 3300047322 | Bacteria | 5290 |
| 633 | Ga0495675_0000466 | 3300047444 | Bacteria | 26682 |
| 634 | Ga0495675_0018016 | 3300047444 | Bacteria | 4477 |
| 635 | Ga0495684_0000050 | 3300047471 | Bacteria | 86794 |
| 636 | Ga0495684_0015113 | 3300047471 | Bacteria | 5945 |
| 637 | Ga0495593_0000394 | 3300047673 | Bacteria | 24241 |
| 638 | Ga0495593_0009204 | 3300047673 | Bacteria | 5726 |
| 639 | Ga0495593_0080823 | 3300047673 | Bacteria | 1681 |
| 640 | Ga0495602_0000012 | 3300048088 | Bacteria | 200520 |
| 641 | Ga0495602_0002664 | 3300048088 | Bacteria | 18252 |
| 642 | Ga0495602_0013607 | 3300048088 | Bacteria | 8305 |
| 643 | Ga0496100_0000713 | 3300048903 | Bacteria | 15859 |
| 644 | Ga0496100_0006554 | 3300048903 | Bacteria | 6356 |
| 645 | Ga0496101_0000151 | 3300048904 | Bacteria | 59751 |
| 646 | Ga0496101_0007659 | 3300048904 | Bacteria | 7011 |
| 647 | Ga0496101_0016572 | 3300048904 | Bacteria | 4982 |
| 648 | Ga0496102_0001766 | 3300048905 | Bacteria | 18797 |
| 649 | Ga0496102_0016358 | 3300048905 | Bacteria | 6479 |
| 650 | Ga0496102_0048953 | 3300048905 | Bacteria | 3844 |
| 651 | Ga0496102_0070115 | 3300048905 | Bacteria | 3218 |
| 652 | Ga0496103_0000589 | 3300048906 | Bacteria | 28631 |
| 653 | Ga0496104_0000215 | 3300048907 | Bacteria | 50960 |
| 654 | Ga0496104_0005956 | 3300048907 | Bacteria | 10678 |
| 655 | Ga0496104_0097659 | 3300048907 | Bacteria | 2812 |
| 656 | Ga0496105_0007651 | 3300048908 | Bacteria | 8374 |
| 657 | Ga0496105_0020355 | 3300048908 | Bacteria | 5361 |
| 658 | Ga0496106_0000347 | 3300048909 | Bacteria | 32770 |
| 659 | Ga0496106_0019937 | 3300048909 | Bacteria | 4973 |
| 660 | Ga0496106_0021616 | 3300048909 | Bacteria | 4777 |
| 661 | Ga0496106_0146486 | 3300048909 | Bacteria | 1860 |
| 662 | Ga0496107_0000959 | 3300048910 | Bacteria | 17091 |
| 663 | Ga0496107_0019768 | 3300048910 | Bacteria | 4754 |
| 664 | Ga0496108_0007921 | 3300048911 | Bacteria | 8613 |
| 665 | Ga0496108_0034131 | 3300048911 | Bacteria | 4227 |
| 666 | Ga0496108_0056436 | 3300048911 | Bacteria | 3299 |
| 667 | Ga0496109_0000186 | 3300048912 | Bacteria | 62084 |
| 668 | Ga0496109_0025701 | 3300048912 | Bacteria | 5248 |
| 669 | Ga0496109_0156658 | 3300048912 | Bacteria | 2133 |
| 670 | Ga0496109_0176532 | 3300048912 | Bacteria | 2005 |
| 671 | Ga0496109_0178517 | 3300048912 | Bacteria | 1994 |
| 672 | Ga0496110_0020387 | 3300048913 | Bacteria | 5599 |
| 673 | Ga0496110_0022488 | 3300048913 | Bacteria | 5355 |
| 674 | Ga0496111_0044120 | 3300048914 | Unclassified | 3205 |
| 675 | Ga0496111_0083807 | 3300048914 | Bacteria | 2330 |
| 676 | Ga0496112_0115992 | 3300048915 | Bacteria | 2648 |
| 677 | Ga0496113_0001663 | 3300048916 | Bacteria | 12569 |
| 678 | Ga0496114_0025999 | 3300048917 | Unclassified | 4789 |
| 679 | Ga0496114_0076223 | 3300048917 | Bacteria | 2825 |
| 680 | Ga0496114_0139289 | 3300048917 | Unclassified | 2099 |
| 681 | Ga0496115_0007404 | 3300048918 | Bacteria | 8076 |
| 682 | Ga0496115_0013246 | 3300048918 | Bacteria | 6231 |
| 683 | Ga0496115_0073757 | 3300048918 | Bacteria | 2770 |
| 684 | Ga0496115_0099732 | 3300048918 | Bacteria | 2380 |
| 685 | Ga0501031_0002359 | 3300049568 | Bacteria | 11972 |
| 686 | Ga0501032_0016805 | 3300049569 | Bacteria | 5142 |
| 687 | Ga0501033_0018743 | 3300049570 | Bacteria | 5230 |
| 688 | Ga0501036_0050405 | 3300049572 | Bacteria | 3525 |
| 689 | Ga0501037_0035553 | 3300049573 | Bacteria | 3673 |
| 690 | Ga0501038_0032902 | 3300049574 | Bacteria | 4569 |
| 691 | Ga0501039_0047666 | 3300049575 | Bacteria | 3312 |
| 692 | Ga0501043_0071175 | 3300049579 | Bacteria | 2732 |
| 693 | Ga0501047_0008787 | 3300049581 | Bacteria | 9533 |
| 694 | Ga0501047_0019730 | 3300049581 | Bacteria | 6470 |
| 695 | Ga0501047_0040644 | 3300049581 | Bacteria | 4497 |
| 696 | Ga0501073_0034839 | 3300049589 | Bacteria | 3581 |
| 697 | Ga0501083_0023331 | 3300049744 | Bacteria | 4292 |
| 698 | Ga0501035_0168441 | 3300049822 | Bacteria | 1893 |
| 699 | Ga0501044_0080989 | 3300049823 | Bacteria | 3287 |
| 700 | Ga0501044_0103888 | 3300049823 | Bacteria | 2856 |
| 701 | nmdc:mga03683_29867_c1 | 3300050489 | Bacteria | 2177 |
| 702 | nmdc:mga06z11_13108_c1 | 3300050494 | Bacteria | 3629 |
| 703 | nmdc:mga05p37_2212_c1 | 3300050507 | Bacteria | 22652 |
| 704 | nmdc:mga09592_6462_c1 | 3300050508 | Bacteria | 9543 |
| 705 | nmdc:mga0qj67_18742_c1 | 3300050509 | Bacteria | 5277 |
| 706 | nmdc:mga08y16_1219_c1 | 3300050511 | Bacteria | 25435 |
| 707 | nmdc:mga08y16_311_c1 | 3300050511 | Bacteria | 43954 |
| 708 | nmdc:mga08y16_3545_c1 | 3300050511 | Bacteria | 16207 |
| 709 | nmdc:mga0n895_141846_c1 | 3300050512 | Bacteria | 2431 |
| 710 | nmdc:mga0n895_15841_c1 | 3300050512 | Bacteria | 6894 |
| 711 | nmdc:mga0n895_1869_c1 | 3300050512 | Bacteria | 16078 |
| 712 | nmdc:mga0n895_62_c1 | 3300050512 | Bacteria | 62891 |
| 713 | nmdc:mga0rr50_2956_c1 | 3300050513 | Bacteria | 9720 |
| 714 | nmdc:mga08x19_27777_c1 | 3300050514 | Bacteria | 3541 |
| 715 | nmdc:mga0a205_1191_c1 | 3300050515 | Bacteria | 21722 |
| 716 | nmdc:mga0a205_2311_c1 | 3300050515 | Bacteria | 12212 |
| 717 | nmdc:mga0sz30_41485_c1 | 3300050516 | Bacteria | 1935 |
| 718 | Ga0495601_0000004 | 3300053077 | Bacteria | 449178 |
| 719 | Ga0495601_0000109 | 3300053077 | Bacteria | 45069 |
| 720 | Ga0495601_0002506 | 3300053077 | Bacteria | 10450 |
| 721 | Ga0495601_0006125 | 3300053077 | Bacteria | 7019 |
| 722 | Ga0495601_0009758 | 3300053077 | Bacteria | 5677 |
| 723 | Ga0495601_0053399 | 3300053077 | Bacteria | 2554 |
| 724 | Ga0495612_0000013 | 3300053078 | Bacteria | 198142 |
| 725 | Ga0495612_0000953 | 3300053078 | Bacteria | 11879 |
| 726 | Ga0495612_0002655 | 3300053078 | Bacteria | 7376 |
| 727 | Ga0495612_0006674 | 3300053078 | Bacteria | 4733 |
| 728 | Ga0495612_0036372 | 3300053078 | Bacteria | 1998 |
| 729 | Ga0495595_0000034 | 3300053084 | Bacteria | 82597 |
| 730 | Ga0495595_0001271 | 3300053084 | Bacteria | 9824 |
| 731 | Ga0495595_0005318 | 3300053084 | Bacteria | 5205 |
| 732 | Ga0495595_0005872 | 3300053084 | Bacteria | 4976 |
| 733 | Ga0495595_0019136 | 3300053084 | Bacteria | 2968 |
| 734 | Ga0495595_0026712 | 3300053084 | Bacteria | 2566 |
| 735 | Ga0495595_0041456 | 3300053084 | Bacteria | 2106 |
| 736 | Ga0495619_0000005 | 3300053085 | Bacteria | 418061 |
| 737 | Ga0495619_0000289 | 3300053085 | Bacteria | 35778 |
| 738 | Ga0495619_0000662 | 3300053085 | Bacteria | 22563 |
| 739 | Ga0495619_0002507 | 3300053085 | Bacteria | 12025 |
| 740 | Ga0495619_0003722 | 3300053085 | Bacteria | 9828 |
| 741 | Ga0495619_0004938 | 3300053085 | Bacteria | 8470 |
| 742 | Ga0495619_0007879 | 3300053085 | Bacteria | 6740 |
| 743 | Ga0495619_0163078 | 3300053085 | Bacteria | 1540 |
| 744 | Ga0500643_002483 | 3300053087 | Bacteria | 9484 |
| 745 | Ga0500644_0000860 | 3300053088 | Bacteria | 9944 |
| 746 | Ga0500651_0051669 | 3300053093 | Bacteria | 2578 |
| 747 | Ga0500566_0019219 | 3300053094 | Bacteria | 4011 |
| 748 | Ga0500641_0015147 | 3300053096 | Bacteria | 2856 |
| 749 | Ga0500595_000062 | 3300053119 | Bacteria | 77506 |
| 750 | Ga0500595_013389 | 3300053119 | Bacteria | 3143 |
| 751 | Ga0500652_000003 | 3300053131 | Bacteria | 221528 |
| 752 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 753 | Ga0500636_0049021 | 3300053177 | Bacteria | 2485 |
| 754 | Ga0500645_000101 | 3300053730 | Bacteria | 68128 |
| 755 | Ga0501084_0067012 | 3300054114 | Bacteria | 3005 |
| 756 | Ga0501082_0067452 | 3300060353 | Bacteria | 3081 |
| 757 | Ga0501082_0148485 | 3300060353 | Bacteria | 2036 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046663 | Ga0495635_0121632 | Ga0495635_0121632_11_1171 | 383 |
| 2 | 3300006914 | Ga0075436_100007051 | Ga0075436_1000070515 | 389 |
| 3 | 3300031247 | Ga0265340_10005195 | Ga0265340_100051958 | 391 |
| 4 | 3300005983 | Ga0081540_1029140 | Ga0081540_10291404 | 392 |
| 5 | 3300009553 | Ga0105249_10003839 | Ga0105249_100038394 | 394 |
| 6 | 3300050512 | nmdc:mga0n895_15841_c1 | nmdc:mga0n895_15841_c1_773_2071 | 395 |
| 7 | 3300025940 | Ga0207691_10077212 | Ga0207691_100772122 | 398 |
| 8 | 3300026118 | Ga0207675_100163364 | Ga0207675_1001633642 | 398 |
| 9 | 3300031238 | Ga0265332_10000899 | Ga0265332_1000089913 | 398 |
| 10 | 3300031249 | Ga0265339_10058197 | Ga0265339_100581973 | 398 |
| 11 | 3300031712 | Ga0265342_10000392 | Ga0265342_1000039245 | 398 |
| 12 | 3300049579 | Ga0501043_0071175 | Ga0501043_0071175_510_1859 | 398 |
| 13 | 3300049823 | Ga0501044_0080989 | Ga0501044_0080989_354_1703 | 398 |
| 14 | 3300025933 | Ga0207706_10015924 | Ga0207706_100159242 | 401 |
| 15 | 3300026088 | Ga0207641_10150637 | Ga0207641_101506372 | 401 |
| 16 | 3300039438 | Ga0436360_0097535 | Ga0436360_0097535_260_1477 | 401 |
| 17 | 3300046529 | Ga0495652_0118954 | Ga0495652_0118954_98_1315 | 401 |
| 18 | 3300048912 | Ga0496109_0156658 | Ga0496109_0156658_413_1621 | 401 |
| 19 | 3300005444 | Ga0070694_100216330 | Ga0070694_1002163301 | 402 |
| 20 | 3300005458 | Ga0070681_10009120 | Ga0070681_100091205 | 402 |
| 21 | 3300005468 | Ga0070707_100013936 | Ga0070707_1000139362 | 402 |
| 22 | 3300025922 | Ga0207646_10069016 | Ga0207646_100690162 | 402 |
| 23 | 3300047322 | Ga0495680_0017612 | Ga0495680_0017612_3296_4510 | 402 |
| 24 | 3300003911 | JGI25405J52794_10001495 | JGI25405J52794_100014955 | 404 |
| 25 | 3300005329 | Ga0070683_100161317 | Ga0070683_1001613172 | 404 |
| 26 | 3300005437 | Ga0070710_10087694 | Ga0070710_100876943 | 404 |
| 27 | 3300005458 | Ga0070681_10090702 | Ga0070681_100907023 | 404 |
| 28 | 3300005563 | Ga0068855_100201967 | Ga0068855_1002019672 | 404 |
| 29 | 3300005937 | Ga0081455_10010063 | Ga0081455_100100636 | 404 |
| 30 | 3300010375 | Ga0105239_10288996 | Ga0105239_102889963 | 404 |
| 31 | 3300025915 | Ga0207693_10011496 | Ga0207693_100114969 | 404 |
| 32 | 3300025917 | Ga0207660_10114085 | Ga0207660_101140852 | 404 |
| 33 | 3300026116 | Ga0207674_10197434 | Ga0207674_101974342 | 404 |
| 34 | 3300005327 | Ga0070658_10028026 | Ga0070658_100280263 | 405 |
| 35 | 3300005329 | Ga0070683_100000695 | Ga0070683_10000069515 | 405 |
| 36 | 3300005331 | Ga0070670_100000442 | Ga0070670_1000004427 | 405 |
| 37 | 3300005338 | Ga0068868_100000127 | Ga0068868_10000012716 | 405 |
| 38 | 3300005344 | Ga0070661_100000589 | Ga0070661_10000058915 | 405 |
| 39 | 3300005354 | Ga0070675_100000082 | Ga0070675_10000008236 | 405 |
| 40 | 3300005355 | Ga0070671_100000405 | Ga0070671_1000004055 | 405 |
| 41 | 3300005364 | Ga0070673_100002161 | Ga0070673_1000021616 | 405 |
| 42 | 3300005367 | Ga0070667_100094121 | Ga0070667_1000941212 | 405 |
| 43 | 3300005456 | Ga0070678_100000014 | Ga0070678_10000001421 | 405 |
| 44 | 3300005459 | Ga0068867_100002202 | Ga0068867_1000022027 | 405 |
| 45 | 3300005535 | Ga0070684_100007137 | Ga0070684_1000071375 | 405 |
| 46 | 3300005543 | Ga0070672_100000029 | Ga0070672_10000002948 | 405 |
| 47 | 3300005548 | Ga0070665_100070658 | Ga0070665_1000706581 | 405 |
| 48 | 3300005564 | Ga0070664_100000124 | Ga0070664_10000012414 | 405 |
| 49 | 3300005615 | Ga0070702_100008129 | Ga0070702_1000081296 | 405 |
| 50 | 3300005616 | Ga0068852_100000016 | Ga0068852_100000016104 | 405 |
| 51 | 3300005618 | Ga0068864_100000823 | Ga0068864_10000082324 | 405 |
| 52 | 3300005834 | Ga0068851_10001223 | Ga0068851_100012235 | 405 |
| 53 | 3300005841 | Ga0068863_100013344 | Ga0068863_1000133446 | 405 |
| 54 | 3300005983 | Ga0081540_1041402 | Ga0081540_10414024 | 405 |
| 55 | 3300006237 | Ga0097621_100000482 | Ga0097621_1000004823 | 405 |
| 56 | 3300006358 | Ga0068871_100000050 | Ga0068871_10000005043 | 405 |
| 57 | 3300009098 | Ga0105245_10213849 | Ga0105245_102138492 | 405 |
| 58 | 3300009177 | Ga0105248_10065290 | Ga0105248_100652902 | 405 |
| 59 | 3300013105 | Ga0157369_10209362 | Ga0157369_102093622 | 405 |
| 60 | 3300013296 | Ga0157374_10000321 | Ga0157374_100003219 | 405 |
| 61 | 3300013297 | Ga0157378_10005246 | Ga0157378_100052465 | 405 |
| 62 | 3300013306 | Ga0163162_10002192 | Ga0163162_100021922 | 405 |
| 63 | 3300013308 | Ga0157375_10000627 | Ga0157375_1000062714 | 405 |
| 64 | 3300025321 | Ga0207656_10002239 | Ga0207656_100022395 | 405 |
| 65 | 3300025909 | Ga0207705_10030075 | Ga0207705_100300753 | 405 |
| 66 | 3300025920 | Ga0207649_10001315 | Ga0207649_100013159 | 405 |
| 67 | 3300025925 | Ga0207650_10001028 | Ga0207650_1000102812 | 405 |
| 68 | 3300025926 | Ga0207659_10001108 | Ga0207659_1000110813 | 405 |
| 69 | 3300025931 | Ga0207644_10000157 | Ga0207644_1000015749 | 405 |
| 70 | 3300025940 | Ga0207691_10000212 | Ga0207691_1000021219 | 405 |
| 71 | 3300025944 | Ga0207661_10002054 | Ga0207661_100020544 | 405 |
| 72 | 3300025945 | Ga0207679_10001608 | Ga0207679_1000160813 | 405 |
| 73 | 3300025960 | Ga0207651_10002529 | Ga0207651_100025293 | 405 |
| 74 | 3300025986 | Ga0207658_10028749 | Ga0207658_100287494 | 405 |
| 75 | 3300026023 | Ga0207677_10001004 | Ga0207677_100010047 | 405 |
| 76 | 3300026089 | Ga0207648_10008450 | Ga0207648_100084503 | 405 |
| 77 | 3300026095 | Ga0207676_10010020 | Ga0207676_100100206 | 405 |
| 78 | 3300026121 | Ga0207683_10000010 | Ga0207683_10000010107 | 405 |
| 79 | 3300026142 | Ga0207698_10000086 | Ga0207698_1000008613 | 405 |
| 80 | 3300028379 | Ga0268266_10272953 | Ga0268266_102729531 | 405 |
| 81 | 3300048911 | Ga0496108_0034131 | Ga0496108_0034131_2161_3411 | 405 |
| 82 | 3300048912 | Ga0496109_0025701 | Ga0496109_0025701_1118_2368 | 405 |
| 83 | 3300048914 | Ga0496111_0044120 | Ga0496111_0044120_1707_2957 | 405 |
| 84 | 3300048917 | Ga0496114_0025999 | Ga0496114_0025999_2647_3897 | 405 |
| 85 | 3300060353 | Ga0501082_0148485 | Ga0501082_0148485_75_1343 | 405 |
| 86 | 3300046526 | Ga0495666_0070652 | Ga0495666_0070652_15_1238 | 406 |
| 87 | 3300005985 | Ga0081539_10002257 | Ga0081539_1000225728 | 407 |
| 88 | 3300005548 | Ga0070665_100116586 | Ga0070665_1001165864 | 408 |
| 89 | 3300005844 | Ga0068862_100067930 | Ga0068862_1000679302 | 408 |
| 90 | 3300005983 | Ga0081540_1000397 | Ga0081540_100039724 | 408 |
| 91 | 3300025315 | Ga0207697_10003212 | Ga0207697_100032126 | 408 |
| 92 | 3300025893 | Ga0207682_10009271 | Ga0207682_100092714 | 408 |
| 93 | 3300025907 | Ga0207645_10013754 | Ga0207645_100137544 | 408 |
| 94 | 3300025934 | Ga0207686_10032093 | Ga0207686_100320934 | 408 |
| 95 | 3300025942 | Ga0207689_10036829 | Ga0207689_100368294 | 408 |
| 96 | 3300025960 | Ga0207651_10112640 | Ga0207651_101126402 | 408 |
| 97 | 3300025961 | Ga0207712_10102257 | Ga0207712_101022573 | 408 |
| 98 | 3300026075 | Ga0207708_10010877 | Ga0207708_100108774 | 408 |
| 99 | 3300048912 | Ga0496109_0178517 | Ga0496109_0178517_658_1920 | 408 |
| 100 | 3300006048 | Ga0075363_100018321 | Ga0075363_1000183212 | 410 |
| 101 | 3300035113 | Ga0373936_0002157 | Ga0373936_0002157_3720_4973 | 411 |
| 102 | 3300035171 | Ga0373946_0033500 | Ga0373946_0033500_714_1967 | 411 |
| 103 | 3300035172 | Ga0373955_0001110 | Ga0373955_0001110_10078_11331 | 411 |
| 104 | 3300035410 | Ga0373924_0001227 | Ga0373924_0001227_1157_2410 | 411 |
| 105 | 3300035692 | Ga0373935_0000208 | Ga0373935_0000208_24898_26151 | 411 |
| 106 | 3300035695 | Ga0373927_0001804 | Ga0373927_0001804_7863_9116 | 411 |
| 107 | 3300035724 | Ga0373933_0020736 | Ga0373933_0020736_1931_3184 | 411 |
| 108 | 3300035725 | Ga0373947_0006947 | Ga0373947_0006947_2003_3256 | 411 |
| 109 | 3300036401 | Ga0373937_0000031 | Ga0373937_0000031_87519_88772 | 411 |
| 110 | 3300037068 | Ga0373925_0000063 | Ga0373925_0000063_91152_92405 | 411 |
| 111 | 3300046454 | Ga0495592_0000072 | Ga0495592_0000072_71605_72858 | 411 |
| 112 | 3300046459 | Ga0495629_0041363 | Ga0495629_0041363_1322_2575 | 411 |
| 113 | 3300046462 | Ga0495651_0001167 | Ga0495651_0001167_5490_6743 | 411 |
| 114 | 3300046463 | Ga0495653_0000020 | Ga0495653_0000020_106211_107464 | 411 |
| 115 | 3300046476 | Ga0495662_0032474 | Ga0495662_0032474_911_2164 | 411 |
| 116 | 3300046477 | Ga0495664_0000006 | Ga0495664_0000006_80311_81564 | 411 |
| 117 | 3300046511 | Ga0495608_0000002 | Ga0495608_0000002_80259_81512 | 411 |
| 118 | 3300046514 | Ga0495618_0000017 | Ga0495618_0000017_61679_62932 | 411 |
| 119 | 3300046516 | Ga0495628_0000004 | Ga0495628_0000004_346847_348100 | 411 |
| 120 | 3300046517 | Ga0495630_0002120 | Ga0495630_0002120_7223_8476 | 411 |
| 121 | 3300046529 | Ga0495652_0000007 | Ga0495652_0000007_336429_337682 | 411 |
| 122 | 3300046531 | Ga0495665_0091746 | Ga0495665_0091746_165_1418 | 411 |
| 123 | 3300046533 | Ga0495640_0000004 | Ga0495640_0000004_102376_103629 | 411 |
| 124 | 3300046536 | Ga0495587_0000002 | Ga0495587_0000002_343783_345036 | 411 |
| 125 | 3300046543 | Ga0495645_0000008 | Ga0495645_0000008_249897_251150 | 411 |
| 126 | 3300046559 | Ga0495667_0000010 | Ga0495667_0000010_135143_136396 | 411 |
| 127 | 3300046642 | Ga0495634_0000603 | Ga0495634_0000603_32773_34026 | 411 |
| 128 | 3300046663 | Ga0495635_0000004 | Ga0495635_0000004_102332_103585 | 411 |
| 129 | 3300046675 | Ga0495657_0000051 | Ga0495657_0000051_20047_21300 | 411 |
| 130 | 3300046678 | Ga0495599_0000003 | Ga0495599_0000003_237508_238761 | 411 |
| 131 | 3300046679 | Ga0495623_0000009 | Ga0495623_0000009_67337_68590 | 411 |
| 132 | 3300046680 | Ga0495646_0000001 | Ga0495646_0000001_80368_81621 | 411 |
| 133 | 3300046690 | Ga0495624_0042593 | Ga0495624_0042593_776_2029 | 411 |
| 134 | 3300046809 | Ga0495600_0000008 | Ga0495600_0000008_66279_67532 | 411 |
| 135 | 3300047317 | Ga0495604_0000003 | Ga0495604_0000003_80233_81486 | 411 |
| 136 | 3300047319 | Ga0495674_0000021 | Ga0495674_0000021_44708_45961 | 411 |
| 137 | 3300047322 | Ga0495680_0000505 | Ga0495680_0000505_16431_17684 | 411 |
| 138 | 3300047444 | Ga0495675_0000466 | Ga0495675_0000466_20041_21294 | 411 |
| 139 | 3300047471 | Ga0495684_0000050 | Ga0495684_0000050_80354_81607 | 411 |
| 140 | 3300047673 | Ga0495593_0000394 | Ga0495593_0000394_5117_6370 | 411 |
| 141 | 3300048088 | Ga0495602_0000012 | Ga0495602_0000012_119041_120294 | 411 |
| 142 | 3300053077 | Ga0495601_0000004 | Ga0495601_0000004_367466_368719 | 411 |
| 143 | 3300053078 | Ga0495612_0000013 | Ga0495612_0000013_116521_117774 | 411 |
| 144 | 3300053084 | Ga0495595_0000034 | Ga0495595_0000034_935_2188 | 411 |
| 145 | 3300053085 | Ga0495619_0000005 | Ga0495619_0000005_80374_81627 | 411 |
| 146 | 3300003659 | JGI25404J52841_10001193 | JGI25404J52841_100011935 | 412 |
| 147 | 3300005983 | Ga0081540_1004355 | Ga0081540_10043554 | 412 |
| 148 | 3300009176 | Ga0105242_10026443 | Ga0105242_100264434 | 413 |
| 149 | 3300009177 | Ga0105248_10094971 | Ga0105248_100949714 | 413 |
| 150 | 3300013100 | Ga0157373_10232834 | Ga0157373_102328341 | 413 |
| 151 | 3300013104 | Ga0157370_10033080 | Ga0157370_100330806 | 413 |
| 152 | 3300013296 | Ga0157374_10326059 | Ga0157374_103260592 | 413 |
| 153 | 3300013297 | Ga0157378_10052863 | Ga0157378_100528634 | 413 |
| 154 | 3300014968 | Ga0157379_10185697 | Ga0157379_101856972 | 413 |
| 155 | 3300028577 | Ga0265318_10001682 | Ga0265318_100016826 | 413 |
| 156 | 3300031235 | Ga0265330_10026680 | Ga0265330_100266802 | 413 |
| 157 | 3300031238 | Ga0265332_10003866 | Ga0265332_100038664 | 413 |
| 158 | 3300031239 | Ga0265328_10002574 | Ga0265328_100025745 | 413 |
| 159 | 3300031240 | Ga0265320_10042060 | Ga0265320_100420602 | 413 |
| 160 | 3300031250 | Ga0265331_10009401 | Ga0265331_100094015 | 413 |
| 161 | 3300031344 | Ga0265316_10027190 | Ga0265316_100271902 | 413 |
| 162 | 3300031711 | Ga0265314_10006115 | Ga0265314_100061155 | 413 |
| 163 | 3300036401 | Ga0373937_0132067 | Ga0373937_0132067_918_2297 | 413 |
| 164 | 3300046683 | Ga0495658_0018082 | Ga0495658_0018082_1752_3032 | 413 |
| 165 | 3300048917 | Ga0496114_0139289 | Ga0496114_0139289_372_1652 | 413 |
| 166 | 3300049589 | Ga0501073_0034839 | Ga0501073_0034839_124_1368 | 413 |
| 167 | 3300031595 | Ga0265313_10036282 | Ga0265313_100362822 | 414 |
| 168 | 3300053085 | Ga0495619_0163078 | Ga0495619_0163078_88_1335 | 414 |
| 169 | iso_pu_bacteria | 2643221547 | 2643756040 | 414 |
| 170 | 3300005290 | Ga0065712_10113325 | Ga0065712_101133252 | 415 |
| 171 | 3300005293 | Ga0065715_10145512 | Ga0065715_101455121 | 415 |
| 172 | 3300005330 | Ga0070690_100023814 | Ga0070690_1000238142 | 415 |
| 173 | 3300005331 | Ga0070670_100072582 | Ga0070670_1000725822 | 415 |
| 174 | 3300005547 | Ga0070693_100140072 | Ga0070693_1001400721 | 415 |
| 175 | 3300005564 | Ga0070664_100040344 | Ga0070664_1000403442 | 415 |
| 176 | 3300006178 | Ga0075367_10102230 | Ga0075367_101022302 | 415 |
| 177 | 3300006871 | Ga0075434_100134451 | Ga0075434_1001344512 | 415 |
| 178 | 3300009101 | Ga0105247_10007491 | Ga0105247_1000749110 | 415 |
| 179 | 3300009177 | Ga0105248_10031579 | Ga0105248_100315792 | 415 |
| 180 | 3300014325 | Ga0163163_10004844 | Ga0163163_100048449 | 415 |
| 181 | 3300025900 | Ga0207710_10021318 | Ga0207710_100213184 | 415 |
| 182 | 3300025941 | Ga0207711_10066716 | Ga0207711_100667164 | 415 |
| 183 | 3300025945 | Ga0207679_10036844 | Ga0207679_100368442 | 415 |
| 184 | 3300047319 | Ga0495674_0257984 | Ga0495674_0257984_92_1366 | 415 |
| 185 | 3300048915 | Ga0496112_0115992 | Ga0496112_0115992_125_1390 | 415 |
| 186 | 3300048916 | Ga0496113_0001663 | Ga0496113_0001663_9584_10849 | 415 |
| 187 | 3300050512 | nmdc:mga0n895_141846_c1 | nmdc:mga0n895_141846_c1_191_1465 | 415 |
| 188 | 3300005367 | Ga0070667_100108839 | Ga0070667_1001088392 | 416 |
| 189 | 3300005618 | Ga0068864_100062981 | Ga0068864_1000629811 | 416 |
| 190 | 3300009098 | Ga0105245_10002287 | Ga0105245_1000228712 | 416 |
| 191 | 3300009176 | Ga0105242_10127768 | Ga0105242_101277682 | 416 |
| 192 | 3300009177 | Ga0105248_10009137 | Ga0105248_100091376 | 416 |
| 193 | 3300025927 | Ga0207687_10012658 | Ga0207687_100126584 | 416 |
| 194 | 3300025928 | Ga0207700_10053149 | Ga0207700_100531494 | 416 |
| 195 | 3300025941 | Ga0207711_10032883 | Ga0207711_100328834 | 416 |
| 196 | 3300025960 | Ga0207651_10101216 | Ga0207651_101012163 | 416 |
| 197 | 3300025986 | Ga0207658_10074481 | Ga0207658_100744813 | 416 |
| 198 | 3300048907 | Ga0496104_0097659 | Ga0496104_0097659_1064_2335 | 416 |
| 199 | 3300053084 | Ga0495595_0019136 | Ga0495595_0019136_1003_2274 | 416 |
| 200 | 3300003659 | JGI25404J52841_10005069 | JGI25404J52841_100050692 | 417 |
| 201 | 3300005983 | Ga0081540_1000518 | Ga0081540_100051830 | 417 |
| 202 | 3300046557 | Ga0495622_0028312 | Ga0495622_0028312_308_1582 | 417 |
| 203 | 3300049581 | Ga0501047_0040644 | Ga0501047_0040644_2279_3565 | 417 |
| 204 | 3300053094 | Ga0500566_0019219 | Ga0500566_0019219_1568_2836 | 417 |
| 205 | 3300053119 | Ga0500595_013389 | Ga0500595_013389_1205_2473 | 417 |
| 206 | 3300053131 | Ga0500652_000003 | Ga0500652_000003_142581_143849 | 417 |
| 207 | 3300053177 | Ga0500636_0049021 | Ga0500636_0049021_108_1376 | 417 |
| 208 | 3300003659 | JGI25404J52841_10000210 | JGI25404J52841_100002102 | 418 |
| 209 | 3300005327 | Ga0070658_10059506 | Ga0070658_100595062 | 418 |
| 210 | 3300005329 | Ga0070683_100026861 | Ga0070683_1000268616 | 418 |
| 211 | 3300005439 | Ga0070711_100101812 | Ga0070711_1001018122 | 418 |
| 212 | 3300005458 | Ga0070681_10091827 | Ga0070681_100918272 | 418 |
| 213 | 3300005530 | Ga0070679_100143328 | Ga0070679_1001433282 | 418 |
| 214 | 3300005937 | Ga0081455_10014701 | Ga0081455_100147016 | 418 |
| 215 | 3300005983 | Ga0081540_1000293 | Ga0081540_100029321 | 418 |
| 216 | 3300005983 | Ga0081540_1005808 | Ga0081540_10058083 | 418 |
| 217 | 3300005983 | Ga0081540_1009145 | Ga0081540_10091452 | 418 |
| 218 | 3300005985 | Ga0081539_10015916 | Ga0081539_100159162 | 418 |
| 219 | 3300006042 | Ga0075368_10033949 | Ga0075368_100339491 | 418 |
| 220 | 3300006177 | Ga0075362_10020225 | Ga0075362_100202251 | 418 |
| 221 | 3300006186 | Ga0075369_10012498 | Ga0075369_100124984 | 418 |
| 222 | 3300020070 | Ga0206356_10402258 | Ga0206356_104022582 | 418 |
| 223 | 3300025921 | Ga0207652_10111632 | Ga0207652_101116322 | 418 |
| 224 | 3300025944 | Ga0207661_10044792 | Ga0207661_100447923 | 418 |
| 225 | 3300031730 | Ga0307516_10009407 | Ga0307516_100094073 | 418 |
| 226 | 3300031730 | Ga0307516_10043262 | Ga0307516_100432625 | 418 |
| 227 | 3300049581 | Ga0501047_0008787 | Ga0501047_0008787_1434_2738 | 418 |
| 228 | 3300049744 | Ga0501083_0023331 | Ga0501083_0023331_1032_2336 | 418 |
| 229 | 3300049823 | Ga0501044_0103888 | Ga0501044_0103888_901_2205 | 418 |
| 230 | 3300050489 | nmdc:mga03683_29867_c1 | nmdc:mga03683_29867_c1_549_1820 | 418 |
| 231 | 3300050516 | nmdc:mga0sz30_41485_c1 | nmdc:mga0sz30_41485_c1_561_1832 | 418 |
| 232 | 3300053096 | Ga0500641_0015147 | Ga0500641_0015147_1470_2741 | 418 |
| 233 | 3300060353 | Ga0501082_0067452 | Ga0501082_0067452_85_1389 | 418 |
| 234 | iso_pu_bacteria | 2513237161 | 2514017097 | 418 |
| 235 | iso_pu_bacteria | 2935608549 | 2935613684 | 418 |
| 236 | iso_pu_bacteria | 2935760218 | 2935767995 | 418 |
| 237 | 3300005545 | Ga0070695_100003239 | Ga0070695_1000032394 | 419 |
| 238 | 3300025906 | Ga0207699_10097860 | Ga0207699_100978602 | 419 |
| 239 | 3300031711 | Ga0265314_10000784 | Ga0265314_1000078411 | 419 |
| 240 | 3300035086 | Ga0373934_0021715 | Ga0373934_0021715_255_1517 | 419 |
| 241 | 3300035172 | Ga0373955_0003230 | Ga0373955_0003230_5614_6876 | 419 |
| 242 | 3300035724 | Ga0373933_0023745 | Ga0373933_0023745_251_1513 | 419 |
| 243 | 3300046559 | Ga0495667_0113573 | Ga0495667_0113573_74_1336 | 419 |
| 244 | 3300046809 | Ga0495600_0052308 | Ga0495600_0052308_731_1993 | 419 |
| 245 | 3300047322 | Ga0495680_0022232 | Ga0495680_0022232_912_2174 | 419 |
| 246 | 3300053077 | Ga0495601_0053399 | Ga0495601_0053399_1013_2275 | 419 |
| 247 | 3300053078 | Ga0495612_0036372 | Ga0495612_0036372_586_1848 | 419 |
| 248 | 3300053084 | Ga0495595_0041456 | Ga0495595_0041456_30_1292 | 419 |
| 249 | 3300053087 | Ga0500643_002483 | Ga0500643_002483_7130_8395 | 419 |
| 250 | 3300053088 | Ga0500644_0000860 | Ga0500644_0000860_7884_9149 | 419 |
| 251 | 3300053119 | Ga0500595_000062 | Ga0500595_000062_16802_18067 | 419 |
| 252 | 3300053153 | Ga0500616_0000006 | Ga0500616_0000006_806805_808070 | 419 |
| 253 | 3300005436 | Ga0070713_100149309 | Ga0070713_1001493092 | 420 |
| 254 | 3300005983 | Ga0081540_1009059 | Ga0081540_10090592 | 420 |
| 255 | 3300006058 | Ga0075432_10031917 | Ga0075432_100319172 | 420 |
| 256 | 3300006846 | Ga0075430_100000627 | Ga0075430_10000062723 | 420 |
| 257 | 3300006852 | Ga0075433_10000615 | Ga0075433_1000061512 | 420 |
| 258 | 3300006880 | Ga0075429_100000877 | Ga0075429_1000008778 | 420 |
| 259 | 3300007076 | Ga0075435_100001540 | Ga0075435_10000154010 | 420 |
| 260 | 3300009094 | Ga0111539_10000423 | Ga0111539_100004238 | 420 |
| 261 | 3300027907 | Ga0207428_10000188 | Ga0207428_1000018819 | 420 |
| 262 | 3300035083 | Ga0373926_0006103 | Ga0373926_0006103_1853_3118 | 420 |
| 263 | 3300035113 | Ga0373936_0055452 | Ga0373936_0055452_157_1476 | 420 |
| 264 | 3300035172 | Ga0373955_0113162 | Ga0373955_0113162_288_1553 | 420 |
| 265 | 3300035692 | Ga0373935_0015490 | Ga0373935_0015490_2886_4151 | 420 |
| 266 | 3300035725 | Ga0373947_0018365 | Ga0373947_0018365_884_2203 | 420 |
| 267 | 3300046455 | Ga0495603_0037807 | Ga0495603_0037807_1495_2760 | 420 |
| 268 | 3300046460 | Ga0495638_0040160 | Ga0495638_0040160_979_2247 | 420 |
| 269 | 3300046463 | Ga0495653_0038789 | Ga0495653_0038789_36_1301 | 420 |
| 270 | 3300046472 | Ga0495580_0175931 | Ga0495580_0175931_61_1326 | 420 |
| 271 | 3300046476 | Ga0495662_0025797 | Ga0495662_0025797_1377_2696 | 420 |
| 272 | 3300046477 | Ga0495664_0021710 | Ga0495664_0021710_531_1850 | 420 |
| 273 | 3300046529 | Ga0495652_0077885 | Ga0495652_0077885_567_1886 | 420 |
| 274 | 3300046559 | Ga0495667_0104514 | Ga0495667_0104514_432_1697 | 420 |
| 275 | 3300046663 | Ga0495635_0091274 | Ga0495635_0091274_194_1513 | 420 |
| 276 | 3300046683 | Ga0495658_0139104 | Ga0495658_0139104_183_1448 | 420 |
| 277 | 3300046689 | Ga0495613_0038188 | Ga0495613_0038188_619_1938 | 420 |
| 278 | 3300050507 | nmdc:mga05p37_2212_c1 | nmdc:mga05p37_2212_c1_7448_8719 | 420 |
| 279 | 3300050508 | nmdc:mga09592_6462_c1 | nmdc:mga09592_6462_c1_5594_6865 | 420 |
| 280 | 3300050509 | nmdc:mga0qj67_18742_c1 | nmdc:mga0qj67_18742_c1_2679_3950 | 420 |
| 281 | 3300050511 | nmdc:mga08y16_3545_c1 | nmdc:mga08y16_3545_c1_13010_14281 | 420 |
| 282 | 3300050512 | nmdc:mga0n895_1869_c1 | nmdc:mga0n895_1869_c1_12001_13272 | 420 |
| 283 | 3300050513 | nmdc:mga0rr50_2956_c1 | nmdc:mga0rr50_2956_c1_7313_8584 | 420 |
| 284 | 3300050515 | nmdc:mga0a205_1191_c1 | nmdc:mga0a205_1191_c1_328_1599 | 420 |
| 285 | 3300053077 | Ga0495601_0002506 | Ga0495601_0002506_2960_4279 | 420 |
| 286 | 3300053078 | Ga0495612_0006674 | Ga0495612_0006674_621_1940 | 420 |
| 287 | 3300053085 | Ga0495619_0004938 | Ga0495619_0004938_1560_2879 | 420 |
| 288 | 3300053093 | Ga0500651_0051669 | Ga0500651_0051669_63_1331 | 420 |
| 289 | 2209111006 | 2214745219 | 2213754919 | 421 |
| 290 | 3300000041 | ARcpr5oldR_c000117 | ARcpr5oldR_00011718 | 421 |
| 291 | 3300000652 | ARCol0yngRDRAFT_1000003 | ARCol0yngRDRAFT_100000325 | 421 |
| 292 | 3300001989 | JGI24739J22299_10002682 | JGI24739J22299_100026822 | 421 |
| 293 | 3300001990 | JGI24737J22298_10000992 | JGI24737J22298_100009926 | 421 |
| 294 | 3300001990 | JGI24737J22298_10003261 | JGI24737J22298_100032614 | 421 |
| 295 | 3300002070 | JGI24750J21931_1000480 | JGI24750J21931_10004809 | 421 |
| 296 | 3300002073 | JGI24745J21846_1002842 | JGI24745J21846_10028422 | 421 |
| 297 | 3300002074 | JGI24748J21848_1000438 | JGI24748J21848_10004382 | 421 |
| 298 | 3300002075 | JGI24738J21930_10001848 | JGI24738J21930_100018481 | 421 |
| 299 | 3300002076 | JGI24749J21850_1000392 | JGI24749J21850_10003929 | 421 |
| 300 | 3300002077 | JGI24744J21845_10004046 | JGI24744J21845_100040462 | 421 |
| 301 | 3300002126 | JGI24035J26624_1000144 | JGI24035J26624_10001448 | 421 |
| 302 | 3300002239 | JGI24034J26672_10000590 | JGI24034J26672_100005907 | 421 |
| 303 | 3300002244 | JGI24742J22300_10000041 | JGI24742J22300_100000419 | 421 |
| 304 | 3300005277 | Ga0065716_1001888 | Ga0065716_10018882 | 421 |
| 305 | 3300005289 | Ga0065704_10080219 | Ga0065704_100802194 | 421 |
| 306 | 3300005290 | Ga0065712_10000247 | Ga0065712_100002478 | 421 |
| 307 | 3300005293 | Ga0065715_10003780 | Ga0065715_100037803 | 421 |
| 308 | 3300005293 | Ga0065715_10089103 | Ga0065715_100891039 | 421 |
| 309 | 3300005328 | Ga0070676_10000036 | Ga0070676_1000003627 | 421 |
| 310 | 3300005328 | Ga0070676_10066362 | Ga0070676_100663621 | 421 |
| 311 | 3300005329 | Ga0070683_100000898 | Ga0070683_1000008982 | 421 |
| 312 | 3300005329 | Ga0070683_100320775 | Ga0070683_1003207751 | 421 |
| 313 | 3300005330 | Ga0070690_100000402 | Ga0070690_10000040215 | 421 |
| 314 | 3300005330 | Ga0070690_100035779 | Ga0070690_1000357792 | 421 |
| 315 | 3300005330 | Ga0070690_100144204 | Ga0070690_1001442042 | 421 |
| 316 | 3300005331 | Ga0070670_100016727 | Ga0070670_1000167272 | 421 |
| 317 | 3300005331 | Ga0070670_100085242 | Ga0070670_1000852422 | 421 |
| 318 | 3300005333 | Ga0070677_10000124 | Ga0070677_1000012420 | 421 |
| 319 | 3300005334 | Ga0068869_100000087 | Ga0068869_10000008730 | 421 |
| 320 | 3300005335 | Ga0070666_10044947 | Ga0070666_100449474 | 421 |
| 321 | 3300005336 | Ga0070680_100066910 | Ga0070680_1000669102 | 421 |
| 322 | 3300005336 | Ga0070680_100073406 | Ga0070680_1000734062 | 421 |
| 323 | 3300005337 | Ga0070682_100000341 | Ga0070682_10000034116 | 421 |
| 324 | 3300005337 | Ga0070682_100022461 | Ga0070682_1000224612 | 421 |
| 325 | 3300005337 | Ga0070682_100132866 | Ga0070682_1001328662 | 421 |
| 326 | 3300005338 | Ga0068868_100007585 | Ga0068868_1000075854 | 421 |
| 327 | 3300005338 | Ga0068868_100023195 | Ga0068868_1000231954 | 421 |
| 328 | 3300005339 | Ga0070660_100076282 | Ga0070660_1000762822 | 421 |
| 329 | 3300005340 | Ga0070689_100002790 | Ga0070689_1000027903 | 421 |
| 330 | 3300005341 | Ga0070691_10004809 | Ga0070691_100048098 | 421 |
| 331 | 3300005341 | Ga0070691_10008048 | Ga0070691_100080482 | 421 |
| 332 | 3300005343 | Ga0070687_100005901 | Ga0070687_1000059014 | 421 |
| 333 | 3300005344 | Ga0070661_100000017 | Ga0070661_10000001795 | 421 |
| 334 | 3300005344 | Ga0070661_100063833 | Ga0070661_1000638333 | 421 |
| 335 | 3300005345 | Ga0070692_10000018 | Ga0070692_100000184 | 421 |
| 336 | 3300005347 | Ga0070668_100001356 | Ga0070668_1000013569 | 421 |
| 337 | 3300005347 | Ga0070668_100111063 | Ga0070668_1001110632 | 421 |
| 338 | 3300005353 | Ga0070669_100000217 | Ga0070669_10000021727 | 421 |
| 339 | 3300005354 | Ga0070675_100000088 | Ga0070675_10000008830 | 421 |
| 340 | 3300005354 | Ga0070675_100060091 | Ga0070675_1000600914 | 421 |
| 341 | 3300005355 | Ga0070671_100011124 | Ga0070671_1000111242 | 421 |
| 342 | 3300005355 | Ga0070671_100020068 | Ga0070671_1000200685 | 421 |
| 343 | 3300005355 | Ga0070671_100075228 | Ga0070671_1000752283 | 421 |
| 344 | 3300005364 | Ga0070673_100000239 | Ga0070673_10000023915 | 421 |
| 345 | 3300005364 | Ga0070673_100031259 | Ga0070673_1000312593 | 421 |
| 346 | 3300005365 | Ga0070688_100000084 | Ga0070688_10000008424 | 421 |
| 347 | 3300005365 | Ga0070688_100003883 | Ga0070688_1000038836 | 421 |
| 348 | 3300005365 | Ga0070688_100016483 | Ga0070688_1000164834 | 421 |
| 349 | 3300005367 | Ga0070667_100003023 | Ga0070667_10000302319 | 421 |
| 350 | 3300005367 | Ga0070667_100096956 | Ga0070667_1000969563 | 421 |
| 351 | 3300005406 | Ga0070703_10016932 | Ga0070703_100169322 | 421 |
| 352 | 3300005434 | Ga0070709_10000855 | Ga0070709_1000085517 | 421 |
| 353 | 3300005434 | Ga0070709_10004300 | Ga0070709_100043009 | 421 |
| 354 | 3300005434 | Ga0070709_10124055 | Ga0070709_101240551 | 421 |
| 355 | 3300005436 | Ga0070713_100002359 | Ga0070713_10000235915 | 421 |
| 356 | 3300005436 | Ga0070713_100004066 | Ga0070713_1000040663 | 421 |
| 357 | 3300005436 | Ga0070713_100031837 | Ga0070713_1000318372 | 421 |
| 358 | 3300005437 | Ga0070710_10003385 | Ga0070710_100033851 | 421 |
| 359 | 3300005437 | Ga0070710_10021169 | Ga0070710_100211691 | 421 |
| 360 | 3300005437 | Ga0070710_10029684 | Ga0070710_100296842 | 421 |
| 361 | 3300005438 | Ga0070701_10019817 | Ga0070701_100198172 | 421 |
| 362 | 3300005439 | Ga0070711_100077069 | Ga0070711_1000770692 | 421 |
| 363 | 3300005439 | Ga0070711_100137381 | Ga0070711_1001373812 | 421 |
| 364 | 3300005440 | Ga0070705_100000425 | Ga0070705_10000042519 | 421 |
| 365 | 3300005440 | Ga0070705_100076457 | Ga0070705_1000764572 | 421 |
| 366 | 3300005441 | Ga0070700_100000430 | Ga0070700_1000004302 | 421 |
| 367 | 3300005441 | Ga0070700_100034968 | Ga0070700_1000349682 | 421 |
| 368 | 3300005444 | Ga0070694_100000401 | Ga0070694_10000040120 | 421 |
| 369 | 3300005444 | Ga0070694_100010745 | Ga0070694_1000107453 | 421 |
| 370 | 3300005445 | Ga0070708_100026428 | Ga0070708_1000264284 | 421 |
| 371 | 3300005455 | Ga0070663_100032570 | Ga0070663_1000325703 | 421 |
| 372 | 3300005456 | Ga0070678_100000053 | Ga0070678_10000005331 | 421 |
| 373 | 3300005456 | Ga0070678_100022259 | Ga0070678_1000222593 | 421 |
| 374 | 3300005456 | Ga0070678_100030073 | Ga0070678_1000300731 | 421 |
| 375 | 3300005458 | Ga0070681_10000493 | Ga0070681_1000049319 | 421 |
| 376 | 3300005458 | Ga0070681_10013271 | Ga0070681_100132718 | 421 |
| 377 | 3300005459 | Ga0068867_100015926 | Ga0068867_1000159265 | 421 |
| 378 | 3300005466 | Ga0070685_10001195 | Ga0070685_100011959 | 421 |
| 379 | 3300005530 | Ga0070679_100000679 | Ga0070679_10000067919 | 421 |
| 380 | 3300005530 | Ga0070679_100042532 | Ga0070679_1000425325 | 421 |
| 381 | 3300005530 | Ga0070679_100122492 | Ga0070679_1001224922 | 421 |
| 382 | 3300005535 | Ga0070684_100000144 | Ga0070684_10000014449 | 421 |
| 383 | 3300005535 | Ga0070684_100174444 | Ga0070684_1001744441 | 421 |
| 384 | 3300005543 | Ga0070672_100000014 | Ga0070672_10000001449 | 421 |
| 385 | 3300005544 | Ga0070686_100002767 | Ga0070686_10000276711 | 421 |
| 386 | 3300005545 | Ga0070695_100000743 | Ga0070695_1000007436 | 421 |
| 387 | 3300005545 | Ga0070695_100007870 | Ga0070695_1000078704 | 421 |
| 388 | 3300005545 | Ga0070695_100065695 | Ga0070695_1000656951 | 421 |
| 389 | 3300005546 | Ga0070696_100000918 | Ga0070696_1000009186 | 421 |
| 390 | 3300005547 | Ga0070693_100000141 | Ga0070693_1000001416 | 421 |
| 391 | 3300005547 | Ga0070693_100058059 | Ga0070693_1000580592 | 421 |
| 392 | 3300005548 | Ga0070665_100069877 | Ga0070665_1000698772 | 421 |
| 393 | 3300005549 | Ga0070704_100008824 | Ga0070704_1000088244 | 421 |
| 394 | 3300005549 | Ga0070704_100014935 | Ga0070704_1000149352 | 421 |
| 395 | 3300005564 | Ga0070664_100038514 | Ga0070664_1000385142 | 421 |
| 396 | 3300005577 | Ga0068857_100001474 | Ga0068857_1000014742 | 421 |
| 397 | 3300005578 | Ga0068854_100000168 | Ga0068854_10000016819 | 421 |
| 398 | 3300005614 | Ga0068856_100000932 | Ga0068856_10000093212 | 421 |
| 399 | 3300005615 | Ga0070702_100019143 | Ga0070702_1000191433 | 421 |
| 400 | 3300005617 | Ga0068859_100071001 | Ga0068859_1000710012 | 421 |
| 401 | 3300005617 | Ga0068859_100093040 | Ga0068859_1000930402 | 421 |
| 402 | 3300005618 | Ga0068864_100088136 | Ga0068864_1000881362 | 421 |
| 403 | 3300005719 | Ga0068861_100000315 | Ga0068861_10000031516 | 421 |
| 404 | 3300005840 | Ga0068870_10000002 | Ga0068870_1000000255 | 421 |
| 405 | 3300005841 | Ga0068863_100067439 | Ga0068863_1000674392 | 421 |
| 406 | 3300005842 | Ga0068858_100000356 | Ga0068858_10000035625 | 421 |
| 407 | 3300005842 | Ga0068858_100059299 | Ga0068858_1000592994 | 421 |
| 408 | 3300005843 | Ga0068860_100000747 | Ga0068860_10000074719 | 421 |
| 409 | 3300005843 | Ga0068860_100315126 | Ga0068860_1003151262 | 421 |
| 410 | 3300005844 | Ga0068862_100000671 | Ga0068862_1000006712 | 421 |
| 411 | 3300005937 | Ga0081455_10000048 | Ga0081455_10000048133 | 421 |
| 412 | 3300006028 | Ga0070717_10003328 | Ga0070717_1000332810 | 421 |
| 413 | 3300006173 | Ga0070716_100002233 | Ga0070716_1000022334 | 421 |
| 414 | 3300006173 | Ga0070716_100031117 | Ga0070716_1000311174 | 421 |
| 415 | 3300006175 | Ga0070712_100046610 | Ga0070712_1000466102 | 421 |
| 416 | 3300006237 | Ga0097621_100000144 | Ga0097621_10000014416 | 421 |
| 417 | 3300006237 | Ga0097621_100008876 | Ga0097621_1000088763 | 421 |
| 418 | 3300006237 | Ga0097621_100026444 | Ga0097621_1000264442 | 421 |
| 419 | 3300006358 | Ga0068871_100000110 | Ga0068871_10000011030 | 421 |
| 420 | 3300006358 | Ga0068871_100015537 | Ga0068871_1000155375 | 421 |
| 421 | 3300006358 | Ga0068871_100108543 | Ga0068871_1001085432 | 421 |
| 422 | 3300006852 | Ga0075433_10179981 | Ga0075433_101799812 | 421 |
| 423 | 3300006871 | Ga0075434_100000084 | Ga0075434_10000008423 | 421 |
| 424 | 3300006881 | Ga0068865_100000066 | Ga0068865_10000006631 | 421 |
| 425 | 3300006881 | Ga0068865_100009015 | Ga0068865_1000090153 | 421 |
| 426 | 3300006914 | Ga0075436_100031219 | Ga0075436_1000312192 | 421 |
| 427 | 3300006931 | Ga0097620_100071001 | Ga0097620_1000710012 | 421 |
| 428 | 3300006931 | Ga0097620_100093043 | Ga0097620_1000930432 | 421 |
| 429 | 3300007076 | Ga0075435_100180757 | Ga0075435_1001807572 | 421 |
| 430 | 3300009011 | Ga0105251_10012262 | Ga0105251_100122622 | 421 |
| 431 | 3300009094 | Ga0111539_10000652 | Ga0111539_1000065218 | 421 |
| 432 | 3300009094 | Ga0111539_10001255 | Ga0111539_1000125514 | 421 |
| 433 | 3300009098 | Ga0105245_10000287 | Ga0105245_1000028730 | 421 |
| 434 | 3300009098 | Ga0105245_10038270 | Ga0105245_100382702 | 421 |
| 435 | 3300009101 | Ga0105247_10001223 | Ga0105247_1000122318 | 421 |
| 436 | 3300009101 | Ga0105247_10086615 | Ga0105247_100866151 | 421 |
| 437 | 3300009148 | Ga0105243_10000695 | Ga0105243_1000069514 | 421 |
| 438 | 3300009148 | Ga0105243_10013699 | Ga0105243_100136993 | 421 |
| 439 | 3300009174 | Ga0105241_10002331 | Ga0105241_1000233119 | 421 |
| 440 | 3300009174 | Ga0105241_10037102 | Ga0105241_100371022 | 421 |
| 441 | 3300009176 | Ga0105242_10000792 | Ga0105242_1000079216 | 421 |
| 442 | 3300009176 | Ga0105242_10006274 | Ga0105242_100062748 | 421 |
| 443 | 3300009176 | Ga0105242_10059085 | Ga0105242_100590854 | 421 |
| 444 | 3300009177 | Ga0105248_10000535 | Ga0105248_1000053550 | 421 |
| 445 | 3300009177 | Ga0105248_10065160 | Ga0105248_100651603 | 421 |
| 446 | 3300009545 | Ga0105237_10002795 | Ga0105237_1000279516 | 421 |
| 447 | 3300009551 | Ga0105238_10157027 | Ga0105238_101570272 | 421 |
| 448 | 3300009553 | Ga0105249_10000279 | Ga0105249_1000027932 | 421 |
| 449 | 3300009553 | Ga0105249_10361945 | Ga0105249_103619451 | 421 |
| 450 | 3300010375 | Ga0105239_10001686 | Ga0105239_1000168613 | 421 |
| 451 | 3300010375 | Ga0105239_10044533 | Ga0105239_100445336 | 421 |
| 452 | 3300010375 | Ga0105239_10074149 | Ga0105239_100741495 | 421 |
| 453 | 3300011119 | Ga0105246_10000095 | Ga0105246_1000009526 | 421 |
| 454 | 3300013102 | Ga0157371_10011031 | Ga0157371_100110319 | 421 |
| 455 | 3300013296 | Ga0157374_10001348 | Ga0157374_1000134820 | 421 |
| 456 | 3300013297 | Ga0157378_10000956 | Ga0157378_1000095631 | 421 |
| 457 | 3300013297 | Ga0157378_10094941 | Ga0157378_100949412 | 421 |
| 458 | 3300013306 | Ga0163162_10003795 | Ga0163162_100037956 | 421 |
| 459 | 3300013307 | Ga0157372_10009222 | Ga0157372_100092224 | 421 |
| 460 | 3300013307 | Ga0157372_10134988 | Ga0157372_101349884 | 421 |
| 461 | 3300013308 | Ga0157375_10000135 | Ga0157375_100001353 | 421 |
| 462 | 3300013308 | Ga0157375_10135433 | Ga0157375_101354334 | 421 |
| 463 | 3300014325 | Ga0163163_10124732 | Ga0163163_101247322 | 421 |
| 464 | 3300014326 | Ga0157380_10000052 | Ga0157380_1000005233 | 421 |
| 465 | 3300014745 | Ga0157377_10000076 | Ga0157377_1000007619 | 421 |
| 466 | 3300014968 | Ga0157379_10000060 | Ga0157379_1000006057 | 421 |
| 467 | 3300014968 | Ga0157379_10007831 | Ga0157379_1000783111 | 421 |
| 468 | 3300014968 | Ga0157379_10026823 | Ga0157379_100268232 | 421 |
| 469 | 3300014969 | Ga0157376_10000141 | Ga0157376_1000014128 | 421 |
| 470 | 3300017792 | Ga0163161_10026256 | Ga0163161_100262565 | 421 |
| 471 | 3300025271 | Ga0207666_1000005 | Ga0207666_100000532 | 421 |
| 472 | 3300025271 | Ga0207666_1000330 | Ga0207666_10003305 | 421 |
| 473 | 3300025290 | Ga0207673_1000002 | Ga0207673_100000212 | 421 |
| 474 | 3300025315 | Ga0207697_10000011 | Ga0207697_1000001120 | 421 |
| 475 | 3300025885 | Ga0207653_10007931 | Ga0207653_100079315 | 421 |
| 476 | 3300025893 | Ga0207682_10000051 | Ga0207682_1000005138 | 421 |
| 477 | 3300025898 | Ga0207692_10005372 | Ga0207692_100053724 | 421 |
| 478 | 3300025898 | Ga0207692_10028543 | Ga0207692_100285431 | 421 |
| 479 | 3300025899 | Ga0207642_10000229 | Ga0207642_1000022915 | 421 |
| 480 | 3300025900 | Ga0207710_10001284 | Ga0207710_1000128417 | 421 |
| 481 | 3300025901 | Ga0207688_10000001 | Ga0207688_1000000138 | 421 |
| 482 | 3300025901 | Ga0207688_10009124 | Ga0207688_100091243 | 421 |
| 483 | 3300025903 | Ga0207680_10029075 | Ga0207680_100290755 | 421 |
| 484 | 3300025904 | Ga0207647_10001714 | Ga0207647_1000171420 | 421 |
| 485 | 3300025904 | Ga0207647_10007690 | Ga0207647_100076907 | 421 |
| 486 | 3300025905 | Ga0207685_10004129 | Ga0207685_100041292 | 421 |
| 487 | 3300025906 | Ga0207699_10001161 | Ga0207699_100011616 | 421 |
| 488 | 3300025907 | Ga0207645_10000121 | Ga0207645_1000012114 | 421 |
| 489 | 3300025907 | Ga0207645_10023325 | Ga0207645_100233256 | 421 |
| 490 | 3300025907 | Ga0207645_10086216 | Ga0207645_100862162 | 421 |
| 491 | 3300025908 | Ga0207643_10000009 | Ga0207643_1000000999 | 421 |
| 492 | 3300025911 | Ga0207654_10043742 | Ga0207654_100437424 | 421 |
| 493 | 3300025912 | Ga0207707_10000840 | Ga0207707_1000084019 | 421 |
| 494 | 3300025912 | Ga0207707_10026208 | Ga0207707_100262084 | 421 |
| 495 | 3300025915 | Ga0207693_10003131 | Ga0207693_1000313112 | 421 |
| 496 | 3300025915 | Ga0207693_10058351 | Ga0207693_100583512 | 421 |
| 497 | 3300025916 | Ga0207663_10015462 | Ga0207663_100154622 | 421 |
| 498 | 3300025917 | Ga0207660_10021268 | Ga0207660_100212686 | 421 |
| 499 | 3300025917 | Ga0207660_10180614 | Ga0207660_101806142 | 421 |
| 500 | 3300025918 | Ga0207662_10000120 | Ga0207662_100001208 | 421 |
| 501 | 3300025918 | Ga0207662_10001791 | Ga0207662_100017917 | 421 |
| 502 | 3300025919 | Ga0207657_10002826 | Ga0207657_100028269 | 421 |
| 503 | 3300025919 | Ga0207657_10004971 | Ga0207657_100049718 | 421 |
| 504 | 3300025919 | Ga0207657_10081532 | Ga0207657_100815321 | 421 |
| 505 | 3300025920 | Ga0207649_10000052 | Ga0207649_1000005231 | 421 |
| 506 | 3300025921 | Ga0207652_10000508 | Ga0207652_1000050815 | 421 |
| 507 | 3300025921 | Ga0207652_10016692 | Ga0207652_100166929 | 421 |
| 508 | 3300025921 | Ga0207652_10098796 | Ga0207652_100987963 | 421 |
| 509 | 3300025923 | Ga0207681_10000035 | Ga0207681_10000035108 | 421 |
| 510 | 3300025924 | Ga0207694_10172192 | Ga0207694_101721921 | 421 |
| 511 | 3300025925 | Ga0207650_10000843 | Ga0207650_1000084315 | 421 |
| 512 | 3300025925 | Ga0207650_10078480 | Ga0207650_100784802 | 421 |
| 513 | 3300025926 | Ga0207659_10000027 | Ga0207659_1000002730 | 421 |
| 514 | 3300025927 | Ga0207687_10000231 | Ga0207687_1000023114 | 421 |
| 515 | 3300025927 | Ga0207687_10012582 | Ga0207687_100125823 | 421 |
| 516 | 3300025928 | Ga0207700_10000917 | Ga0207700_1000091718 | 421 |
| 517 | 3300025928 | Ga0207700_10021942 | Ga0207700_100219422 | 421 |
| 518 | 3300025931 | Ga0207644_10007559 | Ga0207644_100075594 | 421 |
| 519 | 3300025932 | Ga0207690_10000056 | Ga0207690_100000567 | 421 |
| 520 | 3300025932 | Ga0207690_10017319 | Ga0207690_100173193 | 421 |
| 521 | 3300025933 | Ga0207706_10000261 | Ga0207706_1000026134 | 421 |
| 522 | 3300025933 | Ga0207706_10004416 | Ga0207706_1000441614 | 421 |
| 523 | 3300025933 | Ga0207706_10014945 | Ga0207706_100149455 | 421 |
| 524 | 3300025934 | Ga0207686_10000171 | Ga0207686_1000017128 | 421 |
| 525 | 3300025934 | Ga0207686_10011564 | Ga0207686_100115645 | 421 |
| 526 | 3300025935 | Ga0207709_10000087 | Ga0207709_10000087110 | 421 |
| 527 | 3300025936 | Ga0207670_10000169 | Ga0207670_1000016929 | 421 |
| 528 | 3300025936 | Ga0207670_10017561 | Ga0207670_100175613 | 421 |
| 529 | 3300025937 | Ga0207669_10000351 | Ga0207669_100003516 | 421 |
| 530 | 3300025938 | Ga0207704_10000134 | Ga0207704_1000013434 | 421 |
| 531 | 3300025939 | Ga0207665_10000333 | Ga0207665_1000033312 | 421 |
| 532 | 3300025940 | Ga0207691_10000106 | Ga0207691_1000010646 | 421 |
| 533 | 3300025941 | Ga0207711_10086244 | Ga0207711_100862442 | 421 |
| 534 | 3300025941 | Ga0207711_10107904 | Ga0207711_101079043 | 421 |
| 535 | 3300025942 | Ga0207689_10000031 | Ga0207689_1000003117 | 421 |
| 536 | 3300025942 | Ga0207689_10031849 | Ga0207689_100318495 | 421 |
| 537 | 3300025944 | Ga0207661_10000219 | Ga0207661_1000021914 | 421 |
| 538 | 3300025949 | Ga0207667_10039261 | Ga0207667_100392612 | 421 |
| 539 | 3300025960 | Ga0207651_10010392 | Ga0207651_100103924 | 421 |
| 540 | 3300025960 | Ga0207651_10072873 | Ga0207651_100728732 | 421 |
| 541 | 3300025960 | Ga0207651_10099361 | Ga0207651_100993612 | 421 |
| 542 | 3300025961 | Ga0207712_10000176 | Ga0207712_1000017629 | 421 |
| 543 | 3300025961 | Ga0207712_10012238 | Ga0207712_100122382 | 421 |
| 544 | 3300025972 | Ga0207668_10000191 | Ga0207668_1000019128 | 421 |
| 545 | 3300025972 | Ga0207668_10115042 | Ga0207668_101150422 | 421 |
| 546 | 3300025981 | Ga0207640_10000126 | Ga0207640_1000012619 | 421 |
| 547 | 3300025986 | Ga0207658_10001331 | Ga0207658_1000133114 | 421 |
| 548 | 3300025986 | Ga0207658_10047022 | Ga0207658_100470223 | 421 |
| 549 | 3300025986 | Ga0207658_10071512 | Ga0207658_100715123 | 421 |
| 550 | 3300026023 | Ga0207677_10004460 | Ga0207677_100044603 | 421 |
| 551 | 3300026035 | Ga0207703_10007278 | Ga0207703_100072787 | 421 |
| 552 | 3300026035 | Ga0207703_10060365 | Ga0207703_100603652 | 421 |
| 553 | 3300026041 | Ga0207639_10000515 | Ga0207639_100005156 | 421 |
| 554 | 3300026041 | Ga0207639_10107499 | Ga0207639_101074992 | 421 |
| 555 | 3300026067 | Ga0207678_10000137 | Ga0207678_1000013746 | 421 |
| 556 | 3300026067 | Ga0207678_10019341 | Ga0207678_100193411 | 421 |
| 557 | 3300026067 | Ga0207678_10097972 | Ga0207678_100979722 | 421 |
| 558 | 3300026075 | Ga0207708_10000250 | Ga0207708_1000025014 | 421 |
| 559 | 3300026075 | Ga0207708_10004369 | Ga0207708_100043695 | 421 |
| 560 | 3300026078 | Ga0207702_10001067 | Ga0207702_1000106717 | 421 |
| 561 | 3300026088 | Ga0207641_10000937 | Ga0207641_1000093731 | 421 |
| 562 | 3300026089 | Ga0207648_10000125 | Ga0207648_1000012546 | 421 |
| 563 | 3300026089 | Ga0207648_10012120 | Ga0207648_100121202 | 421 |
| 564 | 3300026095 | Ga0207676_10001547 | Ga0207676_1000154719 | 421 |
| 565 | 3300026116 | Ga0207674_10000095 | Ga0207674_1000009569 | 421 |
| 566 | 3300026118 | Ga0207675_100000140 | Ga0207675_10000014046 | 421 |
| 567 | 3300026118 | Ga0207675_100010192 | Ga0207675_1000101924 | 421 |
| 568 | 3300026121 | Ga0207683_10000178 | Ga0207683_1000017834 | 421 |
| 569 | 3300026121 | Ga0207683_10001447 | Ga0207683_100014479 | 421 |
| 570 | 3300026142 | Ga0207698_10001736 | Ga0207698_1000173617 | 421 |
| 571 | 3300027617 | Ga0210002_1002682 | Ga0210002_10026822 | 421 |
| 572 | 3300027682 | Ga0209971_1003367 | Ga0209971_10033672 | 421 |
| 573 | 3300027717 | Ga0209998_10000790 | Ga0209998_100007907 | 421 |
| 574 | 3300027717 | Ga0209998_10001828 | Ga0209998_100018284 | 421 |
| 575 | 3300027876 | Ga0209974_10005676 | Ga0209974_100056762 | 421 |
| 576 | 3300027876 | Ga0209974_10019463 | Ga0209974_100194632 | 421 |
| 577 | 3300027907 | Ga0207428_10000037 | Ga0207428_10000037132 | 421 |
| 578 | 3300027907 | Ga0207428_10001468 | Ga0207428_1000146825 | 421 |
| 579 | 3300028379 | Ga0268266_10025953 | Ga0268266_100259533 | 421 |
| 580 | 3300028380 | Ga0268265_10000774 | Ga0268265_1000077416 | 421 |
| 581 | 3300028381 | Ga0268264_10000467 | Ga0268264_1000046734 | 421 |
| 582 | 3300031241 | Ga0265325_10000049 | Ga0265325_1000004983 | 421 |
| 583 | 3300031595 | Ga0265313_10036963 | Ga0265313_100369634 | 421 |
| 584 | 3300034816 | Ga0373930_0000027 | Ga0373930_0000027_4716_5981 | 421 |
| 585 | 3300034817 | Ga0373948_0000240 | Ga0373948_0000240_3409_4674 | 421 |
| 586 | 3300034818 | Ga0373950_0001487 | Ga0373950_0001487_1040_2305 | 421 |
| 587 | 3300034819 | Ga0373958_0000799 | Ga0373958_0000799_213_1478 | 421 |
| 588 | 3300034819 | Ga0373958_0001378 | Ga0373958_0001378_705_1970 | 421 |
| 589 | 3300034957 | Ga0373938_0000020 | Ga0373938_0000020_7400_8665 | 421 |
| 590 | 3300034957 | Ga0373938_0000482 | Ga0373938_0000482_2087_3352 | 421 |
| 591 | 3300035084 | Ga0373928_0001620 | Ga0373928_0001620_1064_2329 | 421 |
| 592 | 3300035084 | Ga0373928_0003098 | Ga0373928_0003098_1256_2521 | 421 |
| 593 | 3300035084 | Ga0373928_0004039 | Ga0373928_0004039_1418_2686 | 421 |
| 594 | 3300035085 | Ga0373929_0001458 | Ga0373929_0001458_2932_4197 | 421 |
| 595 | 3300035090 | Ga0373949_0000753 | Ga0373949_0000753_1762_3027 | 421 |
| 596 | 3300035090 | Ga0373949_0004305 | Ga0373949_0004305_1239_2504 | 421 |
| 597 | 3300035091 | Ga0373951_0001531 | Ga0373951_0001531_424_1689 | 421 |
| 598 | 3300035091 | Ga0373951_0006562 | Ga0373951_0006562_691_1959 | 421 |
| 599 | 3300035092 | Ga0373952_0000597 | Ga0373952_0000597_2674_3939 | 421 |
| 600 | 3300035092 | Ga0373952_0001351 | Ga0373952_0001351_1748_3013 | 421 |
| 601 | 3300035112 | Ga0373932_0000316 | Ga0373932_0000316_3565_4830 | 421 |
| 602 | 3300035114 | Ga0373939_0000429 | Ga0373939_0000429_2205_3470 | 421 |
| 603 | 3300035115 | Ga0373941_0000341 | Ga0373941_0000341_7686_8951 | 421 |
| 604 | 3300035115 | Ga0373941_0001140 | Ga0373941_0001140_1363_2628 | 421 |
| 605 | 3300035117 | Ga0373953_0006441 | Ga0373953_0006441_1836_3104 | 421 |
| 606 | 3300035118 | Ga0373954_0008900 | Ga0373954_0008900_1183_2451 | 421 |
| 607 | 3300035119 | Ga0373956_0005690 | Ga0373956_0005690_3451_4719 | 421 |
| 608 | 3300035121 | Ga0373960_0000127 | Ga0373960_0000127_5809_7074 | 421 |
| 609 | 3300035121 | Ga0373960_0000335 | Ga0373960_0000335_6072_7337 | 421 |
| 610 | 3300035121 | Ga0373960_0004580 | Ga0373960_0004580_1651_2919 | 421 |
| 611 | 3300035207 | Ga0373942_0000054 | Ga0373942_0000054_11984_13249 | 421 |
| 612 | 3300035207 | Ga0373942_0015211 | Ga0373942_0015211_22_1290 | 421 |
| 613 | 3300035241 | Ga0373961_0000807 | Ga0373961_0000807_8169_9434 | 421 |
| 614 | 3300035241 | Ga0373961_0004284 | Ga0373961_0004284_678_1943 | 421 |
| 615 | 3300035242 | Ga0373962_0000497 | Ga0373962_0000497_908_2173 | 421 |
| 616 | 3300035242 | Ga0373962_0001528 | Ga0373962_0001528_1106_2371 | 421 |
| 617 | 3300035410 | Ga0373924_0008024 | Ga0373924_0008024_593_1861 | 421 |
| 618 | 3300035691 | Ga0373931_0001604 | Ga0373931_0001604_2338_3603 | 421 |
| 619 | 3300035691 | Ga0373931_0003983 | Ga0373931_0003983_4283_5548 | 421 |
| 620 | 3300035691 | Ga0373931_0004569 | Ga0373931_0004569_1506_2774 | 421 |
| 621 | 3300035692 | Ga0373935_0004548 | Ga0373935_0004548_4102_5370 | 421 |
| 622 | 3300035692 | Ga0373935_0035574 | Ga0373935_0035574_756_2024 | 421 |
| 623 | 3300035695 | Ga0373927_0017601 | Ga0373927_0017601_2625_3893 | 421 |
| 624 | 3300035724 | Ga0373933_0002449 | Ga0373933_0002449_6812_8080 | 421 |
| 625 | 3300035725 | Ga0373947_0005403 | Ga0373947_0005403_5586_6854 | 421 |
| 626 | 3300036401 | Ga0373937_0002996 | Ga0373937_0002996_6692_7960 | 421 |
| 627 | 3300037068 | Ga0373925_0025234 | Ga0373925_0025234_552_1820 | 421 |
| 628 | 3300045051 | Ga0451576_0010925 | Ga0451576_0010925_3772_5037 | 421 |
| 629 | 3300046454 | Ga0495592_0001840 | Ga0495592_0001840_7240_8508 | 421 |
| 630 | 3300046454 | Ga0495592_0010619 | Ga0495592_0010619_3538_4806 | 421 |
| 631 | 3300046455 | Ga0495603_0011026 | Ga0495603_0011026_2332_3600 | 421 |
| 632 | 3300046455 | Ga0495603_0051357 | Ga0495603_0051357_344_1612 | 421 |
| 633 | 3300046459 | Ga0495629_0000269 | Ga0495629_0000269_14559_15827 | 421 |
| 634 | 3300046459 | Ga0495629_0089738 | Ga0495629_0089738_793_2064 | 421 |
| 635 | 3300046462 | Ga0495651_0005718 | Ga0495651_0005718_6217_7485 | 421 |
| 636 | 3300046462 | Ga0495651_0010406 | Ga0495651_0010406_4800_6068 | 421 |
| 637 | 3300046462 | Ga0495651_0014281 | Ga0495651_0014281_747_2015 | 421 |
| 638 | 3300046463 | Ga0495653_0010063 | Ga0495653_0010063_3625_4893 | 421 |
| 639 | 3300046463 | Ga0495653_0030364 | Ga0495653_0030364_2076_3344 | 421 |
| 640 | 3300046473 | Ga0495582_0003928 | Ga0495582_0003928_1537_2805 | 421 |
| 641 | 3300046477 | Ga0495664_0010264 | Ga0495664_0010264_679_1947 | 421 |
| 642 | 3300046477 | Ga0495664_0012784 | Ga0495664_0012784_262_1530 | 421 |
| 643 | 3300046491 | Ga0495584_0021696 | Ga0495584_0021696_1764_3029 | 421 |
| 644 | 3300046492 | Ga0495585_0001825 | Ga0495585_0001825_8016_9284 | 421 |
| 645 | 3300046499 | Ga0495594_0009788 | Ga0495594_0009788_2346_3614 | 421 |
| 646 | 3300046501 | Ga0495607_0040121 | Ga0495607_0040121_236_1504 | 421 |
| 647 | 3300046511 | Ga0495608_0001268 | Ga0495608_0001268_12029_13297 | 421 |
| 648 | 3300046511 | Ga0495608_0006562 | Ga0495608_0006562_6110_7378 | 421 |
| 649 | 3300046511 | Ga0495608_0016256 | Ga0495608_0016256_3810_5078 | 421 |
| 650 | 3300046514 | Ga0495618_0088979 | Ga0495618_0088979_188_1456 | 421 |
| 651 | 3300046516 | Ga0495628_0005226 | Ga0495628_0005226_3908_5176 | 421 |
| 652 | 3300046516 | Ga0495628_0007947 | Ga0495628_0007947_250_1518 | 421 |
| 653 | 3300046516 | Ga0495628_0012576 | Ga0495628_0012576_3241_4509 | 421 |
| 654 | 3300046517 | Ga0495630_0025455 | Ga0495630_0025455_2972_4240 | 421 |
| 655 | 3300046523 | Ga0495644_0000494 | Ga0495644_0000494_1602_2870 | 421 |
| 656 | 3300046526 | Ga0495666_0019704 | Ga0495666_0019704_2064_3332 | 421 |
| 657 | 3300046529 | Ga0495652_0061818 | Ga0495652_0061818_1390_2658 | 421 |
| 658 | 3300046533 | Ga0495640_0006352 | Ga0495640_0006352_2056_3324 | 421 |
| 659 | 3300046535 | Ga0495586_0011910 | Ga0495586_0011910_2623_3891 | 421 |
| 660 | 3300046536 | Ga0495587_0000620 | Ga0495587_0000620_13136_14404 | 421 |
| 661 | 3300046536 | Ga0495587_0010054 | Ga0495587_0010054_4645_5913 | 421 |
| 662 | 3300046543 | Ga0495645_0000848 | Ga0495645_0000848_9461_10729 | 421 |
| 663 | 3300046543 | Ga0495645_0008343 | Ga0495645_0008343_5437_6705 | 421 |
| 664 | 3300046558 | Ga0495633_0001631 | Ga0495633_0001631_8022_9290 | 421 |
| 665 | 3300046559 | Ga0495667_0001254 | Ga0495667_0001254_2951_4219 | 421 |
| 666 | 3300046615 | Ga0495656_0000749 | Ga0495656_0000749_392_1660 | 421 |
| 667 | 3300046642 | Ga0495634_0019712 | Ga0495634_0019712_2951_4219 | 421 |
| 668 | 3300046663 | Ga0495635_0005437 | Ga0495635_0005437_1905_3173 | 421 |
| 669 | 3300046663 | Ga0495635_0036531 | Ga0495635_0036531_1023_2291 | 421 |
| 670 | 3300046663 | Ga0495635_0090897 | Ga0495635_0090897_483_1754 | 421 |
| 671 | 3300046664 | Ga0495659_0018184 | Ga0495659_0018184_293_1561 | 421 |
| 672 | 3300046665 | Ga0495661_0050032 | Ga0495661_0050032_1158_2426 | 421 |
| 673 | 3300046674 | Ga0495588_0007720 | Ga0495588_0007720_593_1861 | 421 |
| 674 | 3300046675 | Ga0495657_0002939 | Ga0495657_0002939_5625_6893 | 421 |
| 675 | 3300046678 | Ga0495599_0003832 | Ga0495599_0003832_250_1518 | 421 |
| 676 | 3300046679 | Ga0495623_0026867 | Ga0495623_0026867_1869_3137 | 421 |
| 677 | 3300046680 | Ga0495646_0000856 | Ga0495646_0000856_2856_4124 | 421 |
| 678 | 3300046681 | Ga0495647_0012435 | Ga0495647_0012435_1273_2541 | 421 |
| 679 | 3300046683 | Ga0495658_0004553 | Ga0495658_0004553_4045_5313 | 421 |
| 680 | 3300046689 | Ga0495613_0015225 | Ga0495613_0015225_3492_4760 | 421 |
| 681 | 3300046690 | Ga0495624_0040542 | Ga0495624_0040542_1024_2292 | 421 |
| 682 | 3300046691 | Ga0495670_0001311 | Ga0495670_0001311_8240_9508 | 421 |
| 683 | 3300046809 | Ga0495600_0019144 | Ga0495600_0019144_1132_2400 | 421 |
| 684 | 3300046809 | Ga0495600_0058956 | Ga0495600_0058956_143_1411 | 421 |
| 685 | 3300047317 | Ga0495604_0005959 | Ga0495604_0005959_1869_3137 | 421 |
| 686 | 3300047317 | Ga0495604_0027617 | Ga0495604_0027617_1601_2869 | 421 |
| 687 | 3300047319 | Ga0495674_0005637 | Ga0495674_0005637_2994_4262 | 421 |
| 688 | 3300047321 | Ga0495676_0034516 | Ga0495676_0034516_2594_3862 | 421 |
| 689 | 3300047321 | Ga0495676_0120584 | Ga0495676_0120584_42_1310 | 421 |
| 690 | 3300047322 | Ga0495680_0001472 | Ga0495680_0001472_11717_12985 | 421 |
| 691 | 3300047322 | Ga0495680_0006777 | Ga0495680_0006777_7351_8619 | 421 |
| 692 | 3300047322 | Ga0495680_0018210 | Ga0495680_0018210_861_2129 | 421 |
| 693 | 3300047444 | Ga0495675_0018016 | Ga0495675_0018016_3072_4340 | 421 |
| 694 | 3300047471 | Ga0495684_0015113 | Ga0495684_0015113_1731_2999 | 421 |
| 695 | 3300047673 | Ga0495593_0009204 | Ga0495593_0009204_3216_4484 | 421 |
| 696 | 3300047673 | Ga0495593_0080823 | Ga0495593_0080823_358_1626 | 421 |
| 697 | 3300048088 | Ga0495602_0002664 | Ga0495602_0002664_4768_6036 | 421 |
| 698 | 3300048088 | Ga0495602_0013607 | Ga0495602_0013607_4491_5759 | 421 |
| 699 | 3300048903 | Ga0496100_0000713 | Ga0496100_0000713_11344_12609 | 421 |
| 700 | 3300048903 | Ga0496100_0006554 | Ga0496100_0006554_3554_4822 | 421 |
| 701 | 3300048904 | Ga0496101_0000151 | Ga0496101_0000151_45072_46337 | 421 |
| 702 | 3300048904 | Ga0496101_0007659 | Ga0496101_0007659_3559_4827 | 421 |
| 703 | 3300048904 | Ga0496101_0016572 | Ga0496101_0016572_235_1503 | 421 |
| 704 | 3300048905 | Ga0496102_0001766 | Ga0496102_0001766_1035_2300 | 421 |
| 705 | 3300048905 | Ga0496102_0016358 | Ga0496102_0016358_3128_4396 | 421 |
| 706 | 3300048905 | Ga0496102_0048953 | Ga0496102_0048953_712_1977 | 421 |
| 707 | 3300048905 | Ga0496102_0070115 | Ga0496102_0070115_1198_2466 | 421 |
| 708 | 3300048906 | Ga0496103_0000589 | Ga0496103_0000589_25488_26753 | 421 |
| 709 | 3300048907 | Ga0496104_0000215 | Ga0496104_0000215_21847_23115 | 421 |
| 710 | 3300048907 | Ga0496104_0005956 | Ga0496104_0005956_7288_8556 | 421 |
| 711 | 3300048908 | Ga0496105_0007651 | Ga0496105_0007651_3574_4842 | 421 |
| 712 | 3300048908 | Ga0496105_0020355 | Ga0496105_0020355_1173_2441 | 421 |
| 713 | 3300048909 | Ga0496106_0000347 | Ga0496106_0000347_29068_30333 | 421 |
| 714 | 3300048909 | Ga0496106_0019937 | Ga0496106_0019937_3017_4285 | 421 |
| 715 | 3300048909 | Ga0496106_0021616 | Ga0496106_0021616_741_2006 | 421 |
| 716 | 3300048909 | Ga0496106_0146486 | Ga0496106_0146486_361_1629 | 421 |
| 717 | 3300048910 | Ga0496107_0000959 | Ga0496107_0000959_11502_12767 | 421 |
| 718 | 3300048910 | Ga0496107_0019768 | Ga0496107_0019768_1363_2631 | 421 |
| 719 | 3300048911 | Ga0496108_0007921 | Ga0496108_0007921_4995_6260 | 421 |
| 720 | 3300048911 | Ga0496108_0056436 | Ga0496108_0056436_791_2059 | 421 |
| 721 | 3300048912 | Ga0496109_0000186 | Ga0496109_0000186_52066_53331 | 421 |
| 722 | 3300048912 | Ga0496109_0176532 | Ga0496109_0176532_470_1738 | 421 |
| 723 | 3300048913 | Ga0496110_0020387 | Ga0496110_0020387_1442_2707 | 421 |
| 724 | 3300048913 | Ga0496110_0022488 | Ga0496110_0022488_1064_2332 | 421 |
| 725 | 3300048914 | Ga0496111_0083807 | Ga0496111_0083807_212_1480 | 421 |
| 726 | 3300048917 | Ga0496114_0076223 | Ga0496114_0076223_1033_2301 | 421 |
| 727 | 3300048918 | Ga0496115_0007404 | Ga0496115_0007404_4859_6124 | 421 |
| 728 | 3300048918 | Ga0496115_0013246 | Ga0496115_0013246_3845_5113 | 421 |
| 729 | 3300048918 | Ga0496115_0073757 | Ga0496115_0073757_787_2055 | 421 |
| 730 | 3300048918 | Ga0496115_0099732 | Ga0496115_0099732_601_1869 | 421 |
| 731 | 3300049568 | Ga0501031_0002359 | Ga0501031_0002359_2238_3524 | 421 |
| 732 | 3300049569 | Ga0501032_0016805 | Ga0501032_0016805_2200_3486 | 421 |
| 733 | 3300049570 | Ga0501033_0018743 | Ga0501033_0018743_2112_3398 | 421 |
| 734 | 3300049572 | Ga0501036_0050405 | Ga0501036_0050405_1926_3212 | 421 |
| 735 | 3300049573 | Ga0501037_0035553 | Ga0501037_0035553_2036_3322 | 421 |
| 736 | 3300049574 | Ga0501038_0032902 | Ga0501038_0032902_1900_3186 | 421 |
| 737 | 3300049575 | Ga0501039_0047666 | Ga0501039_0047666_1609_2895 | 421 |
| 738 | 3300049581 | Ga0501047_0019730 | Ga0501047_0019730_1324_2610 | 421 |
| 739 | 3300049822 | Ga0501035_0168441 | Ga0501035_0168441_179_1465 | 421 |
| 740 | 3300050494 | nmdc:mga06z11_13108_c1 | nmdc:mga06z11_13108_c1_1760_3025 | 421 |
| 741 | 3300050511 | nmdc:mga08y16_1219_c1 | nmdc:mga08y16_1219_c1_14372_15637 | 421 |
| 742 | 3300050511 | nmdc:mga08y16_311_c1 | nmdc:mga08y16_311_c1_21181_22446 | 421 |
| 743 | 3300050512 | nmdc:mga0n895_62_c1 | nmdc:mga0n895_62_c1_49461_50726 | 421 |
| 744 | 3300050514 | nmdc:mga08x19_27777_c1 | nmdc:mga08x19_27777_c1_2034_3302 | 421 |
| 745 | 3300050515 | nmdc:mga0a205_2311_c1 | nmdc:mga0a205_2311_c1_8923_10188 | 421 |
| 746 | 3300053077 | Ga0495601_0000109 | Ga0495601_0000109_37733_39001 | 421 |
| 747 | 3300053077 | Ga0495601_0006125 | Ga0495601_0006125_2993_4261 | 421 |
| 748 | 3300053077 | Ga0495601_0009758 | Ga0495601_0009758_4347_5618 | 421 |
| 749 | 3300053078 | Ga0495612_0000953 | Ga0495612_0000953_6440_7708 | 421 |
| 750 | 3300053078 | Ga0495612_0002655 | Ga0495612_0002655_541_1809 | 421 |
| 751 | 3300053084 | Ga0495595_0001271 | Ga0495595_0001271_2726_3994 | 421 |
| 752 | 3300053084 | Ga0495595_0005318 | Ga0495595_0005318_871_2139 | 421 |
| 753 | 3300053084 | Ga0495595_0005872 | Ga0495595_0005872_963_2234 | 421 |
| 754 | 3300053084 | Ga0495595_0026712 | Ga0495595_0026712_1160_2428 | 421 |
| 755 | 3300053085 | Ga0495619_0000289 | Ga0495619_0000289_29630_30898 | 421 |
| 756 | 3300053085 | Ga0495619_0000662 | Ga0495619_0000662_18504_19775 | 421 |
| 757 | 3300053085 | Ga0495619_0002507 | Ga0495619_0002507_8896_10164 | 421 |
| 758 | 3300053085 | Ga0495619_0003722 | Ga0495619_0003722_8433_9701 | 421 |
| 759 | 3300053085 | Ga0495619_0007879 | Ga0495619_0007879_5223_6491 | 421 |
| 760 | 3300053730 | Ga0500645_000101 | Ga0500645_000101_28294_29565 | 421 |
| 761 | 3300054114 | Ga0501084_0067012 | Ga0501084_0067012_519_1784 | 421 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2c1d-assembly4.cif.gz_G | crystal structure of soxxa from p. pantotrophus | 0.897 | 209 | 421 |
| 1h31-assembly3.cif.gz_E | oxidised soxax complex from rhodovulum sulfidophilum | 0.8747 | 209 | 421 |
| 3ocd-assembly2.cif.gz_C | diheme soxax - c236m mutant | 0.8158 | 211 | 420 |
| 3oa8-assembly1.cif.gz_E | diheme soxax | 0.809 | 211 | 420 |
| 3oa8-assembly1.cif.gz_B | diheme soxax | 0.7765 | 79 | 177 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2c1dG02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.8529 | 214 | 301 | 1.10.760.10 |
| 2c1dG02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.8358 | 214 | 301 | 1.10.760.10 |
| 4wqaA01 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7894 | 213 | 309 | 1.10.760.10 |
| 3oa8D00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7751 | 79 | 177 | 1.10.760.10 |
| 3oa8E01 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7697 | 299 | 420 | 1.10.760.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537N8W6-F1-model_v4 | L-cysteine S-thiosulfotransferase subunit SoxA (EC 2.8.5.2) (Protein SoxA) (SoxAX cytochrome complex subunit A) (Sulfur oxidizing protein A) (Thiosulfate-oxidizing multienzyme system protein SoxA) | 0.9522 | 38 | 421 |
GO:0009055
GO:0016669 GO:0016740 GO:0019417 GO:0020037 GO:0042597 GO:0046872 GO:0070069 |
| AF-A0A537N8W6-F1-model_v4 | L-cysteine S-thiosulfotransferase subunit SoxA (EC 2.8.5.2) (Protein SoxA) (SoxAX cytochrome complex subunit A) (Sulfur oxidizing protein A) (Thiosulfate-oxidizing multienzyme system protein SoxA) | 0.9497 | 38 | 421 |
GO:0009055
GO:0016669 GO:0016740 GO:0019417 GO:0020037 GO:0042597 GO:0046872 GO:0070069 |
| AF-A0A2V6TWF3-F1-model_v4 | L-cysteine S-thiosulfotransferase subunit SoxA (EC 2.8.5.2) | 0.928 | 251 | 421 |
GO:0009055
GO:0016669 GO:0016740 GO:0019417 GO:0020037 GO:0042597 GO:0046872 GO:0070069 |
| AF-A0A7C5S9B2-F1-model_v4 | L-cysteine S-thiosulfotransferase subunit SoxA (EC 2.8.5.2) | 0.9244 | 209 | 421 |
GO:0009055
GO:0016669 GO:0016740 GO:0019417 GO:0020037 GO:0042597 GO:0046872 GO:0070069 |
| AF-A0A7W4VQ28-F1-model_v4 | L-cysteine S-thiosulfotransferase subunit SoxA (EC 2.8.5.2) (Protein SoxA) (SoxAX cytochrome complex subunit A) (Sulfur oxidizing protein A) (Thiosulfate-oxidizing multienzyme system protein SoxA) | 0.9212 | 214 | 421 |
GO:0009055
GO:0016669 GO:0016740 GO:0019417 GO:0020037 GO:0042597 GO:0046872 GO:0070069 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar