F479581

General Info

Members Datasets Scaffolds Average Seq Length
761 372 757 421

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0132067|Ga0373937_0132067_918_2297
Length 452
Sequence MMTAQSLPRKKKLPWADERSALRWCGRHNDNNSFGEEPMTRGGILASSAAGALGLAADAHAQAKGKEAPLELKGDASVRPWKRYSGWPARDESKFNTLANLASPVAPKQPRKIGPITGDTANGAKLVADRNRGGSCLACHVMGQAGNADLPGNVGPDLSEIGNGGRTDEWLFNYIYDARVYNPDTVMPPWGSHGVFTDGEINDMVAFLKTLKKPAVFKTELDDPNKRPAPVEKRENLDAIENPGMWALDMAAELWKTRGSDGFSCNTCHSDPKAAFKTWAASMPKWEPRLNKVLGVEEFVTRHAKATTGLSWLMETDENRNMSVYLHNLANGEPIAVDTTSAEAKAAIERGKALASRKLGELNFACTDCHGNSANHWIRGQWLGEPKGQYDHFPTWRTSLLAIWDIRQRFQWCQVNIRADELPPDAKEYGDLELYLASLNDGQKLSVPGIRH

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
3 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
4 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
5 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
6 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
12 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
15 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
16 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
17 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
18 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
19 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
20 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
92 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
94 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
95 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
96 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
97 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
98 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
99 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
100 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
101 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
102 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
104 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
105 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
106 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
107 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
108 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
109 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
112 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
143 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
216 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
217 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
218 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
219 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
220 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
221 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
222 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
223 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
224 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
225 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
226 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
227 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
228 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
229 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
230 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
231 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
232 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
233 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
234 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
235 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
236 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
237 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
238 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
239 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
240 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
241 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
242 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
243 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
244 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
245 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
246 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
247 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
248 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
249 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
250 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
251 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
252 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
253 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
254 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
255 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
256 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
257 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
258 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
259 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
260 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
261 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
262 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
263 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
264 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
265 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
266 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
267 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
268 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
269 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
270 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
271 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
272 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
273 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
274 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
275 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
276 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
277 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
278 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
279 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
280 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
281 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
282 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
283 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
284 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
285 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
286 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
287 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
288 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
289 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
290 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
291 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
292 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
293 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
294 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
295 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
296 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
297 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
298 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
299 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
300 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
301 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
302 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
303 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
304 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
305 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
306 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
307 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
308 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
309 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
310 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
311 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
312 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
313 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
314 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
315 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
316 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
317 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
318 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
319 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
320 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
321 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
322 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
323 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
324 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
325 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
326 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
327 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
328 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
329 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
330 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
331 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
332 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
333 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
343 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
344 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
346 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
347 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
348 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
349 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
350 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
351 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
352 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
353 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
354 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
355 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
356 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
357 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
358 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
359 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
360 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
361 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
362 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
363 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
364 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
365 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
366 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
367 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
368 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
369 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
370 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
371 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
372 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0.13
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.5
Nodule 0.39
Rhizoplane 5.52
Rhizosphere 91.2
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214745219 2209111006 Bacteria 14065
2 ARcpr5oldR_c000117 3300000041 Bacteria 14388
3 ARCol0yngRDRAFT_1000003 3300000652 Bacteria 53041
4 JGI24739J22299_10002682 3300001989 Bacteria 6851
5 JGI24737J22298_10000992 3300001990 Bacteria 10058
6 JGI24737J22298_10003261 3300001990 Bacteria 5753
7 JGI24750J21931_1000480 3300002070 Bacteria 6356
8 JGI24745J21846_1002842 3300002073 Bacteria 1792
9 JGI24748J21848_1000438 3300002074 Bacteria 4619
10 JGI24738J21930_10001848 3300002075 Bacteria 5737
11 JGI24749J21850_1000392 3300002076 Bacteria 6511
12 JGI24744J21845_10004046 3300002077 Bacteria 3024
13 JGI24035J26624_1000144 3300002126 Bacteria 6361
14 JGI24034J26672_10000590 3300002239 Bacteria 4637
15 JGI24742J22300_10000041 3300002244 Bacteria 18966
16 JGI25404J52841_10000210 3300003659 Bacteria 7064
17 JGI25404J52841_10001193 3300003659 Unclassified 4457
18 JGI25404J52841_10005069 3300003659 Unclassified 2709
19 JGI25405J52794_10001495 3300003911 Bacteria 3858
20 Ga0065716_1001888 3300005277 Bacteria 2864
21 Ga0065704_10080219 3300005289 Bacteria 3988
22 Ga0065712_10000247 3300005290 Bacteria 16703
23 Ga0065712_10113325 3300005290 Bacteria 1785
24 Ga0065715_10003780 3300005293 Bacteria 5282
25 Ga0065715_10089103 3300005293 Bacteria 14332
26 Ga0065715_10145512 3300005293 Bacteria 1794
27 Ga0070658_10028026 3300005327 Bacteria 4521
28 Ga0070658_10059506 3300005327 Bacteria 3111
29 Ga0070676_10000036 3300005328 Bacteria 40368
30 Ga0070676_10066362 3300005328 Bacteria 2156
31 Ga0070683_100000695 3300005329 Bacteria 24431
32 Ga0070683_100000898 3300005329 Bacteria 22112
33 Ga0070683_100026861 3300005329 Bacteria 5188
34 Ga0070683_100161317 3300005329 Bacteria 2127
35 Ga0070683_100320775 3300005329 Bacteria 1474
36 Ga0070690_100000402 3300005330 Bacteria 21886
37 Ga0070690_100023814 3300005330 Bacteria 3760
38 Ga0070690_100035779 3300005330 Bacteria 3118
39 Ga0070690_100144204 3300005330 Bacteria 1619
40 Ga0070670_100000442 3300005331 Bacteria 33887
41 Ga0070670_100016727 3300005331 Bacteria 6295
42 Ga0070670_100072582 3300005331 Bacteria 2956
43 Ga0070670_100085242 3300005331 Bacteria 2714
44 Ga0070677_10000124 3300005333 Bacteria 25567
45 Ga0068869_100000087 3300005334 Bacteria 42211
46 Ga0070666_10044947 3300005335 Bacteria 2960
47 Ga0070680_100066910 3300005336 Bacteria 2947
48 Ga0070680_100073406 3300005336 Bacteria 2814
49 Ga0070682_100000341 3300005337 Bacteria 32124
50 Ga0070682_100022461 3300005337 Bacteria 3737
51 Ga0070682_100132866 3300005337 Bacteria 1686
52 Ga0068868_100000127 3300005338 Bacteria 48790
53 Ga0068868_100007585 3300005338 Bacteria 7731
54 Ga0068868_100023195 3300005338 Bacteria 4694
55 Ga0070660_100076282 3300005339 Bacteria 2625
56 Ga0070689_100002790 3300005340 Bacteria 11470
57 Ga0070691_10004809 3300005341 Bacteria 6147
58 Ga0070691_10008048 3300005341 Bacteria 4823
59 Ga0070687_100005901 3300005343 Bacteria 4979
60 Ga0070661_100000017 3300005344 Bacteria 153232
61 Ga0070661_100000589 3300005344 Bacteria 27482
62 Ga0070661_100063833 3300005344 Bacteria 2705
63 Ga0070692_10000018 3300005345 Bacteria 33825
64 Ga0070668_100001356 3300005347 Bacteria 17522
65 Ga0070668_100111063 3300005347 Bacteria 2182
66 Ga0070669_100000217 3300005353 Bacteria 47833
67 Ga0070675_100000082 3300005354 Bacteria 56027
68 Ga0070675_100000088 3300005354 Bacteria 53698
69 Ga0070675_100060091 3300005354 Bacteria 3137
70 Ga0070671_100000405 3300005355 Bacteria 29748
71 Ga0070671_100011124 3300005355 Bacteria 7227
72 Ga0070671_100020068 3300005355 Bacteria 5445
73 Ga0070671_100075228 3300005355 Bacteria 2821
74 Ga0070673_100000239 3300005364 Bacteria 27611
75 Ga0070673_100002161 3300005364 Bacteria 11909
76 Ga0070673_100031259 3300005364 Bacteria 3993
77 Ga0070688_100000084 3300005365 Bacteria 47194
78 Ga0070688_100003883 3300005365 Bacteria 7746
79 Ga0070688_100016483 3300005365 Bacteria 4225
80 Ga0070667_100003023 3300005367 Bacteria 14455
81 Ga0070667_100094121 3300005367 Bacteria 2581
82 Ga0070667_100096956 3300005367 Bacteria 2543
83 Ga0070667_100108839 3300005367 Bacteria 2401
84 Ga0070703_10016932 3300005406 Bacteria 2097
85 Ga0070709_10000855 3300005434 Bacteria 17027
86 Ga0070709_10004300 3300005434 Bacteria 7681
87 Ga0070709_10124055 3300005434 Bacteria 1755
88 Ga0070713_100002359 3300005436 Bacteria 12318
89 Ga0070713_100004066 3300005436 Bacteria 9738
90 Ga0070713_100031837 3300005436 Bacteria 4205
91 Ga0070713_100149309 3300005436 Bacteria 2077
92 Ga0070710_10003385 3300005437 Bacteria 7554
93 Ga0070710_10021169 3300005437 Bacteria 3384
94 Ga0070710_10029684 3300005437 Bacteria 2935
95 Ga0070710_10087694 3300005437 Bacteria 1829
96 Ga0070701_10019817 3300005438 Bacteria 3182
97 Ga0070711_100077069 3300005439 Bacteria 2365
98 Ga0070711_100101812 3300005439 Bacteria 2091
99 Ga0070711_100137381 3300005439 Bacteria 1829
100 Ga0070705_100000425 3300005440 Bacteria 24231
101 Ga0070705_100076457 3300005440 Bacteria 2042
102 Ga0070700_100000430 3300005441 Bacteria 21259
103 Ga0070700_100034968 3300005441 Bacteria 3037
104 Ga0070694_100000401 3300005444 Bacteria 23534
105 Ga0070694_100010745 3300005444 Bacteria 5661
106 Ga0070694_100216330 3300005444 Bacteria 1435
107 Ga0070708_100026428 3300005445 Bacteria 4969
108 Ga0070663_100032570 3300005455 Bacteria 3594
109 Ga0070678_100000014 3300005456 Bacteria 55438
110 Ga0070678_100000053 3300005456 Bacteria 40418
111 Ga0070678_100022259 3300005456 Bacteria 4195
112 Ga0070678_100030073 3300005456 Bacteria 3728
113 Ga0070681_10000493 3300005458 Bacteria 32198
114 Ga0070681_10009120 3300005458 Bacteria 9749
115 Ga0070681_10013271 3300005458 Bacteria 8185
116 Ga0070681_10090702 3300005458 Bacteria 3006
117 Ga0070681_10091827 3300005458 Bacteria 2986
118 Ga0068867_100002202 3300005459 Bacteria 13675
119 Ga0068867_100015926 3300005459 Bacteria 5337
120 Ga0070685_10001195 3300005466 Bacteria 13859
121 Ga0070707_100013936 3300005468 Bacteria 7530
122 Ga0070679_100000679 3300005530 Bacteria 29087
123 Ga0070679_100042532 3300005530 Bacteria 4525
124 Ga0070679_100122492 3300005530 Bacteria 2584
125 Ga0070679_100143328 3300005530 Bacteria 2368
126 Ga0070684_100000144 3300005535 Bacteria 47665
127 Ga0070684_100007137 3300005535 Bacteria 8679
128 Ga0070684_100174444 3300005535 Bacteria 1953
129 Ga0070672_100000014 3300005543 Bacteria 72627
130 Ga0070672_100000029 3300005543 Bacteria 63114
131 Ga0070686_100002767 3300005544 Bacteria 9659
132 Ga0070695_100000743 3300005545 Bacteria 17429
133 Ga0070695_100003239 3300005545 Bacteria 9500
134 Ga0070695_100007870 3300005545 Bacteria 6313
135 Ga0070695_100065695 3300005545 Bacteria 2363
136 Ga0070696_100000918 3300005546 Bacteria 19157
137 Ga0070693_100000141 3300005547 Bacteria 32426
138 Ga0070693_100058059 3300005547 Bacteria 2239
139 Ga0070693_100140072 3300005547 Bacteria 1521
140 Ga0070665_100069877 3300005548 Bacteria 3519
141 Ga0070665_100070658 3300005548 Unclassified 3498
142 Ga0070665_100116586 3300005548 Unclassified 2673
143 Ga0070704_100008824 3300005549 Bacteria 6068
144 Ga0070704_100014935 3300005549 Bacteria 4861
145 Ga0068855_100201967 3300005563 Bacteria 2237
146 Ga0070664_100000124 3300005564 Bacteria 51361
147 Ga0070664_100038514 3300005564 Bacteria 4024
148 Ga0070664_100040344 3300005564 Bacteria 3935
149 Ga0068857_100001474 3300005577 Bacteria 18724
150 Ga0068854_100000168 3300005578 Bacteria 44522
151 Ga0068856_100000932 3300005614 Bacteria 31354
152 Ga0070702_100008129 3300005615 Bacteria 5070
153 Ga0070702_100019143 3300005615 Bacteria 3563
154 Ga0068852_100000016 3300005616 Bacteria 132773
155 Ga0068859_100071001 3300005617 Bacteria 3517
156 Ga0068859_100093040 3300005617 Bacteria 3066
157 Ga0068864_100000823 3300005618 Bacteria 26121
158 Ga0068864_100062981 3300005618 Bacteria 3214
159 Ga0068864_100088136 3300005618 Bacteria 2733
160 Ga0068861_100000315 3300005719 Bacteria 27094
161 Ga0068851_10001223 3300005834 Bacteria 11165
162 Ga0068870_10000002 3300005840 Bacteria 91107
163 Ga0068863_100013344 3300005841 Bacteria 7922
164 Ga0068863_100067439 3300005841 Bacteria 3384
165 Ga0068858_100000356 3300005842 Bacteria 48189
166 Ga0068858_100059299 3300005842 Bacteria 3537
167 Ga0068860_100000747 3300005843 Bacteria 36976
168 Ga0068860_100315126 3300005843 Bacteria 1534
169 Ga0068862_100000671 3300005844 Bacteria 35004
170 Ga0068862_100067930 3300005844 Bacteria 3074
171 Ga0081455_10000048 3300005937 Bacteria 126551
172 Ga0081455_10010063 3300005937 Bacteria 9654
173 Ga0081455_10014701 3300005937 Bacteria 7645
174 Ga0081540_1000293 3300005983 Bacteria 52532
175 Ga0081540_1000397 3300005983 Bacteria 43084
176 Ga0081540_1000518 3300005983 Bacteria 37819
177 Ga0081540_1004355 3300005983 Bacteria 10828
178 Ga0081540_1005808 3300005983 Bacteria 9133
179 Ga0081540_1009059 3300005983 Bacteria 6878
180 Ga0081540_1009145 3300005983 Bacteria 6837
181 Ga0081540_1029140 3300005983 Bacteria 3082
182 Ga0081540_1041402 3300005983 Bacteria 2389
183 Ga0081539_10002257 3300005985 Bacteria 28023
184 Ga0081539_10015916 3300005985 Bacteria 5420
185 Ga0070717_10003328 3300006028 Bacteria 11477
186 Ga0075368_10033949 3300006042 Bacteria 1986
187 Ga0075363_100018321 3300006048 Bacteria 3487
188 Ga0075432_10031917 3300006058 Bacteria 1824
189 Ga0070716_100002233 3300006173 Bacteria 8923
190 Ga0070716_100031117 3300006173 Bacteria 2900
191 Ga0070712_100046610 3300006175 Bacteria 2997
192 Ga0075362_10020225 3300006177 Bacteria 2779
193 Ga0075367_10102230 3300006178 Bacteria 1753
194 Ga0075369_10012498 3300006186 Bacteria 3356
195 Ga0097621_100000144 3300006237 Bacteria 43169
196 Ga0097621_100000482 3300006237 Bacteria 27827
197 Ga0097621_100008876 3300006237 Bacteria 7268
198 Ga0097621_100026444 3300006237 Bacteria 4552
199 Ga0068871_100000050 3300006358 Bacteria 64862
200 Ga0068871_100000110 3300006358 Bacteria 49756
201 Ga0068871_100015537 3300006358 Bacteria 5702
202 Ga0068871_100108543 3300006358 Bacteria 2333
203 Ga0075430_100000627 3300006846 Bacteria 26908
204 Ga0075433_10000615 3300006852 Bacteria 23766
205 Ga0075433_10179981 3300006852 Bacteria 1881
206 Ga0075434_100000084 3300006871 Bacteria 50928
207 Ga0075434_100134451 3300006871 Bacteria 2492
208 Ga0075429_100000877 3300006880 Bacteria 23746
209 Ga0068865_100000066 3300006881 Bacteria 54564
210 Ga0068865_100009015 3300006881 Bacteria 6171
211 Ga0075436_100007051 3300006914 Bacteria 7695
212 Ga0075436_100031219 3300006914 Bacteria 3668
213 Ga0097620_100071001 3300006931 Bacteria 3517
214 Ga0097620_100093043 3300006931 Bacteria 3066
215 Ga0075435_100001540 3300007076 Bacteria 14850
216 Ga0075435_100180757 3300007076 Bacteria 1782
217 Ga0105251_10012262 3300009011 Bacteria 4857
218 Ga0111539_10000423 3300009094 Bacteria 53050
219 Ga0111539_10000652 3300009094 Bacteria 44828
220 Ga0111539_10001255 3300009094 Bacteria 33804
221 Ga0105245_10000287 3300009098 Bacteria 48204
222 Ga0105245_10002287 3300009098 Bacteria 17339
223 Ga0105245_10038270 3300009098 Bacteria 4268
224 Ga0105245_10213849 3300009098 Unclassified 1857
225 Ga0105247_10001223 3300009101 Bacteria 19057
226 Ga0105247_10007491 3300009101 Bacteria 6691
227 Ga0105247_10086615 3300009101 Bacteria 1982
228 Ga0105243_10000695 3300009148 Bacteria 32613
229 Ga0105243_10013699 3300009148 Bacteria 6135
230 Ga0105241_10002331 3300009174 Bacteria 14262
231 Ga0105241_10037102 3300009174 Bacteria 3671
232 Ga0105242_10000792 3300009176 Bacteria 24525
233 Ga0105242_10006274 3300009176 Bacteria 9156
234 Ga0105242_10026443 3300009176 Bacteria 4600
235 Ga0105242_10059085 3300009176 Bacteria 3145
236 Ga0105242_10127768 3300009176 Bacteria 2190
237 Ga0105248_10000535 3300009177 Bacteria 43210
238 Ga0105248_10009137 3300009177 Bacteria 10900
239 Ga0105248_10031579 3300009177 Bacteria 5918
240 Ga0105248_10065160 3300009177 Bacteria 4090
241 Ga0105248_10065290 3300009177 Bacteria 4086
242 Ga0105248_10094971 3300009177 Unclassified 3357
243 Ga0105237_10002795 3300009545 Bacteria 21203
244 Ga0105238_10157027 3300009551 Bacteria 2250
245 Ga0105249_10000279 3300009553 Bacteria 53594
246 Ga0105249_10003839 3300009553 Bacteria 12962
247 Ga0105249_10361945 3300009553 Bacteria 1472
248 Ga0105239_10001686 3300010375 Bacteria 29130
249 Ga0105239_10044533 3300010375 Bacteria 4864
250 Ga0105239_10074149 3300010375 Bacteria 3742
251 Ga0105239_10288996 3300010375 Bacteria 1846
252 Ga0105246_10000095 3300011119 Bacteria 38417
253 Ga0157373_10232834 3300013100 Bacteria 1301
254 Ga0157371_10011031 3300013102 Bacteria 7000
255 Ga0157370_10033080 3300013104 Bacteria 5042
256 Ga0157369_10209362 3300013105 Unclassified 2044
257 Ga0157374_10000321 3300013296 Bacteria 44720
258 Ga0157374_10001348 3300013296 Bacteria 20895
259 Ga0157374_10326059 3300013296 Bacteria 1522
260 Ga0157378_10000956 3300013297 Bacteria 26502
261 Ga0157378_10005246 3300013297 Bacteria 11380
262 Ga0157378_10052863 3300013297 Bacteria 3615
263 Ga0157378_10094941 3300013297 Bacteria 2716
264 Ga0163162_10002192 3300013306 Bacteria 18324
265 Ga0163162_10003795 3300013306 Bacteria 14493
266 Ga0157372_10009222 3300013307 Bacteria 10491
267 Ga0157372_10134988 3300013307 Bacteria 2841
268 Ga0157375_10000135 3300013308 Bacteria 73281
269 Ga0157375_10000627 3300013308 Bacteria 31374
270 Ga0157375_10135433 3300013308 Bacteria 2586
271 Ga0163163_10004844 3300014325 Bacteria 11564
272 Ga0163163_10124732 3300014325 Bacteria 2612
273 Ga0157380_10000052 3300014326 Bacteria 67030
274 Ga0157377_10000076 3300014745 Bacteria 75835
275 Ga0157379_10000060 3300014968 Bacteria 69312
276 Ga0157379_10007831 3300014968 Bacteria 9252
277 Ga0157379_10026823 3300014968 Bacteria 5128
278 Ga0157379_10185697 3300014968 Unclassified 1879
279 Ga0157376_10000141 3300014969 Bacteria 49288
280 Ga0163161_10026256 3300017792 Bacteria 4126
281 Ga0206356_10402258 3300020070 Bacteria 1684
282 Ga0207666_1000005 3300025271 Bacteria 54011
283 Ga0207666_1000330 3300025271 Bacteria 6509
284 Ga0207673_1000002 3300025290 Bacteria 18299
285 Ga0207697_10000011 3300025315 Bacteria 65035
286 Ga0207697_10003212 3300025315 Bacteria 8131
287 Ga0207656_10002239 3300025321 Bacteria 6483
288 Ga0207653_10007931 3300025885 Bacteria 3309
289 Ga0207682_10000051 3300025893 Bacteria 49249
290 Ga0207682_10009271 3300025893 Bacteria 3888
291 Ga0207692_10005372 3300025898 Bacteria 5131
292 Ga0207692_10028543 3300025898 Bacteria 2641
293 Ga0207642_10000229 3300025899 Bacteria 16538
294 Ga0207710_10001284 3300025900 Bacteria 12696
295 Ga0207710_10021318 3300025900 Bacteria 2776
296 Ga0207688_10000001 3300025901 Bacteria 107505
297 Ga0207688_10009124 3300025901 Bacteria 5400
298 Ga0207680_10029075 3300025903 Bacteria 3100
299 Ga0207647_10001714 3300025904 Bacteria 16833
300 Ga0207647_10007690 3300025904 Bacteria 7763
301 Ga0207685_10004129 3300025905 Bacteria 3644
302 Ga0207699_10001161 3300025906 Bacteria 12456
303 Ga0207699_10097860 3300025906 Unclassified 1855
304 Ga0207645_10000121 3300025907 Bacteria 58999
305 Ga0207645_10013754 3300025907 Bacteria 5433
306 Ga0207645_10023325 3300025907 Bacteria 4022
307 Ga0207645_10086216 3300025907 Bacteria 2017
308 Ga0207643_10000009 3300025908 Bacteria 160496
309 Ga0207705_10030075 3300025909 Bacteria 3874
310 Ga0207654_10043742 3300025911 Bacteria 2540
311 Ga0207707_10000840 3300025912 Bacteria 30189
312 Ga0207707_10026208 3300025912 Bacteria 5096
313 Ga0207693_10003131 3300025915 Bacteria 14229
314 Ga0207693_10011496 3300025915 Bacteria 7161
315 Ga0207693_10058351 3300025915 Bacteria 3024
316 Ga0207663_10015462 3300025916 Bacteria 4210
317 Ga0207660_10021268 3300025917 Bacteria 4361
318 Ga0207660_10114085 3300025917 Bacteria 2037
319 Ga0207660_10180614 3300025917 Unclassified 1639
320 Ga0207662_10000120 3300025918 Bacteria 37721
321 Ga0207662_10001791 3300025918 Bacteria 10543
322 Ga0207657_10002826 3300025919 Bacteria 18663
323 Ga0207657_10004971 3300025919 Bacteria 13989
324 Ga0207657_10081532 3300025919 Bacteria 2717
325 Ga0207649_10000052 3300025920 Bacteria 106800
326 Ga0207649_10001315 3300025920 Bacteria 14788
327 Ga0207652_10000508 3300025921 Bacteria 39568
328 Ga0207652_10016692 3300025921 Bacteria 6000
329 Ga0207652_10098796 3300025921 Bacteria 2575
330 Ga0207652_10111632 3300025921 Bacteria 2425
331 Ga0207646_10069016 3300025922 Bacteria 3157
332 Ga0207681_10000035 3300025923 Bacteria 161792
333 Ga0207694_10172192 3300025924 Bacteria 1753
334 Ga0207650_10000843 3300025925 Bacteria 23231
335 Ga0207650_10001028 3300025925 Bacteria 20946
336 Ga0207650_10078480 3300025925 Bacteria 2498
337 Ga0207659_10000027 3300025926 Bacteria 135454
338 Ga0207659_10001108 3300025926 Bacteria 15972
339 Ga0207687_10000231 3300025927 Bacteria 38087
340 Ga0207687_10012582 3300025927 Bacteria 5527
341 Ga0207687_10012658 3300025927 Bacteria 5512
342 Ga0207700_10000917 3300025928 Bacteria 16892
343 Ga0207700_10021942 3300025928 Bacteria 4372
344 Ga0207700_10053149 3300025928 Bacteria 3033
345 Ga0207644_10000157 3300025931 Bacteria 49224
346 Ga0207644_10007559 3300025931 Bacteria 7084
347 Ga0207690_10000056 3300025932 Bacteria 101387
348 Ga0207690_10017319 3300025932 Bacteria 4397
349 Ga0207706_10000261 3300025933 Bacteria 57530
350 Ga0207706_10004416 3300025933 Bacteria 13214
351 Ga0207706_10014945 3300025933 Bacteria 7030
352 Ga0207706_10015924 3300025933 Bacteria 6794
353 Ga0207686_10000171 3300025934 Bacteria 49624
354 Ga0207686_10011564 3300025934 Bacteria 4836
355 Ga0207686_10032093 3300025934 Unclassified 3123
356 Ga0207709_10000087 3300025935 Bacteria 155019
357 Ga0207670_10000169 3300025936 Bacteria 43470
358 Ga0207670_10017561 3300025936 Bacteria 4326
359 Ga0207669_10000351 3300025937 Bacteria 20924
360 Ga0207704_10000134 3300025938 Bacteria 40098
361 Ga0207665_10000333 3300025939 Bacteria 32450
362 Ga0207691_10000106 3300025940 Bacteria 74290
363 Ga0207691_10000212 3300025940 Bacteria 56413
364 Ga0207691_10077212 3300025940 Bacteria 3001
365 Ga0207711_10032883 3300025941 Bacteria 4387
366 Ga0207711_10066716 3300025941 Bacteria 3112
367 Ga0207711_10086244 3300025941 Bacteria 2752
368 Ga0207711_10107904 3300025941 Bacteria 2472
369 Ga0207689_10000031 3300025942 Bacteria 97131
370 Ga0207689_10031849 3300025942 Bacteria 4386
371 Ga0207689_10036829 3300025942 Bacteria 4060
372 Ga0207661_10000219 3300025944 Bacteria 37298
373 Ga0207661_10002054 3300025944 Bacteria 13858
374 Ga0207661_10044792 3300025944 Bacteria 3499
375 Ga0207679_10001608 3300025945 Bacteria 14055
376 Ga0207679_10036844 3300025945 Bacteria 3473
377 Ga0207667_10039261 3300025949 Bacteria 5047
378 Ga0207651_10002529 3300025960 Bacteria 8730
379 Ga0207651_10010392 3300025960 Bacteria 5158
380 Ga0207651_10072873 3300025960 Bacteria 2440
381 Ga0207651_10099361 3300025960 Bacteria 2155
382 Ga0207651_10101216 3300025960 Bacteria 2138
383 Ga0207651_10112640 3300025960 Bacteria 2045
384 Ga0207712_10000176 3300025961 Bacteria 66116
385 Ga0207712_10012238 3300025961 Bacteria 5482
386 Ga0207712_10102257 3300025961 Bacteria 2133
387 Ga0207668_10000191 3300025972 Bacteria 41901
388 Ga0207668_10115042 3300025972 Bacteria 2026
389 Ga0207640_10000126 3300025981 Bacteria 58432
390 Ga0207658_10001331 3300025986 Bacteria 19354
391 Ga0207658_10028749 3300025986 Bacteria 3919
392 Ga0207658_10047022 3300025986 Bacteria 3155
393 Ga0207658_10071512 3300025986 Bacteria 2627
394 Ga0207658_10074481 3300025986 Bacteria 2580
395 Ga0207677_10001004 3300026023 Bacteria 15580
396 Ga0207677_10004460 3300026023 Bacteria 7516
397 Ga0207703_10007278 3300026035 Bacteria 8798
398 Ga0207703_10060365 3300026035 Bacteria 3100
399 Ga0207639_10000515 3300026041 Bacteria 26655
400 Ga0207639_10107499 3300026041 Bacteria 2266
401 Ga0207678_10000137 3300026067 Bacteria 60700
402 Ga0207678_10019341 3300026067 Bacteria 5982
403 Ga0207678_10097972 3300026067 Bacteria 2505
404 Ga0207708_10000250 3300026075 Bacteria 42228
405 Ga0207708_10004369 3300026075 Bacteria 10414
406 Ga0207708_10010877 3300026075 Bacteria 6769
407 Ga0207702_10001067 3300026078 Bacteria 28056
408 Ga0207641_10000937 3300026088 Bacteria 30095
409 Ga0207641_10150637 3300026088 Unclassified 2106
410 Ga0207648_10000125 3300026089 Bacteria 75547
411 Ga0207648_10008450 3300026089 Bacteria 9969
412 Ga0207648_10012120 3300026089 Bacteria 8085
413 Ga0207676_10001547 3300026095 Bacteria 16966
414 Ga0207676_10010020 3300026095 Bacteria 6744
415 Ga0207674_10000095 3300026116 Bacteria 99278
416 Ga0207674_10197434 3300026116 Bacteria 1962
417 Ga0207675_100000140 3300026118 Bacteria 62058
418 Ga0207675_100010192 3300026118 Bacteria 8808
419 Ga0207675_100163364 3300026118 Bacteria 2126
420 Ga0207683_10000010 3300026121 Bacteria 150106
421 Ga0207683_10000178 3300026121 Bacteria 54648
422 Ga0207683_10001447 3300026121 Bacteria 21461
423 Ga0207698_10000086 3300026142 Bacteria 61523
424 Ga0207698_10001736 3300026142 Bacteria 12713
425 Ga0210002_1002682 3300027617 Bacteria 2576
426 Ga0209971_1003367 3300027682 Bacteria 3795
427 Ga0209998_10000790 3300027717 Bacteria 8188
428 Ga0209998_10001828 3300027717 Bacteria 5040
429 Ga0209974_10005676 3300027876 Bacteria 4379
430 Ga0209974_10019463 3300027876 Bacteria 2251
431 Ga0207428_10000037 3300027907 Bacteria 218857
432 Ga0207428_10000188 3300027907 Bacteria 85820
433 Ga0207428_10001468 3300027907 Bacteria 24676
434 Ga0268266_10025953 3300028379 Bacteria 4984
435 Ga0268266_10272953 3300028379 Unclassified 1570
436 Ga0268265_10000774 3300028380 Bacteria 30835
437 Ga0268264_10000467 3300028381 Bacteria 54925
438 Ga0265318_10001682 3300028577 Bacteria 12704
439 Ga0265330_10026680 3300031235 Bacteria 2611
440 Ga0265332_10000899 3300031238 Bacteria 17859
441 Ga0265332_10003866 3300031238 Bacteria 7149
442 Ga0265328_10002574 3300031239 Bacteria 8123
443 Ga0265320_10042060 3300031240 Bacteria 2269
444 Ga0265325_10000049 3300031241 Bacteria 80854
445 Ga0265340_10005195 3300031247 Bacteria 7235
446 Ga0265339_10058197 3300031249 Bacteria 2087
447 Ga0265331_10009401 3300031250 Bacteria 5486
448 Ga0265316_10027190 3300031344 Bacteria 4742
449 Ga0265313_10036282 3300031595 Bacteria 2476
450 Ga0265313_10036963 3300031595 Bacteria 2447
451 Ga0265314_10000784 3300031711 Bacteria 37699
452 Ga0265314_10006115 3300031711 Bacteria 10696
453 Ga0265342_10000392 3300031712 Bacteria 48362
454 Ga0307516_10009407 3300031730 Bacteria 10903
455 Ga0307516_10043262 3300031730 Bacteria 4464
456 Ga0373930_0000027 3300034816 Bacteria 13519
457 Ga0373948_0000240 3300034817 Bacteria 6536
458 Ga0373950_0001487 3300034818 Bacteria 3063
459 Ga0373958_0000799 3300034819 Bacteria 4043
460 Ga0373958_0001378 3300034819 Bacteria 3255
461 Ga0373938_0000020 3300034957 Bacteria 20855
462 Ga0373938_0000482 3300034957 Bacteria 6452
463 Ga0373926_0006103 3300035083 Bacteria 3991
464 Ga0373928_0001620 3300035084 Bacteria 4359
465 Ga0373928_0003098 3300035084 Bacteria 3191
466 Ga0373928_0004039 3300035084 Bacteria 2800
467 Ga0373929_0001458 3300035085 Bacteria 4511
468 Ga0373934_0021715 3300035086 Bacteria 2474
469 Ga0373949_0000753 3300035090 Bacteria 10447
470 Ga0373949_0004305 3300035090 Bacteria 3273
471 Ga0373951_0001531 3300035091 Bacteria 6048
472 Ga0373951_0006562 3300035091 Bacteria 2660
473 Ga0373952_0000597 3300035092 Bacteria 6378
474 Ga0373952_0001351 3300035092 Bacteria 4489
475 Ga0373932_0000316 3300035112 Bacteria 14729
476 Ga0373936_0002157 3300035113 Bacteria 7328
477 Ga0373936_0055452 3300035113 Bacteria 1609
478 Ga0373939_0000429 3300035114 Bacteria 10556
479 Ga0373941_0000341 3300035115 Bacteria 9139
480 Ga0373941_0001140 3300035115 Bacteria 5543
481 Ga0373953_0006441 3300035117 Bacteria 3868
482 Ga0373954_0008900 3300035118 Bacteria 4417
483 Ga0373956_0005690 3300035119 Bacteria 4984
484 Ga0373960_0000127 3300035121 Bacteria 12399
485 Ga0373960_0000335 3300035121 Bacteria 9006
486 Ga0373960_0004580 3300035121 Bacteria 3174
487 Ga0373946_0033500 3300035171 Bacteria 2068
488 Ga0373955_0001110 3300035172 Bacteria 11430
489 Ga0373955_0003230 3300035172 Bacteria 7142
490 Ga0373955_0113162 3300035172 Unclassified 1571
491 Ga0373942_0000054 3300035207 Bacteria 23047
492 Ga0373942_0015211 3300035207 Bacteria 1872
493 Ga0373961_0000807 3300035241 Bacteria 10698
494 Ga0373961_0004284 3300035241 Bacteria 3455
495 Ga0373962_0000497 3300035242 Bacteria 8747
496 Ga0373962_0001528 3300035242 Bacteria 5469
497 Ga0373924_0001227 3300035410 Bacteria 8212
498 Ga0373924_0008024 3300035410 Bacteria 3821
499 Ga0373931_0001604 3300035691 Bacteria 9784
500 Ga0373931_0003983 3300035691 Bacteria 6694
501 Ga0373931_0004569 3300035691 Bacteria 6331
502 Ga0373935_0000208 3300035692 Bacteria 28198
503 Ga0373935_0004548 3300035692 Bacteria 8158
504 Ga0373935_0015490 3300035692 Bacteria 4609
505 Ga0373935_0035574 3300035692 Bacteria 3109
506 Ga0373927_0001804 3300035695 Bacteria 15970
507 Ga0373927_0017601 3300035695 Bacteria 4702
508 Ga0373933_0002449 3300035724 Bacteria 10458
509 Ga0373933_0020736 3300035724 Bacteria 3726
510 Ga0373933_0023745 3300035724 Bacteria 3505
511 Ga0373947_0005403 3300035725 Bacteria 7458
512 Ga0373947_0006947 3300035725 Bacteria 6560
513 Ga0373947_0018365 3300035725 Bacteria 4024
514 Ga0373937_0000031 3300036401 Bacteria 120533
515 Ga0373937_0002996 3300036401 Bacteria 14164
516 Ga0373937_0132067 3300036401 Bacteria 2332
517 Ga0373925_0000063 3300037068 Bacteria 114809
518 Ga0373925_0025234 3300037068 Bacteria 4340
519 Ga0436360_0097535 3300039438 Bacteria 1808
520 Ga0451576_0010925 3300045051 Bacteria 10379
521 Ga0495592_0000072 3300046454 Bacteria 91917
522 Ga0495592_0001840 3300046454 Bacteria 14914
523 Ga0495592_0010619 3300046454 Bacteria 6945
524 Ga0495603_0011026 3300046455 Bacteria 5480
525 Ga0495603_0037807 3300046455 Bacteria 2895
526 Ga0495603_0051357 3300046455 Bacteria 2450
527 Ga0495629_0000269 3300046459 Bacteria 45206
528 Ga0495629_0041363 3300046459 Bacteria 3243
529 Ga0495629_0089738 3300046459 Bacteria 2144
530 Ga0495638_0040160 3300046460 Bacteria 2966
531 Ga0495651_0001167 3300046462 Bacteria 20291
532 Ga0495651_0005718 3300046462 Bacteria 9477
533 Ga0495651_0010406 3300046462 Bacteria 7147
534 Ga0495651_0014281 3300046462 Bacteria 6138
535 Ga0495653_0000020 3300046463 Bacteria 175274
536 Ga0495653_0010063 3300046463 Bacteria 7736
537 Ga0495653_0030364 3300046463 Bacteria 4306
538 Ga0495653_0038789 3300046463 Bacteria 3737
539 Ga0495580_0175931 3300046472 Bacteria 1478
540 Ga0495582_0003928 3300046473 Bacteria 8349
541 Ga0495662_0025797 3300046476 Bacteria 2838
542 Ga0495662_0032474 3300046476 Bacteria 2521
543 Ga0495664_0000006 3300046477 Bacteria 407031
544 Ga0495664_0010264 3300046477 Bacteria 5254
545 Ga0495664_0012784 3300046477 Bacteria 4754
546 Ga0495664_0021710 3300046477 Bacteria 3709
547 Ga0495584_0021696 3300046491 Bacteria 3261
548 Ga0495585_0001825 3300046492 Bacteria 16125
549 Ga0495594_0009788 3300046499 Bacteria 4963
550 Ga0495607_0040121 3300046501 Bacteria 2790
551 Ga0495608_0000002 3300046511 Bacteria 376403
552 Ga0495608_0001268 3300046511 Bacteria 17936
553 Ga0495608_0006562 3300046511 Bacteria 8253
554 Ga0495608_0016256 3300046511 Bacteria 5147
555 Ga0495618_0000017 3300046514 Bacteria 143326
556 Ga0495618_0088979 3300046514 Bacteria 1974
557 Ga0495628_0000004 3300046516 Bacteria 462184
558 Ga0495628_0005226 3300046516 Bacteria 11394
559 Ga0495628_0007947 3300046516 Bacteria 9137
560 Ga0495628_0012576 3300046516 Bacteria 7132
561 Ga0495630_0002120 3300046517 Bacteria 13798
562 Ga0495630_0025455 3300046517 Bacteria 4376
563 Ga0495644_0000494 3300046523 Bacteria 16842
564 Ga0495666_0019704 3300046526 Bacteria 3345
565 Ga0495666_0070652 3300046526 Bacteria 1660
566 Ga0495652_0000007 3300046529 Bacteria 418163
567 Ga0495652_0061818 3300046529 Bacteria 3160
568 Ga0495652_0077885 3300046529 Bacteria 2746
569 Ga0495652_0118954 3300046529 Bacteria 2111
570 Ga0495665_0091746 3300046531 Bacteria 1596
571 Ga0495640_0000004 3300046533 Bacteria 357515
572 Ga0495640_0006352 3300046533 Bacteria 9365
573 Ga0495586_0011910 3300046535 Bacteria 4619
574 Ga0495587_0000002 3300046536 Bacteria 425485
575 Ga0495587_0000620 3300046536 Bacteria 24097
576 Ga0495587_0010054 3300046536 Bacteria 6041
577 Ga0495645_0000008 3300046543 Bacteria 331530
578 Ga0495645_0000848 3300046543 Bacteria 20818
579 Ga0495645_0008343 3300046543 Bacteria 7232
580 Ga0495622_0028312 3300046557 Bacteria 2616
581 Ga0495633_0001631 3300046558 Bacteria 16927
582 Ga0495667_0000010 3300046559 Bacteria 222698
583 Ga0495667_0001254 3300046559 Bacteria 16638
584 Ga0495667_0104514 3300046559 Bacteria 1831
585 Ga0495667_0113573 3300046559 Unclassified 1750
586 Ga0495656_0000749 3300046615 Bacteria 10508
587 Ga0495634_0000603 3300046642 Bacteria 34766
588 Ga0495634_0019712 3300046642 Bacteria 4790
589 Ga0495635_0000004 3300046663 Bacteria 388068
590 Ga0495635_0005437 3300046663 Bacteria 8861
591 Ga0495635_0036531 3300046663 Bacteria 3405
592 Ga0495635_0090897 3300046663 Bacteria 2088
593 Ga0495635_0091274 3300046663 Bacteria 2083
594 Ga0495635_0121632 3300046663 Unclassified 1780
595 Ga0495659_0018184 3300046664 Bacteria 2339
596 Ga0495661_0050032 3300046665 Bacteria 2532
597 Ga0495588_0007720 3300046674 Bacteria 4912
598 Ga0495657_0000051 3300046675 Bacteria 101587
599 Ga0495657_0002939 3300046675 Bacteria 14124
600 Ga0495599_0000003 3300046678 Bacteria 319085
601 Ga0495599_0003832 3300046678 Bacteria 8833
602 Ga0495623_0000009 3300046679 Bacteria 127758
603 Ga0495623_0026867 3300046679 Bacteria 3703
604 Ga0495646_0000001 3300046680 Bacteria 403396
605 Ga0495646_0000856 3300046680 Bacteria 17244
606 Ga0495647_0012435 3300046681 Bacteria 2931
607 Ga0495658_0004553 3300046683 Bacteria 6816
608 Ga0495658_0018082 3300046683 Bacteria 3658
609 Ga0495658_0139104 3300046683 Unclassified 1483
610 Ga0495613_0015225 3300046689 Bacteria 5716
611 Ga0495613_0038188 3300046689 Bacteria 3559
612 Ga0495624_0040542 3300046690 Bacteria 2982
613 Ga0495624_0042593 3300046690 Bacteria 2901
614 Ga0495670_0001311 3300046691 Bacteria 12116
615 Ga0495600_0000008 3300046809 Bacteria 147902
616 Ga0495600_0019144 3300046809 Bacteria 4367
617 Ga0495600_0052308 3300046809 Bacteria 2667
618 Ga0495600_0058956 3300046809 Bacteria 2508
619 Ga0495604_0000003 3300047317 Bacteria 464246
620 Ga0495604_0005959 3300047317 Bacteria 9671
621 Ga0495604_0027617 3300047317 Bacteria 4512
622 Ga0495674_0000021 3300047319 Bacteria 174056
623 Ga0495674_0005637 3300047319 Bacteria 11992
624 Ga0495674_0257984 3300047319 Bacteria 1433
625 Ga0495676_0034516 3300047321 Bacteria 4244
626 Ga0495676_0120584 3300047321 Bacteria 1908
627 Ga0495680_0000505 3300047322 Bacteria 44019
628 Ga0495680_0001472 3300047322 Bacteria 25404
629 Ga0495680_0006777 3300047322 Bacteria 10581
630 Ga0495680_0017612 3300047322 Bacteria 6090
631 Ga0495680_0018210 3300047322 Bacteria 5971
632 Ga0495680_0022232 3300047322 Bacteria 5290
633 Ga0495675_0000466 3300047444 Bacteria 26682
634 Ga0495675_0018016 3300047444 Bacteria 4477
635 Ga0495684_0000050 3300047471 Bacteria 86794
636 Ga0495684_0015113 3300047471 Bacteria 5945
637 Ga0495593_0000394 3300047673 Bacteria 24241
638 Ga0495593_0009204 3300047673 Bacteria 5726
639 Ga0495593_0080823 3300047673 Bacteria 1681
640 Ga0495602_0000012 3300048088 Bacteria 200520
641 Ga0495602_0002664 3300048088 Bacteria 18252
642 Ga0495602_0013607 3300048088 Bacteria 8305
643 Ga0496100_0000713 3300048903 Bacteria 15859
644 Ga0496100_0006554 3300048903 Bacteria 6356
645 Ga0496101_0000151 3300048904 Bacteria 59751
646 Ga0496101_0007659 3300048904 Bacteria 7011
647 Ga0496101_0016572 3300048904 Bacteria 4982
648 Ga0496102_0001766 3300048905 Bacteria 18797
649 Ga0496102_0016358 3300048905 Bacteria 6479
650 Ga0496102_0048953 3300048905 Bacteria 3844
651 Ga0496102_0070115 3300048905 Bacteria 3218
652 Ga0496103_0000589 3300048906 Bacteria 28631
653 Ga0496104_0000215 3300048907 Bacteria 50960
654 Ga0496104_0005956 3300048907 Bacteria 10678
655 Ga0496104_0097659 3300048907 Bacteria 2812
656 Ga0496105_0007651 3300048908 Bacteria 8374
657 Ga0496105_0020355 3300048908 Bacteria 5361
658 Ga0496106_0000347 3300048909 Bacteria 32770
659 Ga0496106_0019937 3300048909 Bacteria 4973
660 Ga0496106_0021616 3300048909 Bacteria 4777
661 Ga0496106_0146486 3300048909 Bacteria 1860
662 Ga0496107_0000959 3300048910 Bacteria 17091
663 Ga0496107_0019768 3300048910 Bacteria 4754
664 Ga0496108_0007921 3300048911 Bacteria 8613
665 Ga0496108_0034131 3300048911 Bacteria 4227
666 Ga0496108_0056436 3300048911 Bacteria 3299
667 Ga0496109_0000186 3300048912 Bacteria 62084
668 Ga0496109_0025701 3300048912 Bacteria 5248
669 Ga0496109_0156658 3300048912 Bacteria 2133
670 Ga0496109_0176532 3300048912 Bacteria 2005
671 Ga0496109_0178517 3300048912 Bacteria 1994
672 Ga0496110_0020387 3300048913 Bacteria 5599
673 Ga0496110_0022488 3300048913 Bacteria 5355
674 Ga0496111_0044120 3300048914 Unclassified 3205
675 Ga0496111_0083807 3300048914 Bacteria 2330
676 Ga0496112_0115992 3300048915 Bacteria 2648
677 Ga0496113_0001663 3300048916 Bacteria 12569
678 Ga0496114_0025999 3300048917 Unclassified 4789
679 Ga0496114_0076223 3300048917 Bacteria 2825
680 Ga0496114_0139289 3300048917 Unclassified 2099
681 Ga0496115_0007404 3300048918 Bacteria 8076
682 Ga0496115_0013246 3300048918 Bacteria 6231
683 Ga0496115_0073757 3300048918 Bacteria 2770
684 Ga0496115_0099732 3300048918 Bacteria 2380
685 Ga0501031_0002359 3300049568 Bacteria 11972
686 Ga0501032_0016805 3300049569 Bacteria 5142
687 Ga0501033_0018743 3300049570 Bacteria 5230
688 Ga0501036_0050405 3300049572 Bacteria 3525
689 Ga0501037_0035553 3300049573 Bacteria 3673
690 Ga0501038_0032902 3300049574 Bacteria 4569
691 Ga0501039_0047666 3300049575 Bacteria 3312
692 Ga0501043_0071175 3300049579 Bacteria 2732
693 Ga0501047_0008787 3300049581 Bacteria 9533
694 Ga0501047_0019730 3300049581 Bacteria 6470
695 Ga0501047_0040644 3300049581 Bacteria 4497
696 Ga0501073_0034839 3300049589 Bacteria 3581
697 Ga0501083_0023331 3300049744 Bacteria 4292
698 Ga0501035_0168441 3300049822 Bacteria 1893
699 Ga0501044_0080989 3300049823 Bacteria 3287
700 Ga0501044_0103888 3300049823 Bacteria 2856
701 nmdc:mga03683_29867_c1 3300050489 Bacteria 2177
702 nmdc:mga06z11_13108_c1 3300050494 Bacteria 3629
703 nmdc:mga05p37_2212_c1 3300050507 Bacteria 22652
704 nmdc:mga09592_6462_c1 3300050508 Bacteria 9543
705 nmdc:mga0qj67_18742_c1 3300050509 Bacteria 5277
706 nmdc:mga08y16_1219_c1 3300050511 Bacteria 25435
707 nmdc:mga08y16_311_c1 3300050511 Bacteria 43954
708 nmdc:mga08y16_3545_c1 3300050511 Bacteria 16207
709 nmdc:mga0n895_141846_c1 3300050512 Bacteria 2431
710 nmdc:mga0n895_15841_c1 3300050512 Bacteria 6894
711 nmdc:mga0n895_1869_c1 3300050512 Bacteria 16078
712 nmdc:mga0n895_62_c1 3300050512 Bacteria 62891
713 nmdc:mga0rr50_2956_c1 3300050513 Bacteria 9720
714 nmdc:mga08x19_27777_c1 3300050514 Bacteria 3541
715 nmdc:mga0a205_1191_c1 3300050515 Bacteria 21722
716 nmdc:mga0a205_2311_c1 3300050515 Bacteria 12212
717 nmdc:mga0sz30_41485_c1 3300050516 Bacteria 1935
718 Ga0495601_0000004 3300053077 Bacteria 449178
719 Ga0495601_0000109 3300053077 Bacteria 45069
720 Ga0495601_0002506 3300053077 Bacteria 10450
721 Ga0495601_0006125 3300053077 Bacteria 7019
722 Ga0495601_0009758 3300053077 Bacteria 5677
723 Ga0495601_0053399 3300053077 Bacteria 2554
724 Ga0495612_0000013 3300053078 Bacteria 198142
725 Ga0495612_0000953 3300053078 Bacteria 11879
726 Ga0495612_0002655 3300053078 Bacteria 7376
727 Ga0495612_0006674 3300053078 Bacteria 4733
728 Ga0495612_0036372 3300053078 Bacteria 1998
729 Ga0495595_0000034 3300053084 Bacteria 82597
730 Ga0495595_0001271 3300053084 Bacteria 9824
731 Ga0495595_0005318 3300053084 Bacteria 5205
732 Ga0495595_0005872 3300053084 Bacteria 4976
733 Ga0495595_0019136 3300053084 Bacteria 2968
734 Ga0495595_0026712 3300053084 Bacteria 2566
735 Ga0495595_0041456 3300053084 Bacteria 2106
736 Ga0495619_0000005 3300053085 Bacteria 418061
737 Ga0495619_0000289 3300053085 Bacteria 35778
738 Ga0495619_0000662 3300053085 Bacteria 22563
739 Ga0495619_0002507 3300053085 Bacteria 12025
740 Ga0495619_0003722 3300053085 Bacteria 9828
741 Ga0495619_0004938 3300053085 Bacteria 8470
742 Ga0495619_0007879 3300053085 Bacteria 6740
743 Ga0495619_0163078 3300053085 Bacteria 1540
744 Ga0500643_002483 3300053087 Bacteria 9484
745 Ga0500644_0000860 3300053088 Bacteria 9944
746 Ga0500651_0051669 3300053093 Bacteria 2578
747 Ga0500566_0019219 3300053094 Bacteria 4011
748 Ga0500641_0015147 3300053096 Bacteria 2856
749 Ga0500595_000062 3300053119 Bacteria 77506
750 Ga0500595_013389 3300053119 Bacteria 3143
751 Ga0500652_000003 3300053131 Bacteria 221528
752 Ga0500616_0000006 3300053153 Bacteria 944738
753 Ga0500636_0049021 3300053177 Bacteria 2485
754 Ga0500645_000101 3300053730 Bacteria 68128
755 Ga0501084_0067012 3300054114 Bacteria 3005
756 Ga0501082_0067452 3300060353 Bacteria 3081
757 Ga0501082_0148485 3300060353 Bacteria 2036

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046663 Ga0495635_0121632 Ga0495635_0121632_11_1171 383
2 3300006914 Ga0075436_100007051 Ga0075436_1000070515 389
3 3300031247 Ga0265340_10005195 Ga0265340_100051958 391
4 3300005983 Ga0081540_1029140 Ga0081540_10291404 392
5 3300009553 Ga0105249_10003839 Ga0105249_100038394 394
6 3300050512 nmdc:mga0n895_15841_c1 nmdc:mga0n895_15841_c1_773_2071 395
7 3300025940 Ga0207691_10077212 Ga0207691_100772122 398
8 3300026118 Ga0207675_100163364 Ga0207675_1001633642 398
9 3300031238 Ga0265332_10000899 Ga0265332_1000089913 398
10 3300031249 Ga0265339_10058197 Ga0265339_100581973 398
11 3300031712 Ga0265342_10000392 Ga0265342_1000039245 398
12 3300049579 Ga0501043_0071175 Ga0501043_0071175_510_1859 398
13 3300049823 Ga0501044_0080989 Ga0501044_0080989_354_1703 398
14 3300025933 Ga0207706_10015924 Ga0207706_100159242 401
15 3300026088 Ga0207641_10150637 Ga0207641_101506372 401
16 3300039438 Ga0436360_0097535 Ga0436360_0097535_260_1477 401
17 3300046529 Ga0495652_0118954 Ga0495652_0118954_98_1315 401
18 3300048912 Ga0496109_0156658 Ga0496109_0156658_413_1621 401
19 3300005444 Ga0070694_100216330 Ga0070694_1002163301 402
20 3300005458 Ga0070681_10009120 Ga0070681_100091205 402
21 3300005468 Ga0070707_100013936 Ga0070707_1000139362 402
22 3300025922 Ga0207646_10069016 Ga0207646_100690162 402
23 3300047322 Ga0495680_0017612 Ga0495680_0017612_3296_4510 402
24 3300003911 JGI25405J52794_10001495 JGI25405J52794_100014955 404
25 3300005329 Ga0070683_100161317 Ga0070683_1001613172 404
26 3300005437 Ga0070710_10087694 Ga0070710_100876943 404
27 3300005458 Ga0070681_10090702 Ga0070681_100907023 404
28 3300005563 Ga0068855_100201967 Ga0068855_1002019672 404
29 3300005937 Ga0081455_10010063 Ga0081455_100100636 404
30 3300010375 Ga0105239_10288996 Ga0105239_102889963 404
31 3300025915 Ga0207693_10011496 Ga0207693_100114969 404
32 3300025917 Ga0207660_10114085 Ga0207660_101140852 404
33 3300026116 Ga0207674_10197434 Ga0207674_101974342 404
34 3300005327 Ga0070658_10028026 Ga0070658_100280263 405
35 3300005329 Ga0070683_100000695 Ga0070683_10000069515 405
36 3300005331 Ga0070670_100000442 Ga0070670_1000004427 405
37 3300005338 Ga0068868_100000127 Ga0068868_10000012716 405
38 3300005344 Ga0070661_100000589 Ga0070661_10000058915 405
39 3300005354 Ga0070675_100000082 Ga0070675_10000008236 405
40 3300005355 Ga0070671_100000405 Ga0070671_1000004055 405
41 3300005364 Ga0070673_100002161 Ga0070673_1000021616 405
42 3300005367 Ga0070667_100094121 Ga0070667_1000941212 405
43 3300005456 Ga0070678_100000014 Ga0070678_10000001421 405
44 3300005459 Ga0068867_100002202 Ga0068867_1000022027 405
45 3300005535 Ga0070684_100007137 Ga0070684_1000071375 405
46 3300005543 Ga0070672_100000029 Ga0070672_10000002948 405
47 3300005548 Ga0070665_100070658 Ga0070665_1000706581 405
48 3300005564 Ga0070664_100000124 Ga0070664_10000012414 405
49 3300005615 Ga0070702_100008129 Ga0070702_1000081296 405
50 3300005616 Ga0068852_100000016 Ga0068852_100000016104 405
51 3300005618 Ga0068864_100000823 Ga0068864_10000082324 405
52 3300005834 Ga0068851_10001223 Ga0068851_100012235 405
53 3300005841 Ga0068863_100013344 Ga0068863_1000133446 405
54 3300005983 Ga0081540_1041402 Ga0081540_10414024 405
55 3300006237 Ga0097621_100000482 Ga0097621_1000004823 405
56 3300006358 Ga0068871_100000050 Ga0068871_10000005043 405
57 3300009098 Ga0105245_10213849 Ga0105245_102138492 405
58 3300009177 Ga0105248_10065290 Ga0105248_100652902 405
59 3300013105 Ga0157369_10209362 Ga0157369_102093622 405
60 3300013296 Ga0157374_10000321 Ga0157374_100003219 405
61 3300013297 Ga0157378_10005246 Ga0157378_100052465 405
62 3300013306 Ga0163162_10002192 Ga0163162_100021922 405
63 3300013308 Ga0157375_10000627 Ga0157375_1000062714 405
64 3300025321 Ga0207656_10002239 Ga0207656_100022395 405
65 3300025909 Ga0207705_10030075 Ga0207705_100300753 405
66 3300025920 Ga0207649_10001315 Ga0207649_100013159 405
67 3300025925 Ga0207650_10001028 Ga0207650_1000102812 405
68 3300025926 Ga0207659_10001108 Ga0207659_1000110813 405
69 3300025931 Ga0207644_10000157 Ga0207644_1000015749 405
70 3300025940 Ga0207691_10000212 Ga0207691_1000021219 405
71 3300025944 Ga0207661_10002054 Ga0207661_100020544 405
72 3300025945 Ga0207679_10001608 Ga0207679_1000160813 405
73 3300025960 Ga0207651_10002529 Ga0207651_100025293 405
74 3300025986 Ga0207658_10028749 Ga0207658_100287494 405
75 3300026023 Ga0207677_10001004 Ga0207677_100010047 405
76 3300026089 Ga0207648_10008450 Ga0207648_100084503 405
77 3300026095 Ga0207676_10010020 Ga0207676_100100206 405
78 3300026121 Ga0207683_10000010 Ga0207683_10000010107 405
79 3300026142 Ga0207698_10000086 Ga0207698_1000008613 405
80 3300028379 Ga0268266_10272953 Ga0268266_102729531 405
81 3300048911 Ga0496108_0034131 Ga0496108_0034131_2161_3411 405
82 3300048912 Ga0496109_0025701 Ga0496109_0025701_1118_2368 405
83 3300048914 Ga0496111_0044120 Ga0496111_0044120_1707_2957 405
84 3300048917 Ga0496114_0025999 Ga0496114_0025999_2647_3897 405
85 3300060353 Ga0501082_0148485 Ga0501082_0148485_75_1343 405
86 3300046526 Ga0495666_0070652 Ga0495666_0070652_15_1238 406
87 3300005985 Ga0081539_10002257 Ga0081539_1000225728 407
88 3300005548 Ga0070665_100116586 Ga0070665_1001165864 408
89 3300005844 Ga0068862_100067930 Ga0068862_1000679302 408
90 3300005983 Ga0081540_1000397 Ga0081540_100039724 408
91 3300025315 Ga0207697_10003212 Ga0207697_100032126 408
92 3300025893 Ga0207682_10009271 Ga0207682_100092714 408
93 3300025907 Ga0207645_10013754 Ga0207645_100137544 408
94 3300025934 Ga0207686_10032093 Ga0207686_100320934 408
95 3300025942 Ga0207689_10036829 Ga0207689_100368294 408
96 3300025960 Ga0207651_10112640 Ga0207651_101126402 408
97 3300025961 Ga0207712_10102257 Ga0207712_101022573 408
98 3300026075 Ga0207708_10010877 Ga0207708_100108774 408
99 3300048912 Ga0496109_0178517 Ga0496109_0178517_658_1920 408
100 3300006048 Ga0075363_100018321 Ga0075363_1000183212 410
101 3300035113 Ga0373936_0002157 Ga0373936_0002157_3720_4973 411
102 3300035171 Ga0373946_0033500 Ga0373946_0033500_714_1967 411
103 3300035172 Ga0373955_0001110 Ga0373955_0001110_10078_11331 411
104 3300035410 Ga0373924_0001227 Ga0373924_0001227_1157_2410 411
105 3300035692 Ga0373935_0000208 Ga0373935_0000208_24898_26151 411
106 3300035695 Ga0373927_0001804 Ga0373927_0001804_7863_9116 411
107 3300035724 Ga0373933_0020736 Ga0373933_0020736_1931_3184 411
108 3300035725 Ga0373947_0006947 Ga0373947_0006947_2003_3256 411
109 3300036401 Ga0373937_0000031 Ga0373937_0000031_87519_88772 411
110 3300037068 Ga0373925_0000063 Ga0373925_0000063_91152_92405 411
111 3300046454 Ga0495592_0000072 Ga0495592_0000072_71605_72858 411
112 3300046459 Ga0495629_0041363 Ga0495629_0041363_1322_2575 411
113 3300046462 Ga0495651_0001167 Ga0495651_0001167_5490_6743 411
114 3300046463 Ga0495653_0000020 Ga0495653_0000020_106211_107464 411
115 3300046476 Ga0495662_0032474 Ga0495662_0032474_911_2164 411
116 3300046477 Ga0495664_0000006 Ga0495664_0000006_80311_81564 411
117 3300046511 Ga0495608_0000002 Ga0495608_0000002_80259_81512 411
118 3300046514 Ga0495618_0000017 Ga0495618_0000017_61679_62932 411
119 3300046516 Ga0495628_0000004 Ga0495628_0000004_346847_348100 411
120 3300046517 Ga0495630_0002120 Ga0495630_0002120_7223_8476 411
121 3300046529 Ga0495652_0000007 Ga0495652_0000007_336429_337682 411
122 3300046531 Ga0495665_0091746 Ga0495665_0091746_165_1418 411
123 3300046533 Ga0495640_0000004 Ga0495640_0000004_102376_103629 411
124 3300046536 Ga0495587_0000002 Ga0495587_0000002_343783_345036 411
125 3300046543 Ga0495645_0000008 Ga0495645_0000008_249897_251150 411
126 3300046559 Ga0495667_0000010 Ga0495667_0000010_135143_136396 411
127 3300046642 Ga0495634_0000603 Ga0495634_0000603_32773_34026 411
128 3300046663 Ga0495635_0000004 Ga0495635_0000004_102332_103585 411
129 3300046675 Ga0495657_0000051 Ga0495657_0000051_20047_21300 411
130 3300046678 Ga0495599_0000003 Ga0495599_0000003_237508_238761 411
131 3300046679 Ga0495623_0000009 Ga0495623_0000009_67337_68590 411
132 3300046680 Ga0495646_0000001 Ga0495646_0000001_80368_81621 411
133 3300046690 Ga0495624_0042593 Ga0495624_0042593_776_2029 411
134 3300046809 Ga0495600_0000008 Ga0495600_0000008_66279_67532 411
135 3300047317 Ga0495604_0000003 Ga0495604_0000003_80233_81486 411
136 3300047319 Ga0495674_0000021 Ga0495674_0000021_44708_45961 411
137 3300047322 Ga0495680_0000505 Ga0495680_0000505_16431_17684 411
138 3300047444 Ga0495675_0000466 Ga0495675_0000466_20041_21294 411
139 3300047471 Ga0495684_0000050 Ga0495684_0000050_80354_81607 411
140 3300047673 Ga0495593_0000394 Ga0495593_0000394_5117_6370 411
141 3300048088 Ga0495602_0000012 Ga0495602_0000012_119041_120294 411
142 3300053077 Ga0495601_0000004 Ga0495601_0000004_367466_368719 411
143 3300053078 Ga0495612_0000013 Ga0495612_0000013_116521_117774 411
144 3300053084 Ga0495595_0000034 Ga0495595_0000034_935_2188 411
145 3300053085 Ga0495619_0000005 Ga0495619_0000005_80374_81627 411
146 3300003659 JGI25404J52841_10001193 JGI25404J52841_100011935 412
147 3300005983 Ga0081540_1004355 Ga0081540_10043554 412
148 3300009176 Ga0105242_10026443 Ga0105242_100264434 413
149 3300009177 Ga0105248_10094971 Ga0105248_100949714 413
150 3300013100 Ga0157373_10232834 Ga0157373_102328341 413
151 3300013104 Ga0157370_10033080 Ga0157370_100330806 413
152 3300013296 Ga0157374_10326059 Ga0157374_103260592 413
153 3300013297 Ga0157378_10052863 Ga0157378_100528634 413
154 3300014968 Ga0157379_10185697 Ga0157379_101856972 413
155 3300028577 Ga0265318_10001682 Ga0265318_100016826 413
156 3300031235 Ga0265330_10026680 Ga0265330_100266802 413
157 3300031238 Ga0265332_10003866 Ga0265332_100038664 413
158 3300031239 Ga0265328_10002574 Ga0265328_100025745 413
159 3300031240 Ga0265320_10042060 Ga0265320_100420602 413
160 3300031250 Ga0265331_10009401 Ga0265331_100094015 413
161 3300031344 Ga0265316_10027190 Ga0265316_100271902 413
162 3300031711 Ga0265314_10006115 Ga0265314_100061155 413
163 3300036401 Ga0373937_0132067 Ga0373937_0132067_918_2297 413
164 3300046683 Ga0495658_0018082 Ga0495658_0018082_1752_3032 413
165 3300048917 Ga0496114_0139289 Ga0496114_0139289_372_1652 413
166 3300049589 Ga0501073_0034839 Ga0501073_0034839_124_1368 413
167 3300031595 Ga0265313_10036282 Ga0265313_100362822 414
168 3300053085 Ga0495619_0163078 Ga0495619_0163078_88_1335 414
169 iso_pu_bacteria 2643221547 2643756040 414
170 3300005290 Ga0065712_10113325 Ga0065712_101133252 415
171 3300005293 Ga0065715_10145512 Ga0065715_101455121 415
172 3300005330 Ga0070690_100023814 Ga0070690_1000238142 415
173 3300005331 Ga0070670_100072582 Ga0070670_1000725822 415
174 3300005547 Ga0070693_100140072 Ga0070693_1001400721 415
175 3300005564 Ga0070664_100040344 Ga0070664_1000403442 415
176 3300006178 Ga0075367_10102230 Ga0075367_101022302 415
177 3300006871 Ga0075434_100134451 Ga0075434_1001344512 415
178 3300009101 Ga0105247_10007491 Ga0105247_1000749110 415
179 3300009177 Ga0105248_10031579 Ga0105248_100315792 415
180 3300014325 Ga0163163_10004844 Ga0163163_100048449 415
181 3300025900 Ga0207710_10021318 Ga0207710_100213184 415
182 3300025941 Ga0207711_10066716 Ga0207711_100667164 415
183 3300025945 Ga0207679_10036844 Ga0207679_100368442 415
184 3300047319 Ga0495674_0257984 Ga0495674_0257984_92_1366 415
185 3300048915 Ga0496112_0115992 Ga0496112_0115992_125_1390 415
186 3300048916 Ga0496113_0001663 Ga0496113_0001663_9584_10849 415
187 3300050512 nmdc:mga0n895_141846_c1 nmdc:mga0n895_141846_c1_191_1465 415
188 3300005367 Ga0070667_100108839 Ga0070667_1001088392 416
189 3300005618 Ga0068864_100062981 Ga0068864_1000629811 416
190 3300009098 Ga0105245_10002287 Ga0105245_1000228712 416
191 3300009176 Ga0105242_10127768 Ga0105242_101277682 416
192 3300009177 Ga0105248_10009137 Ga0105248_100091376 416
193 3300025927 Ga0207687_10012658 Ga0207687_100126584 416
194 3300025928 Ga0207700_10053149 Ga0207700_100531494 416
195 3300025941 Ga0207711_10032883 Ga0207711_100328834 416
196 3300025960 Ga0207651_10101216 Ga0207651_101012163 416
197 3300025986 Ga0207658_10074481 Ga0207658_100744813 416
198 3300048907 Ga0496104_0097659 Ga0496104_0097659_1064_2335 416
199 3300053084 Ga0495595_0019136 Ga0495595_0019136_1003_2274 416
200 3300003659 JGI25404J52841_10005069 JGI25404J52841_100050692 417
201 3300005983 Ga0081540_1000518 Ga0081540_100051830 417
202 3300046557 Ga0495622_0028312 Ga0495622_0028312_308_1582 417
203 3300049581 Ga0501047_0040644 Ga0501047_0040644_2279_3565 417
204 3300053094 Ga0500566_0019219 Ga0500566_0019219_1568_2836 417
205 3300053119 Ga0500595_013389 Ga0500595_013389_1205_2473 417
206 3300053131 Ga0500652_000003 Ga0500652_000003_142581_143849 417
207 3300053177 Ga0500636_0049021 Ga0500636_0049021_108_1376 417
208 3300003659 JGI25404J52841_10000210 JGI25404J52841_100002102 418
209 3300005327 Ga0070658_10059506 Ga0070658_100595062 418
210 3300005329 Ga0070683_100026861 Ga0070683_1000268616 418
211 3300005439 Ga0070711_100101812 Ga0070711_1001018122 418
212 3300005458 Ga0070681_10091827 Ga0070681_100918272 418
213 3300005530 Ga0070679_100143328 Ga0070679_1001433282 418
214 3300005937 Ga0081455_10014701 Ga0081455_100147016 418
215 3300005983 Ga0081540_1000293 Ga0081540_100029321 418
216 3300005983 Ga0081540_1005808 Ga0081540_10058083 418
217 3300005983 Ga0081540_1009145 Ga0081540_10091452 418
218 3300005985 Ga0081539_10015916 Ga0081539_100159162 418
219 3300006042 Ga0075368_10033949 Ga0075368_100339491 418
220 3300006177 Ga0075362_10020225 Ga0075362_100202251 418
221 3300006186 Ga0075369_10012498 Ga0075369_100124984 418
222 3300020070 Ga0206356_10402258 Ga0206356_104022582 418
223 3300025921 Ga0207652_10111632 Ga0207652_101116322 418
224 3300025944 Ga0207661_10044792 Ga0207661_100447923 418
225 3300031730 Ga0307516_10009407 Ga0307516_100094073 418
226 3300031730 Ga0307516_10043262 Ga0307516_100432625 418
227 3300049581 Ga0501047_0008787 Ga0501047_0008787_1434_2738 418
228 3300049744 Ga0501083_0023331 Ga0501083_0023331_1032_2336 418
229 3300049823 Ga0501044_0103888 Ga0501044_0103888_901_2205 418
230 3300050489 nmdc:mga03683_29867_c1 nmdc:mga03683_29867_c1_549_1820 418
231 3300050516 nmdc:mga0sz30_41485_c1 nmdc:mga0sz30_41485_c1_561_1832 418
232 3300053096 Ga0500641_0015147 Ga0500641_0015147_1470_2741 418
233 3300060353 Ga0501082_0067452 Ga0501082_0067452_85_1389 418
234 iso_pu_bacteria 2513237161 2514017097 418
235 iso_pu_bacteria 2935608549 2935613684 418
236 iso_pu_bacteria 2935760218 2935767995 418
237 3300005545 Ga0070695_100003239 Ga0070695_1000032394 419
238 3300025906 Ga0207699_10097860 Ga0207699_100978602 419
239 3300031711 Ga0265314_10000784 Ga0265314_1000078411 419
240 3300035086 Ga0373934_0021715 Ga0373934_0021715_255_1517 419
241 3300035172 Ga0373955_0003230 Ga0373955_0003230_5614_6876 419
242 3300035724 Ga0373933_0023745 Ga0373933_0023745_251_1513 419
243 3300046559 Ga0495667_0113573 Ga0495667_0113573_74_1336 419
244 3300046809 Ga0495600_0052308 Ga0495600_0052308_731_1993 419
245 3300047322 Ga0495680_0022232 Ga0495680_0022232_912_2174 419
246 3300053077 Ga0495601_0053399 Ga0495601_0053399_1013_2275 419
247 3300053078 Ga0495612_0036372 Ga0495612_0036372_586_1848 419
248 3300053084 Ga0495595_0041456 Ga0495595_0041456_30_1292 419
249 3300053087 Ga0500643_002483 Ga0500643_002483_7130_8395 419
250 3300053088 Ga0500644_0000860 Ga0500644_0000860_7884_9149 419
251 3300053119 Ga0500595_000062 Ga0500595_000062_16802_18067 419
252 3300053153 Ga0500616_0000006 Ga0500616_0000006_806805_808070 419
253 3300005436 Ga0070713_100149309 Ga0070713_1001493092 420
254 3300005983 Ga0081540_1009059 Ga0081540_10090592 420
255 3300006058 Ga0075432_10031917 Ga0075432_100319172 420
256 3300006846 Ga0075430_100000627 Ga0075430_10000062723 420
257 3300006852 Ga0075433_10000615 Ga0075433_1000061512 420
258 3300006880 Ga0075429_100000877 Ga0075429_1000008778 420
259 3300007076 Ga0075435_100001540 Ga0075435_10000154010 420
260 3300009094 Ga0111539_10000423 Ga0111539_100004238 420
261 3300027907 Ga0207428_10000188 Ga0207428_1000018819 420
262 3300035083 Ga0373926_0006103 Ga0373926_0006103_1853_3118 420
263 3300035113 Ga0373936_0055452 Ga0373936_0055452_157_1476 420
264 3300035172 Ga0373955_0113162 Ga0373955_0113162_288_1553 420
265 3300035692 Ga0373935_0015490 Ga0373935_0015490_2886_4151 420
266 3300035725 Ga0373947_0018365 Ga0373947_0018365_884_2203 420
267 3300046455 Ga0495603_0037807 Ga0495603_0037807_1495_2760 420
268 3300046460 Ga0495638_0040160 Ga0495638_0040160_979_2247 420
269 3300046463 Ga0495653_0038789 Ga0495653_0038789_36_1301 420
270 3300046472 Ga0495580_0175931 Ga0495580_0175931_61_1326 420
271 3300046476 Ga0495662_0025797 Ga0495662_0025797_1377_2696 420
272 3300046477 Ga0495664_0021710 Ga0495664_0021710_531_1850 420
273 3300046529 Ga0495652_0077885 Ga0495652_0077885_567_1886 420
274 3300046559 Ga0495667_0104514 Ga0495667_0104514_432_1697 420
275 3300046663 Ga0495635_0091274 Ga0495635_0091274_194_1513 420
276 3300046683 Ga0495658_0139104 Ga0495658_0139104_183_1448 420
277 3300046689 Ga0495613_0038188 Ga0495613_0038188_619_1938 420
278 3300050507 nmdc:mga05p37_2212_c1 nmdc:mga05p37_2212_c1_7448_8719 420
279 3300050508 nmdc:mga09592_6462_c1 nmdc:mga09592_6462_c1_5594_6865 420
280 3300050509 nmdc:mga0qj67_18742_c1 nmdc:mga0qj67_18742_c1_2679_3950 420
281 3300050511 nmdc:mga08y16_3545_c1 nmdc:mga08y16_3545_c1_13010_14281 420
282 3300050512 nmdc:mga0n895_1869_c1 nmdc:mga0n895_1869_c1_12001_13272 420
283 3300050513 nmdc:mga0rr50_2956_c1 nmdc:mga0rr50_2956_c1_7313_8584 420
284 3300050515 nmdc:mga0a205_1191_c1 nmdc:mga0a205_1191_c1_328_1599 420
285 3300053077 Ga0495601_0002506 Ga0495601_0002506_2960_4279 420
286 3300053078 Ga0495612_0006674 Ga0495612_0006674_621_1940 420
287 3300053085 Ga0495619_0004938 Ga0495619_0004938_1560_2879 420
288 3300053093 Ga0500651_0051669 Ga0500651_0051669_63_1331 420
289 2209111006 2214745219 2213754919 421
290 3300000041 ARcpr5oldR_c000117 ARcpr5oldR_00011718 421
291 3300000652 ARCol0yngRDRAFT_1000003 ARCol0yngRDRAFT_100000325 421
292 3300001989 JGI24739J22299_10002682 JGI24739J22299_100026822 421
293 3300001990 JGI24737J22298_10000992 JGI24737J22298_100009926 421
294 3300001990 JGI24737J22298_10003261 JGI24737J22298_100032614 421
295 3300002070 JGI24750J21931_1000480 JGI24750J21931_10004809 421
296 3300002073 JGI24745J21846_1002842 JGI24745J21846_10028422 421
297 3300002074 JGI24748J21848_1000438 JGI24748J21848_10004382 421
298 3300002075 JGI24738J21930_10001848 JGI24738J21930_100018481 421
299 3300002076 JGI24749J21850_1000392 JGI24749J21850_10003929 421
300 3300002077 JGI24744J21845_10004046 JGI24744J21845_100040462 421
301 3300002126 JGI24035J26624_1000144 JGI24035J26624_10001448 421
302 3300002239 JGI24034J26672_10000590 JGI24034J26672_100005907 421
303 3300002244 JGI24742J22300_10000041 JGI24742J22300_100000419 421
304 3300005277 Ga0065716_1001888 Ga0065716_10018882 421
305 3300005289 Ga0065704_10080219 Ga0065704_100802194 421
306 3300005290 Ga0065712_10000247 Ga0065712_100002478 421
307 3300005293 Ga0065715_10003780 Ga0065715_100037803 421
308 3300005293 Ga0065715_10089103 Ga0065715_100891039 421
309 3300005328 Ga0070676_10000036 Ga0070676_1000003627 421
310 3300005328 Ga0070676_10066362 Ga0070676_100663621 421
311 3300005329 Ga0070683_100000898 Ga0070683_1000008982 421
312 3300005329 Ga0070683_100320775 Ga0070683_1003207751 421
313 3300005330 Ga0070690_100000402 Ga0070690_10000040215 421
314 3300005330 Ga0070690_100035779 Ga0070690_1000357792 421
315 3300005330 Ga0070690_100144204 Ga0070690_1001442042 421
316 3300005331 Ga0070670_100016727 Ga0070670_1000167272 421
317 3300005331 Ga0070670_100085242 Ga0070670_1000852422 421
318 3300005333 Ga0070677_10000124 Ga0070677_1000012420 421
319 3300005334 Ga0068869_100000087 Ga0068869_10000008730 421
320 3300005335 Ga0070666_10044947 Ga0070666_100449474 421
321 3300005336 Ga0070680_100066910 Ga0070680_1000669102 421
322 3300005336 Ga0070680_100073406 Ga0070680_1000734062 421
323 3300005337 Ga0070682_100000341 Ga0070682_10000034116 421
324 3300005337 Ga0070682_100022461 Ga0070682_1000224612 421
325 3300005337 Ga0070682_100132866 Ga0070682_1001328662 421
326 3300005338 Ga0068868_100007585 Ga0068868_1000075854 421
327 3300005338 Ga0068868_100023195 Ga0068868_1000231954 421
328 3300005339 Ga0070660_100076282 Ga0070660_1000762822 421
329 3300005340 Ga0070689_100002790 Ga0070689_1000027903 421
330 3300005341 Ga0070691_10004809 Ga0070691_100048098 421
331 3300005341 Ga0070691_10008048 Ga0070691_100080482 421
332 3300005343 Ga0070687_100005901 Ga0070687_1000059014 421
333 3300005344 Ga0070661_100000017 Ga0070661_10000001795 421
334 3300005344 Ga0070661_100063833 Ga0070661_1000638333 421
335 3300005345 Ga0070692_10000018 Ga0070692_100000184 421
336 3300005347 Ga0070668_100001356 Ga0070668_1000013569 421
337 3300005347 Ga0070668_100111063 Ga0070668_1001110632 421
338 3300005353 Ga0070669_100000217 Ga0070669_10000021727 421
339 3300005354 Ga0070675_100000088 Ga0070675_10000008830 421
340 3300005354 Ga0070675_100060091 Ga0070675_1000600914 421
341 3300005355 Ga0070671_100011124 Ga0070671_1000111242 421
342 3300005355 Ga0070671_100020068 Ga0070671_1000200685 421
343 3300005355 Ga0070671_100075228 Ga0070671_1000752283 421
344 3300005364 Ga0070673_100000239 Ga0070673_10000023915 421
345 3300005364 Ga0070673_100031259 Ga0070673_1000312593 421
346 3300005365 Ga0070688_100000084 Ga0070688_10000008424 421
347 3300005365 Ga0070688_100003883 Ga0070688_1000038836 421
348 3300005365 Ga0070688_100016483 Ga0070688_1000164834 421
349 3300005367 Ga0070667_100003023 Ga0070667_10000302319 421
350 3300005367 Ga0070667_100096956 Ga0070667_1000969563 421
351 3300005406 Ga0070703_10016932 Ga0070703_100169322 421
352 3300005434 Ga0070709_10000855 Ga0070709_1000085517 421
353 3300005434 Ga0070709_10004300 Ga0070709_100043009 421
354 3300005434 Ga0070709_10124055 Ga0070709_101240551 421
355 3300005436 Ga0070713_100002359 Ga0070713_10000235915 421
356 3300005436 Ga0070713_100004066 Ga0070713_1000040663 421
357 3300005436 Ga0070713_100031837 Ga0070713_1000318372 421
358 3300005437 Ga0070710_10003385 Ga0070710_100033851 421
359 3300005437 Ga0070710_10021169 Ga0070710_100211691 421
360 3300005437 Ga0070710_10029684 Ga0070710_100296842 421
361 3300005438 Ga0070701_10019817 Ga0070701_100198172 421
362 3300005439 Ga0070711_100077069 Ga0070711_1000770692 421
363 3300005439 Ga0070711_100137381 Ga0070711_1001373812 421
364 3300005440 Ga0070705_100000425 Ga0070705_10000042519 421
365 3300005440 Ga0070705_100076457 Ga0070705_1000764572 421
366 3300005441 Ga0070700_100000430 Ga0070700_1000004302 421
367 3300005441 Ga0070700_100034968 Ga0070700_1000349682 421
368 3300005444 Ga0070694_100000401 Ga0070694_10000040120 421
369 3300005444 Ga0070694_100010745 Ga0070694_1000107453 421
370 3300005445 Ga0070708_100026428 Ga0070708_1000264284 421
371 3300005455 Ga0070663_100032570 Ga0070663_1000325703 421
372 3300005456 Ga0070678_100000053 Ga0070678_10000005331 421
373 3300005456 Ga0070678_100022259 Ga0070678_1000222593 421
374 3300005456 Ga0070678_100030073 Ga0070678_1000300731 421
375 3300005458 Ga0070681_10000493 Ga0070681_1000049319 421
376 3300005458 Ga0070681_10013271 Ga0070681_100132718 421
377 3300005459 Ga0068867_100015926 Ga0068867_1000159265 421
378 3300005466 Ga0070685_10001195 Ga0070685_100011959 421
379 3300005530 Ga0070679_100000679 Ga0070679_10000067919 421
380 3300005530 Ga0070679_100042532 Ga0070679_1000425325 421
381 3300005530 Ga0070679_100122492 Ga0070679_1001224922 421
382 3300005535 Ga0070684_100000144 Ga0070684_10000014449 421
383 3300005535 Ga0070684_100174444 Ga0070684_1001744441 421
384 3300005543 Ga0070672_100000014 Ga0070672_10000001449 421
385 3300005544 Ga0070686_100002767 Ga0070686_10000276711 421
386 3300005545 Ga0070695_100000743 Ga0070695_1000007436 421
387 3300005545 Ga0070695_100007870 Ga0070695_1000078704 421
388 3300005545 Ga0070695_100065695 Ga0070695_1000656951 421
389 3300005546 Ga0070696_100000918 Ga0070696_1000009186 421
390 3300005547 Ga0070693_100000141 Ga0070693_1000001416 421
391 3300005547 Ga0070693_100058059 Ga0070693_1000580592 421
392 3300005548 Ga0070665_100069877 Ga0070665_1000698772 421
393 3300005549 Ga0070704_100008824 Ga0070704_1000088244 421
394 3300005549 Ga0070704_100014935 Ga0070704_1000149352 421
395 3300005564 Ga0070664_100038514 Ga0070664_1000385142 421
396 3300005577 Ga0068857_100001474 Ga0068857_1000014742 421
397 3300005578 Ga0068854_100000168 Ga0068854_10000016819 421
398 3300005614 Ga0068856_100000932 Ga0068856_10000093212 421
399 3300005615 Ga0070702_100019143 Ga0070702_1000191433 421
400 3300005617 Ga0068859_100071001 Ga0068859_1000710012 421
401 3300005617 Ga0068859_100093040 Ga0068859_1000930402 421
402 3300005618 Ga0068864_100088136 Ga0068864_1000881362 421
403 3300005719 Ga0068861_100000315 Ga0068861_10000031516 421
404 3300005840 Ga0068870_10000002 Ga0068870_1000000255 421
405 3300005841 Ga0068863_100067439 Ga0068863_1000674392 421
406 3300005842 Ga0068858_100000356 Ga0068858_10000035625 421
407 3300005842 Ga0068858_100059299 Ga0068858_1000592994 421
408 3300005843 Ga0068860_100000747 Ga0068860_10000074719 421
409 3300005843 Ga0068860_100315126 Ga0068860_1003151262 421
410 3300005844 Ga0068862_100000671 Ga0068862_1000006712 421
411 3300005937 Ga0081455_10000048 Ga0081455_10000048133 421
412 3300006028 Ga0070717_10003328 Ga0070717_1000332810 421
413 3300006173 Ga0070716_100002233 Ga0070716_1000022334 421
414 3300006173 Ga0070716_100031117 Ga0070716_1000311174 421
415 3300006175 Ga0070712_100046610 Ga0070712_1000466102 421
416 3300006237 Ga0097621_100000144 Ga0097621_10000014416 421
417 3300006237 Ga0097621_100008876 Ga0097621_1000088763 421
418 3300006237 Ga0097621_100026444 Ga0097621_1000264442 421
419 3300006358 Ga0068871_100000110 Ga0068871_10000011030 421
420 3300006358 Ga0068871_100015537 Ga0068871_1000155375 421
421 3300006358 Ga0068871_100108543 Ga0068871_1001085432 421
422 3300006852 Ga0075433_10179981 Ga0075433_101799812 421
423 3300006871 Ga0075434_100000084 Ga0075434_10000008423 421
424 3300006881 Ga0068865_100000066 Ga0068865_10000006631 421
425 3300006881 Ga0068865_100009015 Ga0068865_1000090153 421
426 3300006914 Ga0075436_100031219 Ga0075436_1000312192 421
427 3300006931 Ga0097620_100071001 Ga0097620_1000710012 421
428 3300006931 Ga0097620_100093043 Ga0097620_1000930432 421
429 3300007076 Ga0075435_100180757 Ga0075435_1001807572 421
430 3300009011 Ga0105251_10012262 Ga0105251_100122622 421
431 3300009094 Ga0111539_10000652 Ga0111539_1000065218 421
432 3300009094 Ga0111539_10001255 Ga0111539_1000125514 421
433 3300009098 Ga0105245_10000287 Ga0105245_1000028730 421
434 3300009098 Ga0105245_10038270 Ga0105245_100382702 421
435 3300009101 Ga0105247_10001223 Ga0105247_1000122318 421
436 3300009101 Ga0105247_10086615 Ga0105247_100866151 421
437 3300009148 Ga0105243_10000695 Ga0105243_1000069514 421
438 3300009148 Ga0105243_10013699 Ga0105243_100136993 421
439 3300009174 Ga0105241_10002331 Ga0105241_1000233119 421
440 3300009174 Ga0105241_10037102 Ga0105241_100371022 421
441 3300009176 Ga0105242_10000792 Ga0105242_1000079216 421
442 3300009176 Ga0105242_10006274 Ga0105242_100062748 421
443 3300009176 Ga0105242_10059085 Ga0105242_100590854 421
444 3300009177 Ga0105248_10000535 Ga0105248_1000053550 421
445 3300009177 Ga0105248_10065160 Ga0105248_100651603 421
446 3300009545 Ga0105237_10002795 Ga0105237_1000279516 421
447 3300009551 Ga0105238_10157027 Ga0105238_101570272 421
448 3300009553 Ga0105249_10000279 Ga0105249_1000027932 421
449 3300009553 Ga0105249_10361945 Ga0105249_103619451 421
450 3300010375 Ga0105239_10001686 Ga0105239_1000168613 421
451 3300010375 Ga0105239_10044533 Ga0105239_100445336 421
452 3300010375 Ga0105239_10074149 Ga0105239_100741495 421
453 3300011119 Ga0105246_10000095 Ga0105246_1000009526 421
454 3300013102 Ga0157371_10011031 Ga0157371_100110319 421
455 3300013296 Ga0157374_10001348 Ga0157374_1000134820 421
456 3300013297 Ga0157378_10000956 Ga0157378_1000095631 421
457 3300013297 Ga0157378_10094941 Ga0157378_100949412 421
458 3300013306 Ga0163162_10003795 Ga0163162_100037956 421
459 3300013307 Ga0157372_10009222 Ga0157372_100092224 421
460 3300013307 Ga0157372_10134988 Ga0157372_101349884 421
461 3300013308 Ga0157375_10000135 Ga0157375_100001353 421
462 3300013308 Ga0157375_10135433 Ga0157375_101354334 421
463 3300014325 Ga0163163_10124732 Ga0163163_101247322 421
464 3300014326 Ga0157380_10000052 Ga0157380_1000005233 421
465 3300014745 Ga0157377_10000076 Ga0157377_1000007619 421
466 3300014968 Ga0157379_10000060 Ga0157379_1000006057 421
467 3300014968 Ga0157379_10007831 Ga0157379_1000783111 421
468 3300014968 Ga0157379_10026823 Ga0157379_100268232 421
469 3300014969 Ga0157376_10000141 Ga0157376_1000014128 421
470 3300017792 Ga0163161_10026256 Ga0163161_100262565 421
471 3300025271 Ga0207666_1000005 Ga0207666_100000532 421
472 3300025271 Ga0207666_1000330 Ga0207666_10003305 421
473 3300025290 Ga0207673_1000002 Ga0207673_100000212 421
474 3300025315 Ga0207697_10000011 Ga0207697_1000001120 421
475 3300025885 Ga0207653_10007931 Ga0207653_100079315 421
476 3300025893 Ga0207682_10000051 Ga0207682_1000005138 421
477 3300025898 Ga0207692_10005372 Ga0207692_100053724 421
478 3300025898 Ga0207692_10028543 Ga0207692_100285431 421
479 3300025899 Ga0207642_10000229 Ga0207642_1000022915 421
480 3300025900 Ga0207710_10001284 Ga0207710_1000128417 421
481 3300025901 Ga0207688_10000001 Ga0207688_1000000138 421
482 3300025901 Ga0207688_10009124 Ga0207688_100091243 421
483 3300025903 Ga0207680_10029075 Ga0207680_100290755 421
484 3300025904 Ga0207647_10001714 Ga0207647_1000171420 421
485 3300025904 Ga0207647_10007690 Ga0207647_100076907 421
486 3300025905 Ga0207685_10004129 Ga0207685_100041292 421
487 3300025906 Ga0207699_10001161 Ga0207699_100011616 421
488 3300025907 Ga0207645_10000121 Ga0207645_1000012114 421
489 3300025907 Ga0207645_10023325 Ga0207645_100233256 421
490 3300025907 Ga0207645_10086216 Ga0207645_100862162 421
491 3300025908 Ga0207643_10000009 Ga0207643_1000000999 421
492 3300025911 Ga0207654_10043742 Ga0207654_100437424 421
493 3300025912 Ga0207707_10000840 Ga0207707_1000084019 421
494 3300025912 Ga0207707_10026208 Ga0207707_100262084 421
495 3300025915 Ga0207693_10003131 Ga0207693_1000313112 421
496 3300025915 Ga0207693_10058351 Ga0207693_100583512 421
497 3300025916 Ga0207663_10015462 Ga0207663_100154622 421
498 3300025917 Ga0207660_10021268 Ga0207660_100212686 421
499 3300025917 Ga0207660_10180614 Ga0207660_101806142 421
500 3300025918 Ga0207662_10000120 Ga0207662_100001208 421
501 3300025918 Ga0207662_10001791 Ga0207662_100017917 421
502 3300025919 Ga0207657_10002826 Ga0207657_100028269 421
503 3300025919 Ga0207657_10004971 Ga0207657_100049718 421
504 3300025919 Ga0207657_10081532 Ga0207657_100815321 421
505 3300025920 Ga0207649_10000052 Ga0207649_1000005231 421
506 3300025921 Ga0207652_10000508 Ga0207652_1000050815 421
507 3300025921 Ga0207652_10016692 Ga0207652_100166929 421
508 3300025921 Ga0207652_10098796 Ga0207652_100987963 421
509 3300025923 Ga0207681_10000035 Ga0207681_10000035108 421
510 3300025924 Ga0207694_10172192 Ga0207694_101721921 421
511 3300025925 Ga0207650_10000843 Ga0207650_1000084315 421
512 3300025925 Ga0207650_10078480 Ga0207650_100784802 421
513 3300025926 Ga0207659_10000027 Ga0207659_1000002730 421
514 3300025927 Ga0207687_10000231 Ga0207687_1000023114 421
515 3300025927 Ga0207687_10012582 Ga0207687_100125823 421
516 3300025928 Ga0207700_10000917 Ga0207700_1000091718 421
517 3300025928 Ga0207700_10021942 Ga0207700_100219422 421
518 3300025931 Ga0207644_10007559 Ga0207644_100075594 421
519 3300025932 Ga0207690_10000056 Ga0207690_100000567 421
520 3300025932 Ga0207690_10017319 Ga0207690_100173193 421
521 3300025933 Ga0207706_10000261 Ga0207706_1000026134 421
522 3300025933 Ga0207706_10004416 Ga0207706_1000441614 421
523 3300025933 Ga0207706_10014945 Ga0207706_100149455 421
524 3300025934 Ga0207686_10000171 Ga0207686_1000017128 421
525 3300025934 Ga0207686_10011564 Ga0207686_100115645 421
526 3300025935 Ga0207709_10000087 Ga0207709_10000087110 421
527 3300025936 Ga0207670_10000169 Ga0207670_1000016929 421
528 3300025936 Ga0207670_10017561 Ga0207670_100175613 421
529 3300025937 Ga0207669_10000351 Ga0207669_100003516 421
530 3300025938 Ga0207704_10000134 Ga0207704_1000013434 421
531 3300025939 Ga0207665_10000333 Ga0207665_1000033312 421
532 3300025940 Ga0207691_10000106 Ga0207691_1000010646 421
533 3300025941 Ga0207711_10086244 Ga0207711_100862442 421
534 3300025941 Ga0207711_10107904 Ga0207711_101079043 421
535 3300025942 Ga0207689_10000031 Ga0207689_1000003117 421
536 3300025942 Ga0207689_10031849 Ga0207689_100318495 421
537 3300025944 Ga0207661_10000219 Ga0207661_1000021914 421
538 3300025949 Ga0207667_10039261 Ga0207667_100392612 421
539 3300025960 Ga0207651_10010392 Ga0207651_100103924 421
540 3300025960 Ga0207651_10072873 Ga0207651_100728732 421
541 3300025960 Ga0207651_10099361 Ga0207651_100993612 421
542 3300025961 Ga0207712_10000176 Ga0207712_1000017629 421
543 3300025961 Ga0207712_10012238 Ga0207712_100122382 421
544 3300025972 Ga0207668_10000191 Ga0207668_1000019128 421
545 3300025972 Ga0207668_10115042 Ga0207668_101150422 421
546 3300025981 Ga0207640_10000126 Ga0207640_1000012619 421
547 3300025986 Ga0207658_10001331 Ga0207658_1000133114 421
548 3300025986 Ga0207658_10047022 Ga0207658_100470223 421
549 3300025986 Ga0207658_10071512 Ga0207658_100715123 421
550 3300026023 Ga0207677_10004460 Ga0207677_100044603 421
551 3300026035 Ga0207703_10007278 Ga0207703_100072787 421
552 3300026035 Ga0207703_10060365 Ga0207703_100603652 421
553 3300026041 Ga0207639_10000515 Ga0207639_100005156 421
554 3300026041 Ga0207639_10107499 Ga0207639_101074992 421
555 3300026067 Ga0207678_10000137 Ga0207678_1000013746 421
556 3300026067 Ga0207678_10019341 Ga0207678_100193411 421
557 3300026067 Ga0207678_10097972 Ga0207678_100979722 421
558 3300026075 Ga0207708_10000250 Ga0207708_1000025014 421
559 3300026075 Ga0207708_10004369 Ga0207708_100043695 421
560 3300026078 Ga0207702_10001067 Ga0207702_1000106717 421
561 3300026088 Ga0207641_10000937 Ga0207641_1000093731 421
562 3300026089 Ga0207648_10000125 Ga0207648_1000012546 421
563 3300026089 Ga0207648_10012120 Ga0207648_100121202 421
564 3300026095 Ga0207676_10001547 Ga0207676_1000154719 421
565 3300026116 Ga0207674_10000095 Ga0207674_1000009569 421
566 3300026118 Ga0207675_100000140 Ga0207675_10000014046 421
567 3300026118 Ga0207675_100010192 Ga0207675_1000101924 421
568 3300026121 Ga0207683_10000178 Ga0207683_1000017834 421
569 3300026121 Ga0207683_10001447 Ga0207683_100014479 421
570 3300026142 Ga0207698_10001736 Ga0207698_1000173617 421
571 3300027617 Ga0210002_1002682 Ga0210002_10026822 421
572 3300027682 Ga0209971_1003367 Ga0209971_10033672 421
573 3300027717 Ga0209998_10000790 Ga0209998_100007907 421
574 3300027717 Ga0209998_10001828 Ga0209998_100018284 421
575 3300027876 Ga0209974_10005676 Ga0209974_100056762 421
576 3300027876 Ga0209974_10019463 Ga0209974_100194632 421
577 3300027907 Ga0207428_10000037 Ga0207428_10000037132 421
578 3300027907 Ga0207428_10001468 Ga0207428_1000146825 421
579 3300028379 Ga0268266_10025953 Ga0268266_100259533 421
580 3300028380 Ga0268265_10000774 Ga0268265_1000077416 421
581 3300028381 Ga0268264_10000467 Ga0268264_1000046734 421
582 3300031241 Ga0265325_10000049 Ga0265325_1000004983 421
583 3300031595 Ga0265313_10036963 Ga0265313_100369634 421
584 3300034816 Ga0373930_0000027 Ga0373930_0000027_4716_5981 421
585 3300034817 Ga0373948_0000240 Ga0373948_0000240_3409_4674 421
586 3300034818 Ga0373950_0001487 Ga0373950_0001487_1040_2305 421
587 3300034819 Ga0373958_0000799 Ga0373958_0000799_213_1478 421
588 3300034819 Ga0373958_0001378 Ga0373958_0001378_705_1970 421
589 3300034957 Ga0373938_0000020 Ga0373938_0000020_7400_8665 421
590 3300034957 Ga0373938_0000482 Ga0373938_0000482_2087_3352 421
591 3300035084 Ga0373928_0001620 Ga0373928_0001620_1064_2329 421
592 3300035084 Ga0373928_0003098 Ga0373928_0003098_1256_2521 421
593 3300035084 Ga0373928_0004039 Ga0373928_0004039_1418_2686 421
594 3300035085 Ga0373929_0001458 Ga0373929_0001458_2932_4197 421
595 3300035090 Ga0373949_0000753 Ga0373949_0000753_1762_3027 421
596 3300035090 Ga0373949_0004305 Ga0373949_0004305_1239_2504 421
597 3300035091 Ga0373951_0001531 Ga0373951_0001531_424_1689 421
598 3300035091 Ga0373951_0006562 Ga0373951_0006562_691_1959 421
599 3300035092 Ga0373952_0000597 Ga0373952_0000597_2674_3939 421
600 3300035092 Ga0373952_0001351 Ga0373952_0001351_1748_3013 421
601 3300035112 Ga0373932_0000316 Ga0373932_0000316_3565_4830 421
602 3300035114 Ga0373939_0000429 Ga0373939_0000429_2205_3470 421
603 3300035115 Ga0373941_0000341 Ga0373941_0000341_7686_8951 421
604 3300035115 Ga0373941_0001140 Ga0373941_0001140_1363_2628 421
605 3300035117 Ga0373953_0006441 Ga0373953_0006441_1836_3104 421
606 3300035118 Ga0373954_0008900 Ga0373954_0008900_1183_2451 421
607 3300035119 Ga0373956_0005690 Ga0373956_0005690_3451_4719 421
608 3300035121 Ga0373960_0000127 Ga0373960_0000127_5809_7074 421
609 3300035121 Ga0373960_0000335 Ga0373960_0000335_6072_7337 421
610 3300035121 Ga0373960_0004580 Ga0373960_0004580_1651_2919 421
611 3300035207 Ga0373942_0000054 Ga0373942_0000054_11984_13249 421
612 3300035207 Ga0373942_0015211 Ga0373942_0015211_22_1290 421
613 3300035241 Ga0373961_0000807 Ga0373961_0000807_8169_9434 421
614 3300035241 Ga0373961_0004284 Ga0373961_0004284_678_1943 421
615 3300035242 Ga0373962_0000497 Ga0373962_0000497_908_2173 421
616 3300035242 Ga0373962_0001528 Ga0373962_0001528_1106_2371 421
617 3300035410 Ga0373924_0008024 Ga0373924_0008024_593_1861 421
618 3300035691 Ga0373931_0001604 Ga0373931_0001604_2338_3603 421
619 3300035691 Ga0373931_0003983 Ga0373931_0003983_4283_5548 421
620 3300035691 Ga0373931_0004569 Ga0373931_0004569_1506_2774 421
621 3300035692 Ga0373935_0004548 Ga0373935_0004548_4102_5370 421
622 3300035692 Ga0373935_0035574 Ga0373935_0035574_756_2024 421
623 3300035695 Ga0373927_0017601 Ga0373927_0017601_2625_3893 421
624 3300035724 Ga0373933_0002449 Ga0373933_0002449_6812_8080 421
625 3300035725 Ga0373947_0005403 Ga0373947_0005403_5586_6854 421
626 3300036401 Ga0373937_0002996 Ga0373937_0002996_6692_7960 421
627 3300037068 Ga0373925_0025234 Ga0373925_0025234_552_1820 421
628 3300045051 Ga0451576_0010925 Ga0451576_0010925_3772_5037 421
629 3300046454 Ga0495592_0001840 Ga0495592_0001840_7240_8508 421
630 3300046454 Ga0495592_0010619 Ga0495592_0010619_3538_4806 421
631 3300046455 Ga0495603_0011026 Ga0495603_0011026_2332_3600 421
632 3300046455 Ga0495603_0051357 Ga0495603_0051357_344_1612 421
633 3300046459 Ga0495629_0000269 Ga0495629_0000269_14559_15827 421
634 3300046459 Ga0495629_0089738 Ga0495629_0089738_793_2064 421
635 3300046462 Ga0495651_0005718 Ga0495651_0005718_6217_7485 421
636 3300046462 Ga0495651_0010406 Ga0495651_0010406_4800_6068 421
637 3300046462 Ga0495651_0014281 Ga0495651_0014281_747_2015 421
638 3300046463 Ga0495653_0010063 Ga0495653_0010063_3625_4893 421
639 3300046463 Ga0495653_0030364 Ga0495653_0030364_2076_3344 421
640 3300046473 Ga0495582_0003928 Ga0495582_0003928_1537_2805 421
641 3300046477 Ga0495664_0010264 Ga0495664_0010264_679_1947 421
642 3300046477 Ga0495664_0012784 Ga0495664_0012784_262_1530 421
643 3300046491 Ga0495584_0021696 Ga0495584_0021696_1764_3029 421
644 3300046492 Ga0495585_0001825 Ga0495585_0001825_8016_9284 421
645 3300046499 Ga0495594_0009788 Ga0495594_0009788_2346_3614 421
646 3300046501 Ga0495607_0040121 Ga0495607_0040121_236_1504 421
647 3300046511 Ga0495608_0001268 Ga0495608_0001268_12029_13297 421
648 3300046511 Ga0495608_0006562 Ga0495608_0006562_6110_7378 421
649 3300046511 Ga0495608_0016256 Ga0495608_0016256_3810_5078 421
650 3300046514 Ga0495618_0088979 Ga0495618_0088979_188_1456 421
651 3300046516 Ga0495628_0005226 Ga0495628_0005226_3908_5176 421
652 3300046516 Ga0495628_0007947 Ga0495628_0007947_250_1518 421
653 3300046516 Ga0495628_0012576 Ga0495628_0012576_3241_4509 421
654 3300046517 Ga0495630_0025455 Ga0495630_0025455_2972_4240 421
655 3300046523 Ga0495644_0000494 Ga0495644_0000494_1602_2870 421
656 3300046526 Ga0495666_0019704 Ga0495666_0019704_2064_3332 421
657 3300046529 Ga0495652_0061818 Ga0495652_0061818_1390_2658 421
658 3300046533 Ga0495640_0006352 Ga0495640_0006352_2056_3324 421
659 3300046535 Ga0495586_0011910 Ga0495586_0011910_2623_3891 421
660 3300046536 Ga0495587_0000620 Ga0495587_0000620_13136_14404 421
661 3300046536 Ga0495587_0010054 Ga0495587_0010054_4645_5913 421
662 3300046543 Ga0495645_0000848 Ga0495645_0000848_9461_10729 421
663 3300046543 Ga0495645_0008343 Ga0495645_0008343_5437_6705 421
664 3300046558 Ga0495633_0001631 Ga0495633_0001631_8022_9290 421
665 3300046559 Ga0495667_0001254 Ga0495667_0001254_2951_4219 421
666 3300046615 Ga0495656_0000749 Ga0495656_0000749_392_1660 421
667 3300046642 Ga0495634_0019712 Ga0495634_0019712_2951_4219 421
668 3300046663 Ga0495635_0005437 Ga0495635_0005437_1905_3173 421
669 3300046663 Ga0495635_0036531 Ga0495635_0036531_1023_2291 421
670 3300046663 Ga0495635_0090897 Ga0495635_0090897_483_1754 421
671 3300046664 Ga0495659_0018184 Ga0495659_0018184_293_1561 421
672 3300046665 Ga0495661_0050032 Ga0495661_0050032_1158_2426 421
673 3300046674 Ga0495588_0007720 Ga0495588_0007720_593_1861 421
674 3300046675 Ga0495657_0002939 Ga0495657_0002939_5625_6893 421
675 3300046678 Ga0495599_0003832 Ga0495599_0003832_250_1518 421
676 3300046679 Ga0495623_0026867 Ga0495623_0026867_1869_3137 421
677 3300046680 Ga0495646_0000856 Ga0495646_0000856_2856_4124 421
678 3300046681 Ga0495647_0012435 Ga0495647_0012435_1273_2541 421
679 3300046683 Ga0495658_0004553 Ga0495658_0004553_4045_5313 421
680 3300046689 Ga0495613_0015225 Ga0495613_0015225_3492_4760 421
681 3300046690 Ga0495624_0040542 Ga0495624_0040542_1024_2292 421
682 3300046691 Ga0495670_0001311 Ga0495670_0001311_8240_9508 421
683 3300046809 Ga0495600_0019144 Ga0495600_0019144_1132_2400 421
684 3300046809 Ga0495600_0058956 Ga0495600_0058956_143_1411 421
685 3300047317 Ga0495604_0005959 Ga0495604_0005959_1869_3137 421
686 3300047317 Ga0495604_0027617 Ga0495604_0027617_1601_2869 421
687 3300047319 Ga0495674_0005637 Ga0495674_0005637_2994_4262 421
688 3300047321 Ga0495676_0034516 Ga0495676_0034516_2594_3862 421
689 3300047321 Ga0495676_0120584 Ga0495676_0120584_42_1310 421
690 3300047322 Ga0495680_0001472 Ga0495680_0001472_11717_12985 421
691 3300047322 Ga0495680_0006777 Ga0495680_0006777_7351_8619 421
692 3300047322 Ga0495680_0018210 Ga0495680_0018210_861_2129 421
693 3300047444 Ga0495675_0018016 Ga0495675_0018016_3072_4340 421
694 3300047471 Ga0495684_0015113 Ga0495684_0015113_1731_2999 421
695 3300047673 Ga0495593_0009204 Ga0495593_0009204_3216_4484 421
696 3300047673 Ga0495593_0080823 Ga0495593_0080823_358_1626 421
697 3300048088 Ga0495602_0002664 Ga0495602_0002664_4768_6036 421
698 3300048088 Ga0495602_0013607 Ga0495602_0013607_4491_5759 421
699 3300048903 Ga0496100_0000713 Ga0496100_0000713_11344_12609 421
700 3300048903 Ga0496100_0006554 Ga0496100_0006554_3554_4822 421
701 3300048904 Ga0496101_0000151 Ga0496101_0000151_45072_46337 421
702 3300048904 Ga0496101_0007659 Ga0496101_0007659_3559_4827 421
703 3300048904 Ga0496101_0016572 Ga0496101_0016572_235_1503 421
704 3300048905 Ga0496102_0001766 Ga0496102_0001766_1035_2300 421
705 3300048905 Ga0496102_0016358 Ga0496102_0016358_3128_4396 421
706 3300048905 Ga0496102_0048953 Ga0496102_0048953_712_1977 421
707 3300048905 Ga0496102_0070115 Ga0496102_0070115_1198_2466 421
708 3300048906 Ga0496103_0000589 Ga0496103_0000589_25488_26753 421
709 3300048907 Ga0496104_0000215 Ga0496104_0000215_21847_23115 421
710 3300048907 Ga0496104_0005956 Ga0496104_0005956_7288_8556 421
711 3300048908 Ga0496105_0007651 Ga0496105_0007651_3574_4842 421
712 3300048908 Ga0496105_0020355 Ga0496105_0020355_1173_2441 421
713 3300048909 Ga0496106_0000347 Ga0496106_0000347_29068_30333 421
714 3300048909 Ga0496106_0019937 Ga0496106_0019937_3017_4285 421
715 3300048909 Ga0496106_0021616 Ga0496106_0021616_741_2006 421
716 3300048909 Ga0496106_0146486 Ga0496106_0146486_361_1629 421
717 3300048910 Ga0496107_0000959 Ga0496107_0000959_11502_12767 421
718 3300048910 Ga0496107_0019768 Ga0496107_0019768_1363_2631 421
719 3300048911 Ga0496108_0007921 Ga0496108_0007921_4995_6260 421
720 3300048911 Ga0496108_0056436 Ga0496108_0056436_791_2059 421
721 3300048912 Ga0496109_0000186 Ga0496109_0000186_52066_53331 421
722 3300048912 Ga0496109_0176532 Ga0496109_0176532_470_1738 421
723 3300048913 Ga0496110_0020387 Ga0496110_0020387_1442_2707 421
724 3300048913 Ga0496110_0022488 Ga0496110_0022488_1064_2332 421
725 3300048914 Ga0496111_0083807 Ga0496111_0083807_212_1480 421
726 3300048917 Ga0496114_0076223 Ga0496114_0076223_1033_2301 421
727 3300048918 Ga0496115_0007404 Ga0496115_0007404_4859_6124 421
728 3300048918 Ga0496115_0013246 Ga0496115_0013246_3845_5113 421
729 3300048918 Ga0496115_0073757 Ga0496115_0073757_787_2055 421
730 3300048918 Ga0496115_0099732 Ga0496115_0099732_601_1869 421
731 3300049568 Ga0501031_0002359 Ga0501031_0002359_2238_3524 421
732 3300049569 Ga0501032_0016805 Ga0501032_0016805_2200_3486 421
733 3300049570 Ga0501033_0018743 Ga0501033_0018743_2112_3398 421
734 3300049572 Ga0501036_0050405 Ga0501036_0050405_1926_3212 421
735 3300049573 Ga0501037_0035553 Ga0501037_0035553_2036_3322 421
736 3300049574 Ga0501038_0032902 Ga0501038_0032902_1900_3186 421
737 3300049575 Ga0501039_0047666 Ga0501039_0047666_1609_2895 421
738 3300049581 Ga0501047_0019730 Ga0501047_0019730_1324_2610 421
739 3300049822 Ga0501035_0168441 Ga0501035_0168441_179_1465 421
740 3300050494 nmdc:mga06z11_13108_c1 nmdc:mga06z11_13108_c1_1760_3025 421
741 3300050511 nmdc:mga08y16_1219_c1 nmdc:mga08y16_1219_c1_14372_15637 421
742 3300050511 nmdc:mga08y16_311_c1 nmdc:mga08y16_311_c1_21181_22446 421
743 3300050512 nmdc:mga0n895_62_c1 nmdc:mga0n895_62_c1_49461_50726 421
744 3300050514 nmdc:mga08x19_27777_c1 nmdc:mga08x19_27777_c1_2034_3302 421
745 3300050515 nmdc:mga0a205_2311_c1 nmdc:mga0a205_2311_c1_8923_10188 421
746 3300053077 Ga0495601_0000109 Ga0495601_0000109_37733_39001 421
747 3300053077 Ga0495601_0006125 Ga0495601_0006125_2993_4261 421
748 3300053077 Ga0495601_0009758 Ga0495601_0009758_4347_5618 421
749 3300053078 Ga0495612_0000953 Ga0495612_0000953_6440_7708 421
750 3300053078 Ga0495612_0002655 Ga0495612_0002655_541_1809 421
751 3300053084 Ga0495595_0001271 Ga0495595_0001271_2726_3994 421
752 3300053084 Ga0495595_0005318 Ga0495595_0005318_871_2139 421
753 3300053084 Ga0495595_0005872 Ga0495595_0005872_963_2234 421
754 3300053084 Ga0495595_0026712 Ga0495595_0026712_1160_2428 421
755 3300053085 Ga0495619_0000289 Ga0495619_0000289_29630_30898 421
756 3300053085 Ga0495619_0000662 Ga0495619_0000662_18504_19775 421
757 3300053085 Ga0495619_0002507 Ga0495619_0002507_8896_10164 421
758 3300053085 Ga0495619_0003722 Ga0495619_0003722_8433_9701 421
759 3300053085 Ga0495619_0007879 Ga0495619_0007879_5223_6491 421
760 3300053730 Ga0500645_000101 Ga0500645_000101_28294_29565 421
761 3300054114 Ga0501084_0067012 Ga0501084_0067012_519_1784 421

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21342

SoxA-TsdA_cyt-c

SoxA/TsdA, cytochrome c domain

250

335

0.95

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

118

208

0.71

PF00034

Cytochrom_C

Cytochrome c

120

212

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c1d-assembly4.cif.gz_G crystal structure of soxxa from p. pantotrophus 0.897 209 421
1h31-assembly3.cif.gz_E oxidised soxax complex from rhodovulum sulfidophilum 0.8747 209 421
3ocd-assembly2.cif.gz_C diheme soxax - c236m mutant 0.8158 211 420
3oa8-assembly1.cif.gz_E diheme soxax 0.809 211 420
3oa8-assembly1.cif.gz_B diheme soxax 0.7765 79 177
ID Description Score Start End Superfamily
2c1dG02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8529 214 301 1.10.760.10
2c1dG02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8358 214 301 1.10.760.10
4wqaA01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7894 213 309 1.10.760.10
3oa8D00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7751 79 177 1.10.760.10
3oa8E01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7697 299 420 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A537N8W6-F1-model_v4 L-cysteine S-thiosulfotransferase subunit SoxA (EC 2.8.5.2) (Protein SoxA) (SoxAX cytochrome complex subunit A) (Sulfur oxidizing protein A) (Thiosulfate-oxidizing multienzyme system protein SoxA) 0.9522 38 421 GO:0009055
GO:0016669
GO:0016740
GO:0019417
GO:0020037
GO:0042597
GO:0046872
GO:0070069
AF-A0A537N8W6-F1-model_v4 L-cysteine S-thiosulfotransferase subunit SoxA (EC 2.8.5.2) (Protein SoxA) (SoxAX cytochrome complex subunit A) (Sulfur oxidizing protein A) (Thiosulfate-oxidizing multienzyme system protein SoxA) 0.9497 38 421 GO:0009055
GO:0016669
GO:0016740
GO:0019417
GO:0020037
GO:0042597
GO:0046872
GO:0070069
AF-A0A2V6TWF3-F1-model_v4 L-cysteine S-thiosulfotransferase subunit SoxA (EC 2.8.5.2) 0.928 251 421 GO:0009055
GO:0016669
GO:0016740
GO:0019417
GO:0020037
GO:0042597
GO:0046872
GO:0070069
AF-A0A7C5S9B2-F1-model_v4 L-cysteine S-thiosulfotransferase subunit SoxA (EC 2.8.5.2) 0.9244 209 421 GO:0009055
GO:0016669
GO:0016740
GO:0019417
GO:0020037
GO:0042597
GO:0046872
GO:0070069
AF-A0A7W4VQ28-F1-model_v4 L-cysteine S-thiosulfotransferase subunit SoxA (EC 2.8.5.2) (Protein SoxA) (SoxAX cytochrome complex subunit A) (Sulfur oxidizing protein A) (Thiosulfate-oxidizing multienzyme system protein SoxA) 0.9212 214 421 GO:0009055
GO:0016669
GO:0016740
GO:0019417
GO:0020037
GO:0042597
GO:0046872
GO:0070069

Feature Viewer

pLDDT pTM Quality
80.78 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map