F479641

General Info

Members Datasets Scaffolds Average Seq Length
762 355 1524 151

Family's Representative Sequence

Representative Sequence 3300041405|Ga0439438_049552|Ga0439438_049552_66_521
Length 143
Sequence MSRDSRHLESVLHRDIPLTRDMGLKVLDWHDHQLRLHLPLEANVNHKSTMFGGSLYCGAVLAGWEEGIEGGHIVIQEGHITYPLPVTMDAIAICEAPGAAVWKKFLAMYQRYGRARLTLHSRIVNADSDDDAVRFTGQYVLHR

Samples

Sample ID Description Type Environment
1 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
30 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
31 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
32 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
50 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
60 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
62 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
63 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
82 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
90 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
91 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
92 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
101 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
102 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
103 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
104 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
105 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
106 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
107 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
108 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
109 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
110 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
111 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
112 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
113 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
114 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
115 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
116 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
117 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
118 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
119 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
120 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
121 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
122 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
123 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
124 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
125 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
126 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
127 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
128 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
129 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
130 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
131 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
132 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
136 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
140 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
141 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
142 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
143 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
144 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
145 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
146 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
147 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
148 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
151 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
152 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
153 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
154 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
155 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
156 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
157 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
158 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
159 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
166 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
167 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
175 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
176 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
181 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
182 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
190 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
191 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
192 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
193 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
194 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
203 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
204 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
205 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
206 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
209 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
210 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
214 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
215 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
216 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
217 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
218 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
219 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
220 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
223 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
224 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
225 2511231006 Pseudomonas sp. GM17 Isolate Nodule
226 2511231007 Pseudomonas sp. GM18 Isolate Nodule
227 2511231008 Pseudomonas sp. GM21 Isolate Nodule
228 2511231011 Pseudomonas sp. GM30 Isolate Nodule
229 2511231014 Pseudomonas sp. GM48 Isolate Nodule
230 2511231015 Pseudomonas sp. GM49 Isolate Nodule
231 2511231017 Pseudomonas sp. GM55 Isolate Nodule
232 2511231018 Pseudomonas sp. GM60 Isolate Nodule
233 2511231019 Pseudomonas sp. GM67 Isolate Nodule
234 2511231020 Pseudomonas sp. GM74 Isolate Nodule
235 2511231031 Pseudomonas sp. GM16 Isolate Nodule
236 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
237 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
238 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
239 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
240 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
241 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
242 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
243 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
244 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
245 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
246 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
247 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
248 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
249 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
250 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
251 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
252 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
253 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
254 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
255 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
256 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
257 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
258 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
259 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
260 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
261 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
262 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
263 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
264 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
265 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
266 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
267 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
268 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
269 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
270 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
271 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
272 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
273 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
274 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
275 2773857670 Pseudomonas sp. 478 Isolate Unclassified
276 2773857673 Pseudomonas sp. 443 Isolate Unclassified
277 2784132063 Pseudomonas sp. 424 Isolate Unclassified
278 2784132072 Pseudomonas sp. 460 Isolate Unclassified
279 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
280 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
281 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
282 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
283 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
284 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
285 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
286 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
287 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
288 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
289 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
290 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
291 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
292 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
293 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
294 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
295 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
296 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
297 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
298 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
299 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
300 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
301 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
302 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
303 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
304 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
305 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
306 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
307 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
308 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
309 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
310 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
311 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
312 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
313 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
314 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
315 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
316 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
317 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
318 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
319 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
320 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
321 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
322 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
323 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
324 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
325 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
326 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
327 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
328 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
329 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
330 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
331 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
332 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
333 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
334 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
335 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
336 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
337 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
338 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
339 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
340 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
341 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
342 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
343 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
344 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
345 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
346 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
347 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
348 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
349 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
350 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
351 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
352 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
353 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
354 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
355 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.81
Metatranscriptomes 0
Isolates 17.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.99
Nodule 2.1
Rhizoplane 2.76
Rhizosphere 77.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439438_049552 3300041405 Bacteria 1072
2 MRS2a_Contig_102 2124908027 Bacteria 23833
3 JGI25154J39366_1009001 3300002738 Bacteria 1253
4 JGI25163J39215_1000459 3300002771 Bacteria 12336
5 JGI25164J39214_1000077 3300002772 Bacteria 95293
6 JGI25165J46597_1000182 3300003214 Bacteria 95293
7 Ga0055538_1000118 3300003751 Bacteria 60509
8 Ga0055539_1000169 3300003752 Bacteria 57975
9 Ga0055533_1000174 3300003756 Bacteria 57975
10 Ga0055532_1000164 3300003758 Bacteria 57975
11 Ga0055525_1000234 3300003759 Bacteria 57975
12 Ga0055536_1000956 3300003781 Bacteria 18472
13 Ga0055530_10000034 3300003791 Bacteria 118012
14 Ga0055540_1000658 3300003792 Bacteria 24199
15 Ga0055541_1000110 3300003841 Bacteria 60509
16 Ga0065714_10002667 3300005288 Bacteria 27630
17 Ga0065714_10089286 3300005288 Bacteria 1985
18 Ga0065714_10146131 3300005288 Bacteria 1137
19 Ga0065714_10228114 3300005288 Bacteria 811
20 Ga0065714_10259277 3300005288 Bacteria 756
21 Ga0065704_10047933 3300005289 Bacteria 766
22 Ga0065704_10428125 3300005289 Bacteria 725
23 Ga0065712_10016968 3300005290 Bacteria 2034
24 Ga0065712_10067962 3300005290 Bacteria 18983
25 Ga0065715_10025795 3300005293 Bacteria 2301
26 Ga0070670_100000790 3300005331 Bacteria 24621
27 Ga0070670_100001383 3300005331 Bacteria 19441
28 Ga0070661_100000557 3300005344 Bacteria 28538
29 Ga0070674_101494054 3300005356 Bacteria 607
30 Ga0070664_100003000 3300005564 Bacteria 13655
31 Ga0068856_102097837 3300005614 Bacteria 575
32 Ga0070702_101661299 3300005615 Bacteria 530
33 Ga0075364_10051471 3300006051 Bacteria 2690
34 Ga0075364_10133061 3300006051 Bacteria 1670
35 Ga0075364_10410350 3300006051 Bacteria 924
36 Ga0075432_10005341 3300006058 Bacteria 4376
37 Ga0075432_10008443 3300006058 Bacteria 3514
38 Ga0075432_10032158 3300006058 Bacteria 1818
39 Ga0075432_10045652 3300006058 Bacteria 1537
40 Ga0075432_10179547 3300006058 Bacteria 827
41 Ga0075369_10069999 3300006186 Bacteria 1543
42 Ga0079104_1000104 3300006946 Bacteria 123967
43 Ga0079104_1031432 3300006946 Bacteria 1316
44 Ga0105251_10009461 3300009011 Bacteria 5753
45 Ga0105251_10009917 3300009011 Bacteria 5574
46 Ga0105251_10383741 3300009011 Bacteria 644
47 Ga0105244_10000110 3300009036 Bacteria 85793
48 Ga0105244_10017946 3300009036 Bacteria 3984
49 Ga0105244_10022577 3300009036 Bacteria 3462
50 Ga0105244_10024621 3300009036 Bacteria 3282
51 Ga0105244_10073441 3300009036 Bacteria 1703
52 Ga0105244_10081795 3300009036 Bacteria 1597
53 Ga0105250_10000107 3300009092 Bacteria 75197
54 Ga0105250_10004418 3300009092 Bacteria 6477
55 Ga0105250_10019542 3300009092 Bacteria 2740
56 Ga0105250_10029465 3300009092 Bacteria 2208
57 Ga0105250_10193441 3300009092 Bacteria 857
58 Ga0105250_10277566 3300009092 Bacteria 721
59 Ga0105250_10280356 3300009092 Bacteria 717
60 Ga0105243_10000047 3300009148 Bacteria 154272
61 Ga0105243_10005026 3300009148 Bacteria 10372
62 Ga0105243_10024061 3300009148 Bacteria 4642
63 Ga0105243_10138692 3300009148 Bacteria 2072
64 Ga0105242_10000208 3300009176 Bacteria 45684
65 Ga0105242_10260715 3300009176 Bacteria 1566
66 Ga0105242_11187799 3300009176 Bacteria 781
67 Ga0105237_10001733 3300009545 Bacteria 28197
68 Ga0105249_10002471 3300009553 Bacteria 16014
69 Ga0105246_10000151 3300011119 Bacteria 32865
70 Ga0105246_10003225 3300011119 Bacteria 9899
71 Ga0105246_10006685 3300011119 Bacteria 7049
72 Ga0105246_10018918 3300011119 Bacteria 4393
73 Ga0105246_10038864 3300011119 Bacteria 3202
74 Ga0157336_1011014 3300012477 Bacteria 697
75 Ga0157373_10019479 3300013100 Bacteria 4938
76 Ga0157373_10034439 3300013100 Bacteria 3637
77 Ga0157373_10060414 3300013100 Bacteria 2686
78 Ga0157373_10716147 3300013100 Bacteria 734
79 Ga0157371_10004631 3300013102 Bacteria 11916
80 Ga0157370_10014170 3300013104 Bacteria 8174
81 Ga0157370_10131801 3300013104 Bacteria 2331
82 Ga0157369_10085904 3300013105 Bacteria 3361
83 Ga0157369_10139756 3300013105 Bacteria 2563
84 Ga0157369_11762269 3300013105 Bacteria 629
85 Ga0163162_10238283 3300013306 Bacteria 1950
86 Ga0163162_10654516 3300013306 Bacteria 1174
87 Ga0163162_10724069 3300013306 Bacteria 1115
88 Ga0163162_12789168 3300013306 Bacteria 562
89 Ga0157375_10071521 3300013308 Bacteria 3482
90 Ga0157375_10085217 3300013308 Bacteria 3210
91 Ga0157375_10924916 3300013308 Bacteria 1015
92 Ga0182008_10000066 3300014497 Bacteria 88047
93 Ga0182008_10021477 3300014497 Bacteria 3314
94 Ga0182008_10034253 3300014497 Bacteria 2546
95 Ga0182008_10285260 3300014497 Bacteria 860
96 Ga0182006_1000445 3300015261 Bacteria 32791
97 Ga0182006_1020235 3300015261 Bacteria 2790
98 Ga0182007_10017819 3300015262 Bacteria 2585
99 Ga0182007_10057717 3300015262 Bacteria 1274
100 Ga0163161_10001300 3300017792 Bacteria 18607
101 Ga0163161_10009537 3300017792 Bacteria 6712
102 Ga0163161_10012492 3300017792 Bacteria 5895
103 Ga0163161_10021203 3300017792 Bacteria 4567
104 Ga0163161_10045154 3300017792 Bacteria 3176
105 Ga0163161_10183519 3300017792 Bacteria 1605
106 Ga0163161_11050747 3300017792 Bacteria 698
107 Ga0163161_11085503 3300017792 Bacteria 687
108 Ga0209435_100621 3300025206 Bacteria 6476
109 Ga0209760_100059 3300025207 Bacteria 97774
110 Ga0209784_100087 3300025224 Bacteria 122062
111 Ga0209566_100106 3300025225 Bacteria 122062
112 Ga0209674_100128 3300025226 Bacteria 122062
113 Ga0209147_100129 3300025229 Bacteria 122062
114 Ga0209563_100122 3300025230 Bacteria 122062
115 Ga0207427_100014 3300025231 Bacteria 561361
116 Ga0209437_100016 3300025233 Bacteria 710118
117 Ga0209258_100749 3300025242 Bacteria 20686
118 Ga0209646_1000411 3300025246 Bacteria 24736
119 Ga0209677_100078 3300025253 Bacteria 122062
120 Ga0209759_1014308 3300025256 Bacteria 2105
121 Ga0209759_1015204 3300025256 Bacteria 1995
122 Ga0209233_1000036 3300025261 Bacteria 561361
123 Ga0209130_1061171 3300025284 Bacteria 652
124 Ga0209676_1000032 3300025292 Bacteria 469558
125 Ga0209676_1000208 3300025292 Bacteria 130879
126 Ga0209050_1000025 3300025298 Bacteria 528225
127 Ga0209051_1000039 3300025303 Bacteria 319632
128 Ga0209051_1000047 3300025303 Bacteria 293227
129 Ga0207696_1000020 3300025711 Bacteria 434998
130 Ga0207696_1007596 3300025711 Bacteria 4227
131 Ga0207696_1016742 3300025711 Bacteria 2445
132 Ga0207696_1129106 3300025711 Bacteria 679
133 Ga0207655_1000310 3300025728 Bacteria 72872
134 Ga0207655_1000453 3300025728 Bacteria 53763
135 Ga0207655_1000726 3300025728 Bacteria 37318
136 Ga0207655_1001001 3300025728 Bacteria 28752
137 Ga0207655_1018540 3300025728 Bacteria 3685
138 Ga0207655_1034207 3300025728 Bacteria 2288
139 Ga0207655_1042331 3300025728 Bacteria 1941
140 Ga0207655_1043625 3300025728 Bacteria 1894
141 Ga0207713_1002316 3300025735 Bacteria 13991
142 Ga0207713_1002433 3300025735 Bacteria 13577
143 Ga0207713_1012696 3300025735 Bacteria 4484
144 Ga0207671_10000015 3300025914 Bacteria 439607
145 Ga0207649_10000001 3300025920 Bacteria 537851
146 Ga0207650_10000312 3300025925 Bacteria 47939
147 Ga0207650_10001072 3300025925 Bacteria 20331
148 Ga0207706_10012151 3300025933 Bacteria 7844
149 Ga0207686_10010594 3300025934 Bacteria 5024
150 Ga0207709_10000040 3300025935 Bacteria 259497
151 Ga0207709_10000058 3300025935 Bacteria 212963
152 Ga0207709_10014069 3300025935 Bacteria 4417
153 Ga0207709_10275273 3300025935 Bacteria 1241
154 Ga0207669_11319581 3300025937 Bacteria 613
155 Ga0207679_10000009 3300025945 Bacteria 357262
156 Ga0207712_10222839 3300025961 Bacteria 1509
157 Ga0207678_11393575 3300026067 Bacteria 620
158 Ga0207702_11943056 3300026078 Bacteria 579
159 Ga0209281_1000026 3300027111 Bacteria 465877
160 Ga0209281_1010248 3300027111 Bacteria 2157
161 Ga0209981_1054360 3300027378 Bacteria 609
162 Ga0209996_1000677 3300027395 Bacteria 4082
163 Ga0209995_1006712 3300027471 Bacteria 1851
164 Ga0210002_1048288 3300027617 Bacteria 731
165 Ga0209983_1015997 3300027665 Bacteria 1547
166 Ga0209971_1004042 3300027682 Bacteria 3470
167 Ga0207428_10024218 3300027907 Bacteria 5100
168 Ga0207428_10068817 3300027907 Bacteria 2784
169 Ga0207428_10186108 3300027907 Bacteria 1567
170 Ga0207428_10366840 3300027907 Bacteria 1058
171 Ga0207428_10623551 3300027907 Bacteria 776
172 Ga0207428_10901521 3300027907 Bacteria 625
173 Ga0307517_10120079 3300028786 Bacteria 1947
174 Ga0307517_10260485 3300028786 Bacteria 1008
175 Ga0307517_10592663 3300028786 Bacteria 547
176 Ga0316178_1023877 3300030735 Bacteria 65894
177 Ga0316183_1135980 3300030742 Bacteria 1102
178 Ga0316181_1032417 3300030744 Bacteria 650
179 Ga0265316_10114471 3300031344 Bacteria 2040
180 Ga0307509_10161231 3300031507 Bacteria 2139
181 Ga0307408_100154622 3300031548 Bacteria 1814
182 Ga0307413_10008083 3300031824 Bacteria 4939
183 Ga0307412_10014090 3300031911 Bacteria 4708
184 Ga0307412_10106616 3300031911 Bacteria 1992
185 Ga0307412_10108985 3300031911 Bacteria 1973
186 Ga0307412_10144323 3300031911 Bacteria 1747
187 Ga0307412_10168209 3300031911 Bacteria 1636
188 Ga0307416_100954174 3300032002 Bacteria 959
189 Ga0307414_10050999 3300032004 Bacteria 2870
190 Ga0307414_10299566 3300032004 Bacteria 1359
191 Ga0307510_10004199 3300033180 Bacteria 16928
192 Ga0439438_003578 3300041405 Bacteria 6233
193 Ga0439438_004975 3300041405 Bacteria 4963
194 Ga0439438_169426 3300041405 Bacteria 519
195 Ga0439447_000277 3300041407 Bacteria 18193
196 Ga0439447_000433 3300041407 Bacteria 15555
197 Ga0439447_001686 3300041407 Bacteria 8115
198 Ga0439447_003609 3300041407 Bacteria 5478
199 Ga0439447_010100 3300041407 Bacteria 2818
200 Ga0439447_053036 3300041407 Bacteria 964
201 Ga0439447_132809 3300041407 Bacteria 571
202 Ga0439466_0000403 3300041411 Bacteria 16411
203 Ga0439466_0002721 3300041411 Bacteria 6926
204 Ga0439466_0005041 3300041411 Bacteria 5065
205 Ga0439466_0012411 3300041411 Bacteria 3139
206 Ga0439466_0015065 3300041411 Bacteria 2810
207 Ga0439466_0015293 3300041411 Bacteria 2788
208 Ga0439466_0054471 3300041411 Bacteria 1303
209 Ga0439465_0056383 3300041413 Bacteria 1295
210 Ga0451839_1097242 3300041496 Bacteria 1263
211 Ga0439445_0007533 3300042004 Bacteria 2528
212 Ga0439445_0061677 3300042004 Bacteria 1026
213 Ga0439432_020537 3300042006 Bacteria 2194
214 Ga0439432_027211 3300042006 Bacteria 1868
215 Ga0439432_029632 3300042006 Bacteria 1778
216 Ga0439451_002033 3300042009 Bacteria 4062
217 Ga0439451_047282 3300042009 Bacteria 861
218 Ga0439452_000158 3300042010 Bacteria 50541
219 Ga0439452_003980 3300042010 Bacteria 5048
220 Ga0439452_013314 3300042010 Bacteria 2312
221 Ga0439452_022178 3300042010 Bacteria 1645
222 Ga0439456_000298 3300042013 Bacteria 11808
223 Ga0439456_006408 3300042013 Bacteria 2402
224 Ga0439456_007340 3300042013 Bacteria 2261
225 Ga0439463_021610 3300042016 Bacteria 1607
226 Ga0439463_049310 3300042016 Bacteria 1073
227 Ga0450911_000191 3300042115 Bacteria 24489
228 Ga0450911_003345 3300042115 Bacteria 2850
229 Ga0450919_005655 3300042121 Bacteria 1495
230 Ga0450920_004537 3300042122 Bacteria 2443
231 Ga0450922_000033 3300042124 Bacteria 12133
232 Ga0450923_003703 3300042125 Bacteria 2339
233 Ga0450892_004416 3300042130 Bacteria 1152
234 Ga0450902_002857 3300042137 Bacteria 2479
235 Ga0450902_032866 3300042137 Bacteria 875
236 Ga0450903_000822 3300042138 Bacteria 6050
237 Ga0450903_012279 3300042138 Bacteria 1369
238 Ga0450904_001924 3300042139 Bacteria 2669
239 Ga0450905_002035 3300042142 Bacteria 2581
240 Ga0450905_007220 3300042142 Bacteria 1511
241 Ga0450906_010109 3300042145 Bacteria 1789
242 Ga0450907_000069 3300042146 Bacteria 39731
243 Ga0450907_004884 3300042146 Bacteria 2285
244 Ga0450907_005231 3300042146 Bacteria 2194
245 Ga0450910_000395 3300042147 Bacteria 5149
246 Ga0450910_028664 3300042147 Bacteria 867
247 Ga0439446_0001565 3300042156 Bacteria 5256
248 Ga0450908_016388 3300042184 Bacteria 1322
249 Ga0450908_053565 3300042184 Bacteria 703
250 Ga0450909_005547 3300042185 Bacteria 1814
251 Ga0450909_014665 3300042185 Bacteria 1154
252 Ga0439434_0000024 3300042435 Bacteria 37077
253 Ga0439460_0000474 3300042461 Bacteria 8703
254 Ga0439460_0025665 3300042461 Bacteria 1642
255 Ga0450918_004198 3300042531 Bacteria 2640
256 Ga0439440_0000844 3300042993 Bacteria 5336
257 Ga0495617_002031 3300046452 Bacteria 8416
258 Ga0495617_017426 3300046452 Bacteria 2426
259 Ga0495617_025044 3300046452 Bacteria 2012
260 Ga0495617_048921 3300046452 Bacteria 1407
261 Ga0495617_082534 3300046452 Bacteria 1052
262 Ga0495627_000184 3300046453 Bacteria 69572
263 Ga0495627_000807 3300046453 Bacteria 22872
264 Ga0495627_001889 3300046453 Bacteria 11020
265 Ga0495627_052384 3300046453 Bacteria 1224
266 Ga0495592_0058845 3300046454 Bacteria 2832
267 Ga0495603_0004532 3300046455 Bacteria 8292
268 Ga0495603_0016891 3300046455 Bacteria 4416
269 Ga0495603_0047102 3300046455 Bacteria 2568
270 Ga0495603_0433057 3300046455 Bacteria 753
271 Ga0495590_0013546 3300046457 Bacteria 2994
272 Ga0495590_0061098 3300046457 Bacteria 1319
273 Ga0495590_0082590 3300046457 Bacteria 1132
274 Ga0495590_0115414 3300046457 Bacteria 960
275 Ga0495591_000027 3300046458 Bacteria 186086
276 Ga0495591_005730 3300046458 Bacteria 5667
277 Ga0495591_005736 3300046458 Bacteria 5661
278 Ga0495591_007191 3300046458 Bacteria 4768
279 Ga0495591_010434 3300046458 Bacteria 3602
280 Ga0495591_012557 3300046458 Bacteria 3148
281 Ga0495591_032098 3300046458 Bacteria 1567
282 Ga0495591_034821 3300046458 Bacteria 1478
283 Ga0495591_035574 3300046458 Bacteria 1457
284 Ga0495638_0010943 3300046460 Bacteria 6273
285 Ga0495638_0012032 3300046460 Bacteria 5946
286 Ga0495638_0022905 3300046460 Bacteria 4094
287 Ga0495638_0029242 3300046460 Bacteria 3553
288 Ga0495638_0030665 3300046460 Bacteria 3459
289 Ga0495638_0035122 3300046460 Bacteria 3196
290 Ga0495638_0086253 3300046460 Bacteria 1897
291 Ga0495638_0097700 3300046460 Bacteria 1760
292 Ga0495638_0118478 3300046460 Bacteria 1566
293 Ga0495638_0123643 3300046460 Bacteria 1526
294 Ga0495653_0020928 3300046463 Bacteria 5299
295 Ga0495650_0010742 3300046471 Bacteria 5087
296 Ga0495650_0011035 3300046471 Bacteria 4986
297 Ga0495650_0041949 3300046471 Bacteria 1953
298 Ga0495650_0058037 3300046471 Bacteria 1564
299 Ga0495580_0499609 3300046472 Bacteria 812
300 Ga0495605_0000164 3300046474 Bacteria 84623
301 Ga0495605_0004008 3300046474 Bacteria 8697
302 Ga0495605_0004135 3300046474 Bacteria 8549
303 Ga0495605_0004997 3300046474 Bacteria 7746
304 Ga0495605_0027622 3300046474 Bacteria 2938
305 Ga0495605_0050714 3300046474 Bacteria 2023
306 Ga0495605_0056882 3300046474 Bacteria 1885
307 Ga0495639_0043797 3300046475 Bacteria 2022
308 Ga0495639_0201703 3300046475 Bacteria 974
309 Ga0495584_0004568 3300046491 Bacteria 7425
310 Ga0495584_0008004 3300046491 Bacteria 5494
311 Ga0495584_0021599 3300046491 Bacteria 3268
312 Ga0495584_0038850 3300046491 Bacteria 2405
313 Ga0495584_0054557 3300046491 Bacteria 2011
314 Ga0495585_0000874 3300046492 Bacteria 25668
315 Ga0495585_0012543 3300046492 Bacteria 4992
316 Ga0495585_0017031 3300046492 Bacteria 4205
317 Ga0495585_0021391 3300046492 Bacteria 3714
318 Ga0495585_0043473 3300046492 Bacteria 2512
319 Ga0495585_0082342 3300046492 Bacteria 1742
320 Ga0495585_0195938 3300046492 Bacteria 1031
321 Ga0495594_0001097 3300046499 Bacteria 14107
322 Ga0495594_0008449 3300046499 Bacteria 5305
323 Ga0495596_0037784 3300046500 Bacteria 1908
324 Ga0495607_0000103 3300046501 Bacteria 90192
325 Ga0495607_0000978 3300046501 Bacteria 26506
326 Ga0495607_0008383 3300046501 Bacteria 7068
327 Ga0495607_0009791 3300046501 Bacteria 6471
328 Ga0495607_0021631 3300046501 Bacteria 4044
329 Ga0495607_0031270 3300046501 Bacteria 3259
330 Ga0495607_0038522 3300046501 Bacteria 2863
331 Ga0495607_0040940 3300046501 Bacteria 2754
332 Ga0495607_0065055 3300046501 Bacteria 2057
333 Ga0495607_0082321 3300046501 Bacteria 1766
334 Ga0495607_0091189 3300046501 Bacteria 1651
335 Ga0495607_0093804 3300046501 Bacteria 1620
336 Ga0495607_0097876 3300046501 Bacteria 1576
337 Ga0495607_0131500 3300046501 Bacteria 1301
338 Ga0495583_0000226 3300046506 Bacteria 95293
339 Ga0495583_0000589 3300046506 Bacteria 49822
340 Ga0495583_0003046 3300046506 Bacteria 13339
341 Ga0495583_0005851 3300046506 Bacteria 8197
342 Ga0495583_0017564 3300046506 Bacteria 3793
343 Ga0495606_0005880 3300046507 Bacteria 11550
344 Ga0495606_0012778 3300046507 Bacteria 6690
345 Ga0495606_0018680 3300046507 Bacteria 5188
346 Ga0495606_0162246 3300046507 Bacteria 1303
347 Ga0495610_0003244 3300046512 Bacteria 12854
348 Ga0495610_0005011 3300046512 Bacteria 9582
349 Ga0495610_0005357 3300046512 Bacteria 9154
350 Ga0495610_0011053 3300046512 Bacteria 5548
351 Ga0495610_0012796 3300046512 Bacteria 5019
352 Ga0495610_0014527 3300046512 Bacteria 4621
353 Ga0495610_0021648 3300046512 Bacteria 3529
354 Ga0495610_0035723 3300046512 Bacteria 2547
355 Ga0495610_0040843 3300046512 Bacteria 2333
356 Ga0495610_0081175 3300046512 Bacteria 1489
357 Ga0495616_0002306 3300046513 Bacteria 12768
358 Ga0495616_0011795 3300046513 Bacteria 4987
359 Ga0495616_0037976 3300046513 Bacteria 2474
360 Ga0495616_0069434 3300046513 Bacteria 1708
361 Ga0495620_0000047 3300046515 Bacteria 107032
362 Ga0495620_0006226 3300046515 Bacteria 6571
363 Ga0495620_0020401 3300046515 Bacteria 3237
364 Ga0495620_0028659 3300046515 Bacteria 2586
365 Ga0495620_0139434 3300046515 Bacteria 948
366 Ga0495631_0000166 3300046518 Bacteria 45256
367 Ga0495631_0005947 3300046518 Bacteria 6347
368 Ga0495631_0014628 3300046518 Bacteria 3781
369 Ga0495631_0032563 3300046518 Bacteria 2349
370 Ga0495631_0066937 3300046518 Bacteria 1554
371 Ga0495631_0096659 3300046518 Bacteria 1271
372 Ga0495632_0000647 3300046519 Bacteria 31971
373 Ga0495632_0000656 3300046519 Bacteria 31786
374 Ga0495632_0004083 3300046519 Bacteria 10070
375 Ga0495632_0021967 3300046519 Bacteria 3429
376 Ga0495632_0047255 3300046519 Bacteria 2135
377 Ga0495632_0056424 3300046519 Bacteria 1920
378 Ga0495632_0092196 3300046519 Bacteria 1435
379 Ga0495637_0001540 3300046520 Bacteria 13445
380 Ga0495637_0003570 3300046520 Bacteria 8244
381 Ga0495637_0008775 3300046520 Bacteria 4951
382 Ga0495637_0011609 3300046520 Bacteria 4228
383 Ga0495637_0029443 3300046520 Bacteria 2444
384 Ga0495637_0040652 3300046520 Bacteria 2000
385 Ga0495637_0044495 3300046520 Bacteria 1889
386 Ga0495637_0053844 3300046520 Bacteria 1673
387 Ga0495637_0140791 3300046520 Bacteria 915
388 Ga0495643_0003471 3300046522 Bacteria 11511
389 Ga0495643_0046415 3300046522 Bacteria 2355
390 Ga0495643_0082826 3300046522 Bacteria 1666
391 Ga0495644_0029012 3300046523 Bacteria 2092
392 Ga0495648_0003614 3300046524 Bacteria 13535
393 Ga0495648_0005353 3300046524 Bacteria 10690
394 Ga0495648_0006810 3300046524 Bacteria 9232
395 Ga0495648_0008618 3300046524 Bacteria 7999
396 Ga0495648_0013605 3300046524 Bacteria 6003
397 Ga0495648_0163367 3300046524 Bacteria 1148
398 Ga0495648_0194787 3300046524 Bacteria 1019
399 Ga0495648_0458363 3300046524 Bacteria 556
400 Ga0495642_0000465 3300046528 Bacteria 21296
401 Ga0495652_0183530 3300046529 Bacteria 1603
402 Ga0495654_0001660 3300046530 Bacteria 15059
403 Ga0495654_0017019 3300046530 Bacteria 3828
404 Ga0495654_0019494 3300046530 Bacteria 3547
405 Ga0495654_0043032 3300046530 Bacteria 2239
406 Ga0495654_0043112 3300046530 Bacteria 2237
407 Ga0495654_0050493 3300046530 Bacteria 2032
408 Ga0495654_0084313 3300046530 Bacteria 1484
409 Ga0495654_0219954 3300046530 Bacteria 803
410 Ga0495609_0000023 3300046538 Bacteria 269702
411 Ga0495609_0000156 3300046538 Bacteria 70241
412 Ga0495609_0001086 3300046538 Bacteria 18920
413 Ga0495609_0009423 3300046538 Bacteria 4724
414 Ga0495609_0011499 3300046538 Bacteria 4213
415 Ga0495609_0047525 3300046538 Bacteria 1920
416 Ga0495609_0210749 3300046538 Bacteria 809
417 Ga0495597_0000052 3300046542 Bacteria 96489
418 Ga0495597_0004553 3300046542 Bacteria 7579
419 Ga0495597_0103354 3300046542 Bacteria 1199
420 Ga0495597_0128025 3300046542 Bacteria 1054
421 Ga0495645_0080886 3300046543 Bacteria 2331
422 Ga0495622_0007427 3300046557 Bacteria 5085
423 Ga0495622_0007574 3300046557 Bacteria 5042
424 Ga0495622_0022991 3300046557 Bacteria 2905
425 Ga0495622_0073135 3300046557 Bacteria 1581
426 Ga0495622_0084552 3300046557 Bacteria 1459
427 Ga0495633_0000385 3300046558 Bacteria 46618
428 Ga0495633_0001098 3300046558 Bacteria 21834
429 Ga0495633_0018385 3300046558 Bacteria 3550
430 Ga0495633_0057530 3300046558 Bacteria 1826
431 Ga0495633_0130053 3300046558 Bacteria 1165
432 Ga0495656_0009785 3300046615 Bacteria 3459
433 Ga0495668_0020030 3300046616 Bacteria 3848
434 Ga0495668_0031614 3300046616 Bacteria 2983
435 Ga0495668_0056529 3300046616 Bacteria 2166
436 Ga0495668_0169298 3300046616 Bacteria 1197
437 Ga0495634_0060156 3300046642 Bacteria 2528
438 Ga0495611_0000433 3300046648 Bacteria 25790
439 Ga0495611_0167645 3300046648 Bacteria 1026
440 Ga0495625_0001935 3300046660 Bacteria 23416
441 Ga0495625_0002460 3300046660 Bacteria 20016
442 Ga0495625_0003278 3300046660 Bacteria 16347
443 Ga0495625_0008133 3300046660 Bacteria 8987
444 Ga0495625_0099928 3300046660 Bacteria 1994
445 Ga0495625_0106622 3300046660 Bacteria 1918
446 Ga0495625_0132374 3300046660 Bacteria 1688
447 Ga0495659_0003049 3300046664 Bacteria 5374
448 Ga0495659_0013122 3300046664 Bacteria 2695
449 Ga0495659_0172068 3300046664 Bacteria 879
450 Ga0495661_0000036 3300046665 Bacteria 164694
451 Ga0495661_0000072 3300046665 Bacteria 120743
452 Ga0495661_0000172 3300046665 Bacteria 74827
453 Ga0495661_0000384 3300046665 Bacteria 47272
454 Ga0495661_0011049 3300046665 Bacteria 6134
455 Ga0495661_0023064 3300046665 Bacteria 4044
456 Ga0495661_0035962 3300046665 Bacteria 3104
457 Ga0495661_0121058 3300046665 Bacteria 1446
458 Ga0495588_0030236 3300046674 Bacteria 2721
459 Ga0495588_0045993 3300046674 Bacteria 2238
460 Ga0495588_0071521 3300046674 Bacteria 1804
461 Ga0495588_0213880 3300046674 Bacteria 1018
462 Ga0495588_0423215 3300046674 Bacteria 699
463 Ga0495646_0131945 3300046680 Bacteria 1405
464 Ga0495646_0590024 3300046680 Bacteria 565
465 Ga0495669_0001962 3300046684 Bacteria 8448
466 Ga0495669_0033291 3300046684 Bacteria 2268
467 Ga0495613_0037942 3300046689 Bacteria 3571
468 Ga0495613_0351949 3300046689 Bacteria 1011
469 Ga0495624_0003063 3300046690 Bacteria 12514
470 Ga0495670_0000285 3300046691 Bacteria 23782
471 Ga0495670_0000945 3300046691 Bacteria 14050
472 Ga0495670_0005228 3300046691 Bacteria 6387
473 Ga0495670_0016163 3300046691 Bacteria 3669
474 Ga0495670_0031923 3300046691 Bacteria 2618
475 Ga0495670_0045404 3300046691 Bacteria 2193
476 Ga0495670_0055420 3300046691 Bacteria 1988
477 Ga0495670_0086320 3300046691 Bacteria 1602
478 Ga0495670_0314380 3300046691 Bacteria 840
479 Ga0495671_0008339 3300046692 Bacteria 5831
480 Ga0495671_0022547 3300046692 Bacteria 3298
481 Ga0495671_0026708 3300046692 Bacteria 2989
482 Ga0495671_0045237 3300046692 Bacteria 2204
483 Ga0495671_0048584 3300046692 Bacteria 2116
484 Ga0495671_0048646 3300046692 Bacteria 2115
485 Ga0495671_0056643 3300046692 Bacteria 1940
486 Ga0495671_0169861 3300046692 Bacteria 1060
487 Ga0495671_0188572 3300046692 Bacteria 1001
488 Ga0495649_0000899 3300046694 Bacteria 23619
489 Ga0495649_0045124 3300046694 Bacteria 2404
490 Ga0495649_0080064 3300046694 Bacteria 1747
491 Ga0495649_0144187 3300046694 Bacteria 1252
492 Ga0495649_0453963 3300046694 Bacteria 640
493 Ga0495589_0006407 3300046794 Bacteria 6214
494 Ga0495589_0014254 3300046794 Bacteria 4096
495 Ga0495589_0017065 3300046794 Bacteria 3728
496 Ga0495589_0044367 3300046794 Bacteria 2211
497 Ga0495600_0067397 3300046809 Bacteria 2339
498 Ga0495660_0001553 3300046810 Bacteria 15456
499 Ga0495660_0002491 3300046810 Bacteria 11748
500 Ga0495660_0005751 3300046810 Bacteria 7405
501 Ga0495660_0020683 3300046810 Bacteria 3772
502 Ga0495660_0024368 3300046810 Bacteria 3447
503 Ga0495660_0058554 3300046810 Bacteria 2074
504 Ga0495660_0058598 3300046810 Bacteria 2073
505 Ga0495660_0087079 3300046810 Bacteria 1629
506 Ga0495604_0017817 3300047317 Bacteria 5681
507 Ga0495672_0003609 3300047320 Bacteria 13129
508 Ga0495672_0003895 3300047320 Bacteria 12528
509 Ga0495672_0010865 3300047320 Bacteria 6458
510 Ga0495672_0011360 3300047320 Bacteria 6289
511 Ga0495672_0022914 3300047320 Bacteria 4051
512 Ga0495672_0033171 3300047320 Bacteria 3201
513 Ga0495672_0040238 3300047320 Bacteria 2836
514 Ga0495672_0079358 3300047320 Bacteria 1833
515 Ga0495672_0103395 3300047320 Bacteria 1541
516 Ga0495676_0030751 3300047321 Bacteria 4550
517 Ga0495676_0063310 3300047321 Bacteria 2883
518 Ga0495680_0100228 3300047322 Bacteria 2158
519 Ga0495683_0000028 3300047323 Bacteria 153672
520 Ga0495683_0000163 3300047323 Bacteria 65011
521 Ga0495683_0000272 3300047323 Bacteria 45419
522 Ga0495683_0000744 3300047323 Bacteria 23516
523 Ga0495683_0032801 3300047323 Bacteria 2644
524 Ga0495683_0045678 3300047323 Bacteria 2200
525 Ga0495683_0046826 3300047323 Bacteria 2170
526 Ga0495683_0046865 3300047323 Bacteria 2169
527 Ga0495683_0101694 3300047323 Bacteria 1381
528 Ga0495687_008959 3300047443 Bacteria 5659
529 Ga0495687_017122 3300047443 Bacteria 3626
530 Ga0495677_0002301 3300047445 Bacteria 7529
531 Ga0495679_000745 3300047446 Bacteria 20869
532 Ga0495679_001763 3300047446 Bacteria 11876
533 Ga0495679_014814 3300047446 Bacteria 2872
534 Ga0495679_016514 3300047446 Bacteria 2669
535 Ga0495679_019512 3300047446 Bacteria 2380
536 Ga0495673_0000222 3300047469 Bacteria 84272
537 Ga0495673_0000558 3300047469 Bacteria 38053
538 Ga0495673_0006349 3300047469 Bacteria 6961
539 Ga0495673_0027554 3300047469 Bacteria 2702
540 Ga0495673_0033648 3300047469 Bacteria 2376
541 Ga0495673_0035755 3300047469 Bacteria 2285
542 Ga0495673_0090561 3300047469 Bacteria 1250
543 Ga0495673_0092389 3300047469 Bacteria 1235
544 Ga0495673_0101572 3300047469 Bacteria 1161
545 Ga0495681_0000336 3300047470 Bacteria 37095
546 Ga0495681_0001855 3300047470 Bacteria 15524
547 Ga0495681_0005353 3300047470 Bacteria 8609
548 Ga0495681_0008538 3300047470 Bacteria 6410
549 Ga0495681_0027529 3300047470 Bacteria 2938
550 Ga0495681_0038052 3300047470 Bacteria 2362
551 Ga0495681_0038952 3300047470 Bacteria 2325
552 Ga0495681_0041120 3300047470 Bacteria 2245
553 Ga0495681_0064734 3300047470 Bacteria 1673
554 Ga0495681_0084908 3300047470 Bacteria 1407
555 Ga0495681_0141234 3300047470 Bacteria 1017
556 Ga0495684_0069797 3300047471 Bacteria 2671
557 Ga0495686_0018333 3300047472 Bacteria 4699
558 Ga0495686_0022566 3300047472 Bacteria 4165
559 Ga0495686_0124337 3300047472 Bacteria 1535
560 Ga0495686_0476897 3300047472 Bacteria 660
561 Ga0495593_0022645 3300047673 Bacteria 3498
562 Ga0495593_0025611 3300047673 Bacteria 3264
563 Ga0495602_0022826 3300048088 Bacteria 6114
564 Ga0495626_0002821 3300048091 Bacteria 11621
565 Ga0495626_0030201 3300048091 Bacteria 2614
566 Ga0495626_0033756 3300048091 Bacteria 2450
567 Ga0496100_0416004 3300048903 Bacteria 1026
568 Ga0496110_0680435 3300048913 Bacteria 929
569 Ga0496116_0000239 3300048919 Bacteria 100609
570 Ga0496116_0171091 3300048919 Bacteria 1177
571 Ga0496117_0000656 3300048920 Bacteria 55325
572 Ga0496117_0002174 3300048920 Bacteria 25565
573 Ga0496117_0104597 3300048920 Bacteria 1781
574 Ga0496117_0197846 3300048920 Bacteria 1138
575 Ga0496118_0059659 3300048921 Bacteria 2838
576 Ga0496118_0061686 3300048921 Bacteria 2774
577 Ga0496118_0077115 3300048921 Bacteria 2365
578 Ga0496118_0164909 3300048921 Bacteria 1363
579 Ga0496119_0016318 3300048922 Bacteria 5659
580 Ga0496119_0062939 3300048922 Bacteria 2208
581 Ga0496120_0008011 3300048923 Bacteria 7774
582 Ga0496121_0000262 3300048924 Bacteria 109686
583 Ga0496121_0011523 3300048924 Bacteria 9797
584 Ga0496121_0039743 3300048924 Bacteria 4138
585 Ga0496121_0087877 3300048924 Bacteria 2438
586 Ga0496121_0088321 3300048924 Bacteria 2430
587 Ga0496121_0105969 3300048924 Bacteria 2156
588 Ga0496122_0018148 3300048925 Bacteria 6517
589 Ga0496122_0025926 3300048925 Bacteria 5074
590 Ga0496122_0045839 3300048925 Bacteria 3392
591 Ga0496122_0069839 3300048925 Bacteria 2513
592 Ga0496122_0452453 3300048925 Bacteria 636
593 Ga0496123_0007286 3300048926 Bacteria 10498
594 Ga0496123_0039322 3300048926 Bacteria 3310
595 Ga0496123_0042019 3300048926 Bacteria 3161
596 Ga0496123_0181305 3300048926 Bacteria 1099
597 Ga0496124_0001240 3300048927 Bacteria 39185
598 Ga0496124_0055346 3300048927 Bacteria 3352
599 Ga0496124_0112921 3300048927 Bacteria 2184
600 Ga0496124_0227023 3300048927 Bacteria 1399
601 Ga0496124_0554942 3300048927 Bacteria 757
602 Ga0496125_0001137 3300048928 Bacteria 40507
603 Ga0496125_0003636 3300048928 Bacteria 18476
604 Ga0496125_0015841 3300048928 Bacteria 7264
605 Ga0496125_0017492 3300048928 Bacteria 6830
606 Ga0496125_0051856 3300048928 Bacteria 3379
607 Ga0496125_0124098 3300048928 Bacteria 1834
608 Ga0496125_0138654 3300048928 Bacteria 1695
609 Ga0496125_0395853 3300048928 Bacteria 809
610 Ga0496126_0040445 3300048929 Bacteria 4321
611 Ga0496126_0072581 3300048929 Bacteria 3061
612 Ga0496126_0269866 3300048929 Bacteria 1412
613 Ga0495678_000124 3300049459 Bacteria 90202
614 Ga0495678_022888 3300049459 Bacteria 2725
615 Ga0495678_067220 3300049459 Bacteria 1324
616 Ga0495678_130799 3300049459 Bacteria 832
617 Ga0495678_259180 3300049459 Bacteria 514
618 Ga0495682_0013175 3300049460 Bacteria 3153
619 Ga0495682_0014091 3300049460 Bacteria 3034
620 Ga0495682_0025877 3300049460 Bacteria 2181
621 Ga0495682_0088685 3300049460 Bacteria 1111
622 Ga0501235_202001 3300049669 Bacteria 538
623 Ga0501241_000158 3300049758 Bacteria 15164
624 Ga0501262_056156 3300049759 Bacteria 619
625 Ga0501269_002629 3300049766 Bacteria 2198
626 nmdc:mga03683_219440_c1 3300050489 Bacteria 877
627 nmdc:mga00v17_157927_c2 3300050491 Bacteria 1064
628 nmdc:mga08x19_80722_c1 3300050514 Bacteria 2135
629 nmdc:mga0sz30_65043_c1 3300050516 Bacteria 1563
630 Ga0500618_011099 3300053125 Bacteria 2398
631 Ga0500634_0027281 3300053161 Bacteria 3111
632 2511268559 2511231006 Bacteria 6794709
633 2511272663 2511231007 Bacteria 6306603
634 2511280739 2511231008 Bacteria 6624100
635 2511295858 2511231011 Bacteria 6149768
636 2511312123 2511231014 Bacteria 6462302
637 2511322692 2511231015 Bacteria 6598026
638 2511332801 2511231017 Bacteria 6503007
639 2511336267 2511231018 Bacteria 6436256
640 2511344443 2511231019 Bacteria 6520662
641 2511348420 2511231020 Bacteria 6115223
642 2511411153 2511231031 Bacteria 6558529
643 2512327825 2512047018 Bacteria 6663241
644 2555245612 2554235231 Bacteria 5215788
645 2555667244 2554235341 Bacteria 6867980
646 2583789960 2582580891 Bacteria 6800976
647 2597861506 2597489888 Bacteria 6179543
648 2597867239 2597489889 Bacteria 6297495
649 2599331077 2599185155 Bacteria 5827168
650 2599356467 2599185160 Bacteria 6844013
651 2599363506 2599185161 Bacteria 6960462
652 2599369542 2599185162 Bacteria 6957254
653 2599376615 2599185163 Bacteria 6995158
654 2599381572 2599185164 Bacteria 6841688
655 2599388284 2599185165 Bacteria 6843250
656 2599395189 2599185166 Bacteria 6959206
657 2599406954 2599185168 Bacteria 6997636
658 2599463300 2599185181 Bacteria 6844519
659 2599469353 2599185182 Bacteria 6883168
660 2599492317 2599185186 Bacteria 6831633
661 2599506286 2599185189 Bacteria 5862825
662 2600215929 2599185356 Bacteria 6843884
663 2600368111 2600254931 Bacteria 6734225
664 2601692203 2600255296 Bacteria 5784754
665 2601776096 2600255313 Bacteria 6842543
666 2621302334 2619619299 Bacteria 6649820
667 2624489615 2623620446 Bacteria 6500345
668 2643872768 2643221571 Bacteria 6228673
669 2643956241 2643221589 Bacteria 6250934
670 2644021509 2643221602 Bacteria 6249926
671 2644189622 2643221633 Bacteria 6733554
672 2644619492 2643221713 Bacteria 6554480
673 2671100146 2667528171 Bacteria 6900659
674 2715749016 2713897148 Bacteria 5883533
675 2723246415 2721755607 Bacteria 5841722
676 2738674398 2738541265 Bacteria 6594665
677 2738752791 2738541282 Bacteria 6593925
678 2738861832 2738541303 Bacteria 6591772
679 2739197873 2738543004 Bacteria 6381073
680 2739311121 2738543025 Bacteria 6600348
681 2743734915 2740892503 Bacteria 6855563
682 2774119715 2773857670 Bacteria 6407454
683 2774134570 2773857673 Bacteria 6513460
684 2784261222 2784132063 Bacteria 6262788
685 2784315071 2784132072 Bacteria 6596533
686 2807410764 2806310737 Bacteria 5751088
687 2807459105 2806310745 Bacteria 5742165
688 2808931227 2808606377 Bacteria 6646337
689 2808953283 2808606381 Bacteria 6646461
690 2808955694 2808606382 Bacteria 6841132
691 2808976822 2808606385 Bacteria 6711065
692 2808991740 2808606388 Bacteria 6706662
693 2809217819 2808606445 Bacteria 6057339
694 2817488241 2816332298 Bacteria 6852809
695 2819657079 2818991456 Bacteria 6123676
696 2819705038 2818991464 Bacteria 6907494
697 2826582871 2826581358 Bacteria 5963467
698 2834032420 2834028612 Bacteria 6354979
699 2842820858 2842815866 Bacteria 5947510
700 2842830578 2842826826 Bacteria 5974129
701 2842834015 2842832357 Bacteria 5959113
702 2842838473 2842837860 Bacteria 6066181
703 2842846510 2842843487 Bacteria 6004777
704 2842851429 2842849001 Bacteria 5924277
705 2844667733 2844665904 Bacteria 6817974
706 2852616898 2852612431 Bacteria 6885235
707 2852661559 2852657418 Bacteria 6472974
708 2852672113 2852667396 Bacteria 6885555
709 2860868290 2860867994 Bacteria 5645326
710 2880230961 2880230671 Bacteria 6140320
711 2904519422 2904518522 Bacteria 6068986
712 2904555808 2904550169 Bacteria 6221258
713 2908446873 2908446538 Bacteria 6829095
714 2912968827 2912963787 Bacteria 5646108
715 2917070992 2917070673 Bacteria 6868303
716 2919389926 2919385768 Bacteria 5897293
717 2919459811 2919456309 Bacteria 6586567
718 2919488898 2919487758 Bacteria 5929766
719 2919699124 2919697872 Bacteria 6553725
720 2923153906 2923153595 Bacteria 6870622
721 2929190151 2929189879 Bacteria 5930554
722 2935358820 2935353572 Unclassified 6955622
723 2939640949 2939636861 Bacteria 6297853
724 2939654165 2939651529 Bacteria 5895393
725 2945967428 2945961074 Bacteria 7342064
726 2946012668 2946006987 Bacteria 6705746
727 2946028491 2946027586 Bacteria 6049274
728 2947234989 2947233263 Bacteria 6439278
729 2969304758 2969304461 Bacteria 6601805
730 2974293498 2974289157 Bacteria 6080362
731 2984292183 2984286254 Bacteria 6702062
732 2998140308 2998139840 Bacteria 6073514
733 3007419862 3007419365 Bacteria 7026924
734 3007517717 3007511990 Bacteria 6481491
735 3007617389 3007614139 Bacteria 6053559
736 3007623538 3007619802 Bacteria 6411688
737 3007723877 3007718800 Bacteria 5971527
738 3007857239 3007855910 Bacteria 5637581
739 3007864499 3007861166 Bacteria 6045338
740 3007872556 3007872151 Bacteria 5268868
741 637317642 637000220 Bacteria 7074893
742 651174242 651053060 Bacteria 4689946
743 8015688165 8015687852 Bacteria 6613826
744 8019770146 8019769354 Bacteria 6924660
745 8019777186 8019775933 Bacteria 6858656
746 8030000424 8029995093 Bacteria 5990776
747 8054291447 8054285046 Bacteria 6919322
748 8054350285 8054347763 Bacteria 5901107
749 8054503805 8054503363 Bacteria 6101651
750 8055771267 8055770955 Bacteria 6827675
751 8055818185 8055817908 Bacteria 6609162
752 8056116071 8056115690 Bacteria 5527654
753 8056125671 8056120720 Bacteria 5758328
754 8056126313 8056125926 Bacteria 6228218
755 8056132143 8056131705 Bacteria 6107031
756 8056142734 8056137416 Bacteria 6147080
757 8056152258 8056148874 Bacteria 6479865
758 8056164173 8056161164 Bacteria 6106669
759 8056170734 8056166840 Bacteria 5820959
760 8056176861 8056172158 Bacteria 6133900
761 8056572170 8056569372 Bacteria 5997322
762 8057802531 8057798959 Bacteria 6713499
763 Ga0439438_049552
764 MRS2a_Contig_102
765 JGI25154J39366_1009001
766 JGI25163J39215_1000459
767 JGI25164J39214_1000077
768 JGI25165J46597_1000182
769 Ga0055538_1000118
770 Ga0055539_1000169
771 Ga0055533_1000174
772 Ga0055532_1000164
773 Ga0055525_1000234
774 Ga0055536_1000956
775 Ga0055530_10000034
776 Ga0055540_1000658
777 Ga0055541_1000110
778 Ga0065714_10002667
779 Ga0065714_10089286
780 Ga0065714_10146131
781 Ga0065714_10228114
782 Ga0065714_10259277
783 Ga0065704_10047933
784 Ga0065704_10428125
785 Ga0065712_10016968
786 Ga0065712_10067962
787 Ga0065715_10025795
788 Ga0070670_100000790
789 Ga0070670_100001383
790 Ga0070661_100000557
791 Ga0070674_101494054
792 Ga0070664_100003000
793 Ga0068856_102097837
794 Ga0070702_101661299
795 Ga0075364_10051471
796 Ga0075364_10133061
797 Ga0075364_10410350
798 Ga0075432_10005341
799 Ga0075432_10008443
800 Ga0075432_10032158
801 Ga0075432_10045652
802 Ga0075432_10179547
803 Ga0075369_10069999
804 Ga0079104_1000104
805 Ga0079104_1031432
806 Ga0105251_10009461
807 Ga0105251_10009917
808 Ga0105251_10383741
809 Ga0105244_10000110
810 Ga0105244_10017946
811 Ga0105244_10022577
812 Ga0105244_10024621
813 Ga0105244_10073441
814 Ga0105244_10081795
815 Ga0105250_10000107
816 Ga0105250_10004418
817 Ga0105250_10019542
818 Ga0105250_10029465
819 Ga0105250_10193441
820 Ga0105250_10277566
821 Ga0105250_10280356
822 Ga0105243_10000047
823 Ga0105243_10005026
824 Ga0105243_10024061
825 Ga0105243_10138692
826 Ga0105242_10000208
827 Ga0105242_10260715
828 Ga0105242_11187799
829 Ga0105237_10001733
830 Ga0105249_10002471
831 Ga0105246_10000151
832 Ga0105246_10003225
833 Ga0105246_10006685
834 Ga0105246_10018918
835 Ga0105246_10038864
836 Ga0157336_1011014
837 Ga0157373_10019479
838 Ga0157373_10034439
839 Ga0157373_10060414
840 Ga0157373_10716147
841 Ga0157371_10004631
842 Ga0157370_10014170
843 Ga0157370_10131801
844 Ga0157369_10085904
845 Ga0157369_10139756
846 Ga0157369_11762269
847 Ga0163162_10238283
848 Ga0163162_10654516
849 Ga0163162_10724069
850 Ga0163162_12789168
851 Ga0157375_10071521
852 Ga0157375_10085217
853 Ga0157375_10924916
854 Ga0182008_10000066
855 Ga0182008_10021477
856 Ga0182008_10034253
857 Ga0182008_10285260
858 Ga0182006_1000445
859 Ga0182006_1020235
860 Ga0182007_10017819
861 Ga0182007_10057717
862 Ga0163161_10001300
863 Ga0163161_10009537
864 Ga0163161_10012492
865 Ga0163161_10021203
866 Ga0163161_10045154
867 Ga0163161_10183519
868 Ga0163161_11050747
869 Ga0163161_11085503
870 Ga0209435_100621
871 Ga0209760_100059
872 Ga0209784_100087
873 Ga0209566_100106
874 Ga0209674_100128
875 Ga0209147_100129
876 Ga0209563_100122
877 Ga0207427_100014
878 Ga0209437_100016
879 Ga0209258_100749
880 Ga0209646_1000411
881 Ga0209677_100078
882 Ga0209759_1014308
883 Ga0209759_1015204
884 Ga0209233_1000036
885 Ga0209130_1061171
886 Ga0209676_1000032
887 Ga0209676_1000208
888 Ga0209050_1000025
889 Ga0209051_1000039
890 Ga0209051_1000047
891 Ga0207696_1000020
892 Ga0207696_1007596
893 Ga0207696_1016742
894 Ga0207696_1129106
895 Ga0207655_1000310
896 Ga0207655_1000453
897 Ga0207655_1000726
898 Ga0207655_1001001
899 Ga0207655_1018540
900 Ga0207655_1034207
901 Ga0207655_1042331
902 Ga0207655_1043625
903 Ga0207713_1002316
904 Ga0207713_1002433
905 Ga0207713_1012696
906 Ga0207671_10000015
907 Ga0207649_10000001
908 Ga0207650_10000312
909 Ga0207650_10001072
910 Ga0207706_10012151
911 Ga0207686_10010594
912 Ga0207709_10000040
913 Ga0207709_10000058
914 Ga0207709_10014069
915 Ga0207709_10275273
916 Ga0207669_11319581
917 Ga0207679_10000009
918 Ga0207712_10222839
919 Ga0207678_11393575
920 Ga0207702_11943056
921 Ga0209281_1000026
922 Ga0209281_1010248
923 Ga0209981_1054360
924 Ga0209996_1000677
925 Ga0209995_1006712
926 Ga0210002_1048288
927 Ga0209983_1015997
928 Ga0209971_1004042
929 Ga0207428_10024218
930 Ga0207428_10068817
931 Ga0207428_10186108
932 Ga0207428_10366840
933 Ga0207428_10623551
934 Ga0207428_10901521
935 Ga0307517_10120079
936 Ga0307517_10260485
937 Ga0307517_10592663
938 Ga0316178_1023877
939 Ga0316183_1135980
940 Ga0316181_1032417
941 Ga0265316_10114471
942 Ga0307509_10161231
943 Ga0307408_100154622
944 Ga0307413_10008083
945 Ga0307412_10014090
946 Ga0307412_10106616
947 Ga0307412_10108985
948 Ga0307412_10144323
949 Ga0307412_10168209
950 Ga0307416_100954174
951 Ga0307414_10050999
952 Ga0307414_10299566
953 Ga0307510_10004199
954 Ga0439438_003578
955 Ga0439438_004975
956 Ga0439438_169426
957 Ga0439447_000277
958 Ga0439447_000433
959 Ga0439447_001686
960 Ga0439447_003609
961 Ga0439447_010100
962 Ga0439447_053036
963 Ga0439447_132809
964 Ga0439466_0000403
965 Ga0439466_0002721
966 Ga0439466_0005041
967 Ga0439466_0012411
968 Ga0439466_0015065
969 Ga0439466_0015293
970 Ga0439466_0054471
971 Ga0439465_0056383
972 Ga0451839_1097242
973 Ga0439445_0007533
974 Ga0439445_0061677
975 Ga0439432_020537
976 Ga0439432_027211
977 Ga0439432_029632
978 Ga0439451_002033
979 Ga0439451_047282
980 Ga0439452_000158
981 Ga0439452_003980
982 Ga0439452_013314
983 Ga0439452_022178
984 Ga0439456_000298
985 Ga0439456_006408
986 Ga0439456_007340
987 Ga0439463_021610
988 Ga0439463_049310
989 Ga0450911_000191
990 Ga0450911_003345
991 Ga0450919_005655
992 Ga0450920_004537
993 Ga0450922_000033
994 Ga0450923_003703
995 Ga0450892_004416
996 Ga0450902_002857
997 Ga0450902_032866
998 Ga0450903_000822
999 Ga0450903_012279
1000 Ga0450904_001924
1001 Ga0450905_002035
1002 Ga0450905_007220
1003 Ga0450906_010109
1004 Ga0450907_000069
1005 Ga0450907_004884
1006 Ga0450907_005231
1007 Ga0450910_000395
1008 Ga0450910_028664
1009 Ga0439446_0001565
1010 Ga0450908_016388
1011 Ga0450908_053565
1012 Ga0450909_005547
1013 Ga0450909_014665
1014 Ga0439434_0000024
1015 Ga0439460_0000474
1016 Ga0439460_0025665
1017 Ga0450918_004198
1018 Ga0439440_0000844
1019 Ga0495617_002031
1020 Ga0495617_017426
1021 Ga0495617_025044
1022 Ga0495617_048921
1023 Ga0495617_082534
1024 Ga0495627_000184
1025 Ga0495627_000807
1026 Ga0495627_001889
1027 Ga0495627_052384
1028 Ga0495592_0058845
1029 Ga0495603_0004532
1030 Ga0495603_0016891
1031 Ga0495603_0047102
1032 Ga0495603_0433057
1033 Ga0495590_0013546
1034 Ga0495590_0061098
1035 Ga0495590_0082590
1036 Ga0495590_0115414
1037 Ga0495591_000027
1038 Ga0495591_005730
1039 Ga0495591_005736
1040 Ga0495591_007191
1041 Ga0495591_010434
1042 Ga0495591_012557
1043 Ga0495591_032098
1044 Ga0495591_034821
1045 Ga0495591_035574
1046 Ga0495638_0010943
1047 Ga0495638_0012032
1048 Ga0495638_0022905
1049 Ga0495638_0029242
1050 Ga0495638_0030665
1051 Ga0495638_0035122
1052 Ga0495638_0086253
1053 Ga0495638_0097700
1054 Ga0495638_0118478
1055 Ga0495638_0123643
1056 Ga0495653_0020928
1057 Ga0495650_0010742
1058 Ga0495650_0011035
1059 Ga0495650_0041949
1060 Ga0495650_0058037
1061 Ga0495580_0499609
1062 Ga0495605_0000164
1063 Ga0495605_0004008
1064 Ga0495605_0004135
1065 Ga0495605_0004997
1066 Ga0495605_0027622
1067 Ga0495605_0050714
1068 Ga0495605_0056882
1069 Ga0495639_0043797
1070 Ga0495639_0201703
1071 Ga0495584_0004568
1072 Ga0495584_0008004
1073 Ga0495584_0021599
1074 Ga0495584_0038850
1075 Ga0495584_0054557
1076 Ga0495585_0000874
1077 Ga0495585_0012543
1078 Ga0495585_0017031
1079 Ga0495585_0021391
1080 Ga0495585_0043473
1081 Ga0495585_0082342
1082 Ga0495585_0195938
1083 Ga0495594_0001097
1084 Ga0495594_0008449
1085 Ga0495596_0037784
1086 Ga0495607_0000103
1087 Ga0495607_0000978
1088 Ga0495607_0008383
1089 Ga0495607_0009791
1090 Ga0495607_0021631
1091 Ga0495607_0031270
1092 Ga0495607_0038522
1093 Ga0495607_0040940
1094 Ga0495607_0065055
1095 Ga0495607_0082321
1096 Ga0495607_0091189
1097 Ga0495607_0093804
1098 Ga0495607_0097876
1099 Ga0495607_0131500
1100 Ga0495583_0000226
1101 Ga0495583_0000589
1102 Ga0495583_0003046
1103 Ga0495583_0005851
1104 Ga0495583_0017564
1105 Ga0495606_0005880
1106 Ga0495606_0012778
1107 Ga0495606_0018680
1108 Ga0495606_0162246
1109 Ga0495610_0003244
1110 Ga0495610_0005011
1111 Ga0495610_0005357
1112 Ga0495610_0011053
1113 Ga0495610_0012796
1114 Ga0495610_0014527
1115 Ga0495610_0021648
1116 Ga0495610_0035723
1117 Ga0495610_0040843
1118 Ga0495610_0081175
1119 Ga0495616_0002306
1120 Ga0495616_0011795
1121 Ga0495616_0037976
1122 Ga0495616_0069434
1123 Ga0495620_0000047
1124 Ga0495620_0006226
1125 Ga0495620_0020401
1126 Ga0495620_0028659
1127 Ga0495620_0139434
1128 Ga0495631_0000166
1129 Ga0495631_0005947
1130 Ga0495631_0014628
1131 Ga0495631_0032563
1132 Ga0495631_0066937
1133 Ga0495631_0096659
1134 Ga0495632_0000647
1135 Ga0495632_0000656
1136 Ga0495632_0004083
1137 Ga0495632_0021967
1138 Ga0495632_0047255
1139 Ga0495632_0056424
1140 Ga0495632_0092196
1141 Ga0495637_0001540
1142 Ga0495637_0003570
1143 Ga0495637_0008775
1144 Ga0495637_0011609
1145 Ga0495637_0029443
1146 Ga0495637_0040652
1147 Ga0495637_0044495
1148 Ga0495637_0053844
1149 Ga0495637_0140791
1150 Ga0495643_0003471
1151 Ga0495643_0046415
1152 Ga0495643_0082826
1153 Ga0495644_0029012
1154 Ga0495648_0003614
1155 Ga0495648_0005353
1156 Ga0495648_0006810
1157 Ga0495648_0008618
1158 Ga0495648_0013605
1159 Ga0495648_0163367
1160 Ga0495648_0194787
1161 Ga0495648_0458363
1162 Ga0495642_0000465
1163 Ga0495652_0183530
1164 Ga0495654_0001660
1165 Ga0495654_0017019
1166 Ga0495654_0019494
1167 Ga0495654_0043032
1168 Ga0495654_0043112
1169 Ga0495654_0050493
1170 Ga0495654_0084313
1171 Ga0495654_0219954
1172 Ga0495609_0000023
1173 Ga0495609_0000156
1174 Ga0495609_0001086
1175 Ga0495609_0009423
1176 Ga0495609_0011499
1177 Ga0495609_0047525
1178 Ga0495609_0210749
1179 Ga0495597_0000052
1180 Ga0495597_0004553
1181 Ga0495597_0103354
1182 Ga0495597_0128025
1183 Ga0495645_0080886
1184 Ga0495622_0007427
1185 Ga0495622_0007574
1186 Ga0495622_0022991
1187 Ga0495622_0073135
1188 Ga0495622_0084552
1189 Ga0495633_0000385
1190 Ga0495633_0001098
1191 Ga0495633_0018385
1192 Ga0495633_0057530
1193 Ga0495633_0130053
1194 Ga0495656_0009785
1195 Ga0495668_0020030
1196 Ga0495668_0031614
1197 Ga0495668_0056529
1198 Ga0495668_0169298
1199 Ga0495634_0060156
1200 Ga0495611_0000433
1201 Ga0495611_0167645
1202 Ga0495625_0001935
1203 Ga0495625_0002460
1204 Ga0495625_0003278
1205 Ga0495625_0008133
1206 Ga0495625_0099928
1207 Ga0495625_0106622
1208 Ga0495625_0132374
1209 Ga0495659_0003049
1210 Ga0495659_0013122
1211 Ga0495659_0172068
1212 Ga0495661_0000036
1213 Ga0495661_0000072
1214 Ga0495661_0000172
1215 Ga0495661_0000384
1216 Ga0495661_0011049
1217 Ga0495661_0023064
1218 Ga0495661_0035962
1219 Ga0495661_0121058
1220 Ga0495588_0030236
1221 Ga0495588_0045993
1222 Ga0495588_0071521
1223 Ga0495588_0213880
1224 Ga0495588_0423215
1225 Ga0495646_0131945
1226 Ga0495646_0590024
1227 Ga0495669_0001962
1228 Ga0495669_0033291
1229 Ga0495613_0037942
1230 Ga0495613_0351949
1231 Ga0495624_0003063
1232 Ga0495670_0000285
1233 Ga0495670_0000945
1234 Ga0495670_0005228
1235 Ga0495670_0016163
1236 Ga0495670_0031923
1237 Ga0495670_0045404
1238 Ga0495670_0055420
1239 Ga0495670_0086320
1240 Ga0495670_0314380
1241 Ga0495671_0008339
1242 Ga0495671_0022547
1243 Ga0495671_0026708
1244 Ga0495671_0045237
1245 Ga0495671_0048584
1246 Ga0495671_0048646
1247 Ga0495671_0056643
1248 Ga0495671_0169861
1249 Ga0495671_0188572
1250 Ga0495649_0000899
1251 Ga0495649_0045124
1252 Ga0495649_0080064
1253 Ga0495649_0144187
1254 Ga0495649_0453963
1255 Ga0495589_0006407
1256 Ga0495589_0014254
1257 Ga0495589_0017065
1258 Ga0495589_0044367
1259 Ga0495600_0067397
1260 Ga0495660_0001553
1261 Ga0495660_0002491
1262 Ga0495660_0005751
1263 Ga0495660_0020683
1264 Ga0495660_0024368
1265 Ga0495660_0058554
1266 Ga0495660_0058598
1267 Ga0495660_0087079
1268 Ga0495604_0017817
1269 Ga0495672_0003609
1270 Ga0495672_0003895
1271 Ga0495672_0010865
1272 Ga0495672_0011360
1273 Ga0495672_0022914
1274 Ga0495672_0033171
1275 Ga0495672_0040238
1276 Ga0495672_0079358
1277 Ga0495672_0103395
1278 Ga0495676_0030751
1279 Ga0495676_0063310
1280 Ga0495680_0100228
1281 Ga0495683_0000028
1282 Ga0495683_0000163
1283 Ga0495683_0000272
1284 Ga0495683_0000744
1285 Ga0495683_0032801
1286 Ga0495683_0045678
1287 Ga0495683_0046826
1288 Ga0495683_0046865
1289 Ga0495683_0101694
1290 Ga0495687_008959
1291 Ga0495687_017122
1292 Ga0495677_0002301
1293 Ga0495679_000745
1294 Ga0495679_001763
1295 Ga0495679_014814
1296 Ga0495679_016514
1297 Ga0495679_019512
1298 Ga0495673_0000222
1299 Ga0495673_0000558
1300 Ga0495673_0006349
1301 Ga0495673_0027554
1302 Ga0495673_0033648
1303 Ga0495673_0035755
1304 Ga0495673_0090561
1305 Ga0495673_0092389
1306 Ga0495673_0101572
1307 Ga0495681_0000336
1308 Ga0495681_0001855
1309 Ga0495681_0005353
1310 Ga0495681_0008538
1311 Ga0495681_0027529
1312 Ga0495681_0038052
1313 Ga0495681_0038952
1314 Ga0495681_0041120
1315 Ga0495681_0064734
1316 Ga0495681_0084908
1317 Ga0495681_0141234
1318 Ga0495684_0069797
1319 Ga0495686_0018333
1320 Ga0495686_0022566
1321 Ga0495686_0124337
1322 Ga0495686_0476897
1323 Ga0495593_0022645
1324 Ga0495593_0025611
1325 Ga0495602_0022826
1326 Ga0495626_0002821
1327 Ga0495626_0030201
1328 Ga0495626_0033756
1329 Ga0496100_0416004
1330 Ga0496110_0680435
1331 Ga0496116_0000239
1332 Ga0496116_0171091
1333 Ga0496117_0000656
1334 Ga0496117_0002174
1335 Ga0496117_0104597
1336 Ga0496117_0197846
1337 Ga0496118_0059659
1338 Ga0496118_0061686
1339 Ga0496118_0077115
1340 Ga0496118_0164909
1341 Ga0496119_0016318
1342 Ga0496119_0062939
1343 Ga0496120_0008011
1344 Ga0496121_0000262
1345 Ga0496121_0011523
1346 Ga0496121_0039743
1347 Ga0496121_0087877
1348 Ga0496121_0088321
1349 Ga0496121_0105969
1350 Ga0496122_0018148
1351 Ga0496122_0025926
1352 Ga0496122_0045839
1353 Ga0496122_0069839
1354 Ga0496122_0452453
1355 Ga0496123_0007286
1356 Ga0496123_0039322
1357 Ga0496123_0042019
1358 Ga0496123_0181305
1359 Ga0496124_0001240
1360 Ga0496124_0055346
1361 Ga0496124_0112921
1362 Ga0496124_0227023
1363 Ga0496124_0554942
1364 Ga0496125_0001137
1365 Ga0496125_0003636
1366 Ga0496125_0015841
1367 Ga0496125_0017492
1368 Ga0496125_0051856
1369 Ga0496125_0124098
1370 Ga0496125_0138654
1371 Ga0496125_0395853
1372 Ga0496126_0040445
1373 Ga0496126_0072581
1374 Ga0496126_0269866
1375 Ga0495678_000124
1376 Ga0495678_022888
1377 Ga0495678_067220
1378 Ga0495678_130799
1379 Ga0495678_259180
1380 Ga0495682_0013175
1381 Ga0495682_0014091
1382 Ga0495682_0025877
1383 Ga0495682_0088685
1384 Ga0501235_202001
1385 Ga0501241_000158
1386 Ga0501262_056156
1387 Ga0501269_002629
1388 nmdc:mga03683_219440_c1
1389 nmdc:mga00v17_157927_c2
1390 nmdc:mga08x19_80722_c1
1391 nmdc:mga0sz30_65043_c1
1392 Ga0500618_011099
1393 Ga0500634_0027281
1394 2511268559
1395 2511272663
1396 2511280739
1397 2511295858
1398 2511312123
1399 2511322692
1400 2511332801
1401 2511336267
1402 2511344443
1403 2511348420
1404 2511411153
1405 2512327825
1406 2555245612
1407 2555667244
1408 2583789960
1409 2597861506
1410 2597867239
1411 2599331077
1412 2599356467
1413 2599363506
1414 2599369542
1415 2599376615
1416 2599381572
1417 2599388284
1418 2599395189
1419 2599406954
1420 2599463300
1421 2599469353
1422 2599492317
1423 2599506286
1424 2600215929
1425 2600368111
1426 2601692203
1427 2601776096
1428 2621302334
1429 2624489615
1430 2643872768
1431 2643956241
1432 2644021509
1433 2644189622
1434 2644619492
1435 2671100146
1436 2715749016
1437 2723246415
1438 2738674398
1439 2738752791
1440 2738861832
1441 2739197873
1442 2739311121
1443 2743734915
1444 2774119715
1445 2774134570
1446 2784261222
1447 2784315071
1448 2807410764
1449 2807459105
1450 2808931227
1451 2808953283
1452 2808955694
1453 2808976822
1454 2808991740
1455 2809217819
1456 2817488241
1457 2819657079
1458 2819705038
1459 2826582871
1460 2834032420
1461 2842820858
1462 2842830578
1463 2842834015
1464 2842838473
1465 2842846510
1466 2842851429
1467 2844667733
1468 2852616898
1469 2852661559
1470 2852672113
1471 2860868290
1472 2880230961
1473 2904519422
1474 2904555808
1475 2908446873
1476 2912968827
1477 2917070992
1478 2919389926
1479 2919459811
1480 2919488898
1481 2919699124
1482 2923153906
1483 2929190151
1484 2935358820
1485 2939640949
1486 2939654165
1487 2945967428
1488 2946012668
1489 2946028491
1490 2947234989
1491 2969304758
1492 2974293498
1493 2984292183
1494 2998140308
1495 3007419862
1496 3007517717
1497 3007617389
1498 3007623538
1499 3007723877
1500 3007857239
1501 3007864499
1502 3007872556
1503 637317642
1504 651174242
1505 8015688165
1506 8019770146
1507 8019777186
1508 8030000424
1509 8054291447
1510 8054350285
1511 8054503805
1512 8055771267
1513 8055818185
1514 8056116071
1515 8056125671
1516 8056126313
1517 8056132143
1518 8056142734
1519 8056152258
1520 8056164173
1521 8056170734
1522 8056176861
1523 8056572170
1524 8057802531

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09500

YiiD_C

Putative thioesterase (yiiD_Cterm)

5

143

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ayv-assembly1.cif.gz_B crystal structure of the malonyl-acp decarboxylase madb from pseudomonas putida 0.9521 4 151
8ayv-assembly1.cif.gz_B crystal structure of the malonyl-acp decarboxylase madb from pseudomonas putida 0.9396 4 151
1t82-assembly2.cif.gz_D crystal structure of the putative thioesterase from shewanella oneidensis, northeast structural genomics target sor51 0.9024 1 151
1t82-assembly1.cif.gz_A crystal structure of the putative thioesterase from shewanella oneidensis, northeast structural genomics target sor51 0.9016 1 151
3lmb-assembly1.cif.gz_B the crystal structure of the protein olei01261 with unknown function from chlorobaculum tepidum tls 0.9009 5 151
ID Description Score Start End Superfamily
1t82D00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9059 2 151 3.10.129.10
1t82D00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8994 2 151 3.10.129.10
3lmbB01 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8734 5 151 3.10.129.10
af_P0ADQ2_165_315_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.873 4 150 3.10.129.10
3lmbB01 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8457 5 151 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A6I1NRP1-F1-model_v4 Thioesterase 0.9939 52 151
AF-A0A0P9B339-F1-model_v4 Thioesterase family protein 0.9829 92 151
AF-A0A6I1NRP1-F1-model_v4 Thioesterase 0.9745 52 151
AF-A0A3M5N399-F1-model_v4 deleted 0.9688 77 151
AF-A0A0P9B339-F1-model_v4 Thioesterase family protein 0.9671 92 151

Map