F479643

General Info

Members Datasets Scaffolds Average Seq Length
762 398 1524 203

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0029663|Ga0451577_0029663_2692_3411
Length 239
Sequence VGLFLFPHKHNPTMIRLFVGLGNPGPDYENTRHNAGFWWIDAVARALNAQLVVDKSYHGLVARTSVNGQTIWLLEPQTFMNLSGKSVAALAHFFKISPQEILVAHDELDVVPGEAKLKLGGSHAGHNGLRDIHAQLGTDQYWRLRLGIGHPGNKAEVVHWVLKKPSLDHRIAVDQTIDRAIKALPQLLSGDMEQATRLIHTSKPPRPKVPRPTPALTASDARVSTPMDSQPRPASTPSP

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
16 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
69 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
93 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
94 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
95 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
99 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
100 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
104 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
105 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
106 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
108 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
109 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
152 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
154 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
161 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
162 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
163 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
164 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
165 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
166 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
167 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
168 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
169 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
170 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
171 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
172 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
173 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
174 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
197 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
198 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
199 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
200 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
201 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
202 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
203 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
204 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
205 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
206 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
207 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
208 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
209 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
210 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
211 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
212 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
213 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
214 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
215 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
216 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
217 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
218 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
219 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
220 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
221 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
222 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
223 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
224 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
225 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
226 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
227 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
228 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
229 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
230 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
231 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
232 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
233 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
234 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
235 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
236 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
237 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
238 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
239 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
240 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
241 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
242 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
243 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
244 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
245 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
246 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
247 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
248 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
249 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
250 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
251 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
252 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
253 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
254 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
255 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
256 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
257 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
258 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
259 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
260 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
261 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
262 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
263 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
264 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
265 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
266 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
267 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
268 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
269 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
270 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
271 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
272 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
273 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
274 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
275 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
276 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
277 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
278 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
291 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
292 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
293 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
294 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
295 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
296 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
297 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
298 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
299 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
303 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
304 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
305 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
306 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
307 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
308 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
309 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
310 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
311 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
312 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
313 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
314 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
315 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
316 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
317 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
318 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
319 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
320 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
321 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
322 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
323 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
324 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
325 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
326 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
327 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
328 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
329 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
330 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
331 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
332 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
333 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
334 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
335 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
336 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
337 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
338 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
339 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
340 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
341 2547132374 Acidovorax radicis N35 Isolate Unclassified
342 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
343 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
344 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
345 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
346 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
347 2643221570 Acidovorax sp. Root568 Isolate Unclassified
348 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
349 2643221596 Acidovorax sp. Root70 Isolate Unclassified
350 2643221611 Acidovorax sp. Root219 Isolate Unclassified
351 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
352 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
353 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
354 2643221658 Variovorax sp. Root411 Isolate Unclassified
355 2643221660 Methylibium sp. Root1272 Isolate Unclassified
356 2643221672 Variovorax sp. Root434 Isolate Unclassified
357 2643221683 Variovorax sp. Root473 Isolate Unclassified
358 2643221717 Acidovorax sp. Root267 Isolate Unclassified
359 2721755523 Delftia sp. HK171 Isolate Unclassified
360 2738541277 Variovorax sp. GV051 Isolate Unclassified
361 2738541307 Variovorax sp. GV008 Isolate Unclassified
362 2738543012 Acidovorax sp. CF301 Isolate Unclassified
363 2738543013 Variovorax sp. BT01 Isolate Unclassified
364 2738543019 Variovorax sp. GV040 Isolate Unclassified
365 2816332133 Acidovorax radicis 2721A Isolate Unclassified
366 2818991446 Variovorax sp. 1180 Isolate Unclassified
367 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
368 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
369 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
370 2842677519 Variovorax sp. R-72495 Isolate Unclassified
371 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
372 2842747753 Variovorax sp. R-72060 Isolate Unclassified
373 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
374 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
375 2885198086 Variovorax sp. 679 Isolate Unclassified
376 2885211737 Variovorax sp. 553 Isolate Unclassified
377 2899924645 Variovorax sp. 369 Isolate Unclassified
378 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
379 2904456579 Variovorax sp. 2002 Isolate Unclassified
380 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
381 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
382 2928037797 Variovorax sp. 1126 Isolate Unclassified
383 2928044640 Variovorax sp. 1128 Isolate Unclassified
384 2928051484 Variovorax sp. 1133 Isolate Unclassified
385 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
386 2928070936 Variovorax gossypii 1167 Isolate Unclassified
387 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
388 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
389 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
390 2929520902 Variovorax beijingensis 502 Isolate Unclassified
391 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
392 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
393 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
394 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
395 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
396 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
397 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
398 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.73
Metatranscriptomes 0.39
Isolates 7.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 34.91
Nodule 0.79
Rhizoplane 3.15
Rhizosphere 48.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0029663 3300042876 Bacteria 4944
2 JGI24740J21852_10009214 3300001979 Bacteria 3878
3 JGI24740J21852_10009701 3300001979 Bacteria 3752
4 JGI25155J39150_1000102 3300002704 Bacteria 45181
5 JGI25156J39149_1000010 3300002705 Bacteria 200080
6 JGI25154J39366_1000027 3300002738 Bacteria 200075
7 JGI25158J39367_1006527 3300002739 Bacteria 1668
8 JGI25157J39369_1000146 3300002741 Bacteria 59929
9 JGI25152J39213_1000516 3300002773 Bacteria 21501
10 JGI25152J39213_1010222 3300002773 Bacteria 2165
11 JGI25152J39213_1011717 3300002773 Bacteria 1924
12 JGI25150J39212_1003244 3300002774 Bacteria 3841
13 JGI25150J39212_1007486 3300002774 Bacteria 2189
14 JGI25150J39212_1009352 3300002774 Bacteria 1871
15 JGI25150J39212_1010392 3300002774 Bacteria 1733
16 JGI25159J45721_1000345 3300002987 Bacteria 21479
17 JGI25159J45721_1001064 3300002987 Bacteria 11731
18 JGI25159J45721_1012661 3300002987 Bacteria 1999
19 JGI25159J45721_1013590 3300002987 Bacteria 1877
20 JGI25151J46595_10010095 3300003187 Bacteria 4418
21 JGI25151J46595_10019873 3300003187 Bacteria 2842
22 JGI25151J46595_10029663 3300003187 Bacteria 2162
23 JGI25151J46595_10033026 3300003187 Bacteria 1999
24 JGI25151J46595_10033391 3300003187 Bacteria 1982
25 JGI25153J46596_10002374 3300003215 Bacteria 10904
26 JGI25153J46596_10003174 3300003215 Bacteria 9261
27 JGI25153J46596_10027356 3300003215 Bacteria 1999
28 JGI25160J50197_1000129 3300003354 Bacteria 68068
29 JGI25160J50197_1017895 3300003354 Bacteria 2227
30 JGI25160J50197_1020407 3300003354 Bacteria 1999
31 JGI25160J50197_1040051 3300003354 Bacteria 1090
32 JGI25161J50226_1000080 3300003374 Bacteria 79971
33 JGI25161J50226_1006781 3300003374 Bacteria 2015
34 Ga0006562J51391_1041255 3300003578 Bacteria 1347
35 Ga0006562J51391_1049985 3300003578 Bacteria 1500
36 Ga0006562J51391_1049987 3300003578 Bacteria 880
37 Ga0055532_1010136 3300003758 Bacteria 1131
38 Ga0055535_1002183 3300003761 Bacteria 7482
39 Ga0055542_1000583 3300003762 Bacteria 31637
40 Ga0055526_1002127 3300003771 Bacteria 13599
41 Ga0055526_1008955 3300003771 Bacteria 4902
42 Ga0055526_1024178 3300003771 Bacteria 1999
43 Ga0055526_1024290 3300003771 Bacteria 1988
44 Ga0055526_1027178 3300003771 Bacteria 1777
45 Ga0055526_1033320 3300003771 Bacteria 1432
46 Ga0055537_1000049 3300003773 Bacteria 87244
47 Ga0055537_1000779 3300003773 Bacteria 16033
48 Ga0055537_1007736 3300003773 Bacteria 2553
49 Ga0055537_1010200 3300003773 Bacteria 1999
50 Ga0055537_1010260 3300003773 Bacteria 1988
51 Ga0055524_1000120 3300003775 Bacteria 91299
52 Ga0055524_1000247 3300003775 Bacteria 56379
53 Ga0055524_1023266 3300003775 Bacteria 1999
54 Ga0055536_1001351 3300003781 Bacteria 14939
55 Ga0055536_1002957 3300003781 Bacteria 9316
56 Ga0055536_1011940 3300003781 Bacteria 3272
57 Ga0055536_1015377 3300003781 Bacteria 2624
58 Ga0055536_1019458 3300003781 Bacteria 2133
59 Ga0055534_1000049 3300003784 Bacteria 92974
60 Ga0055534_1001408 3300003784 Bacteria 9598
61 Ga0055534_1010119 3300003784 Bacteria 1999
62 Ga0055528_1001145 3300003790 Bacteria 17246
63 Ga0055528_1002656 3300003790 Bacteria 9437
64 Ga0055528_1022011 3300003790 Bacteria 1999
65 Ga0055528_1022152 3300003790 Bacteria 1988
66 Ga0055528_1026378 3300003790 Bacteria 1670
67 Ga0055530_10001709 3300003791 Bacteria 15489
68 Ga0055530_10003781 3300003791 Bacteria 8345
69 Ga0055530_10010625 3300003791 Bacteria 3380
70 Ga0055530_10013164 3300003791 Bacteria 2838
71 Ga0055540_1000067 3300003792 Bacteria 122108
72 Ga0055540_1000260 3300003792 Bacteria 47714
73 Ga0055540_1006805 3300003792 Bacteria 4458
74 Ga0055540_1007545 3300003792 Bacteria 4077
75 Ga0055540_1009661 3300003792 Bacteria 3301
76 Ga0055540_1012700 3300003792 Bacteria 2624
77 Ga0055540_1017793 3300003792 Bacteria 1971
78 Ga0055531_10001090 3300003794 Bacteria 21279
79 Ga0055531_10001465 3300003794 Bacteria 17364
80 Ga0055531_10001523 3300003794 Bacteria 16987
81 Ga0055531_10006230 3300003794 Bacteria 6813
82 Ga0055531_10018314 3300003794 Bacteria 2897
83 Ga0055531_10019468 3300003794 Bacteria 2743
84 Ga0055531_10027088 3300003794 Bacteria 2023
85 Ga0055543_1000202 3300004625 Bacteria 48648
86 Ga0055543_1009803 3300004625 Bacteria 2037
87 Ga0065165_1001775 3300005262 Bacteria 21338
88 Ga0065165_1005815 3300005262 Bacteria 6728
89 Ga0065165_1014928 3300005262 Bacteria 2991
90 Ga0065165_1024230 3300005262 Bacteria 2042
91 Ga0065165_1050712 3300005262 Bacteria 1180
92 Ga0065165_1061976 3300005262 Bacteria 1021
93 Ga0065714_10014213 3300005288 Bacteria 2291
94 Ga0065704_10076112 3300005289 Bacteria 5260
95 Ga0070658_10629042 3300005327 Bacteria 931
96 Ga0068869_100174378 3300005334 Bacteria 1682
97 Ga0068868_100338173 3300005338 Bacteria 1286
98 Ga0068868_100974123 3300005338 Bacteria 774
99 Ga0070660_100201923 3300005339 Bacteria 1613
100 Ga0070661_100000361 3300005344 Bacteria 35932
101 Ga0070661_100021114 3300005344 Bacteria 4649
102 Ga0070661_100162841 3300005344 Bacteria 1690
103 Ga0070668_100107656 3300005347 Bacteria 2216
104 Ga0070669_100032646 3300005353 Bacteria 3761
105 Ga0070675_100415574 3300005354 Bacteria 1202
106 Ga0070674_100089594 3300005356 Bacteria 2217
107 Ga0070673_100145557 3300005364 Bacteria 2002
108 Ga0070673_100192083 3300005364 Bacteria 1754
109 Ga0070673_100368749 3300005364 Bacteria 1278
110 Ga0070673_100397158 3300005364 Bacteria 1232
111 Ga0070659_100002940 3300005366 Bacteria 12145
112 Ga0070710_10191055 3300005437 Bacteria 1288
113 Ga0070678_100050277 3300005456 Bacteria 3014
114 Ga0070678_100597495 3300005456 Bacteria 985
115 Ga0070678_100602417 3300005456 Bacteria 981
116 Ga0070662_100001973 3300005457 Bacteria 12604
117 Ga0068853_100084615 3300005539 Bacteria 2779
118 Ga0068853_100176055 3300005539 Bacteria 1938
119 Ga0068853_100203649 3300005539 Bacteria 1801
120 Ga0070672_100105050 3300005543 Bacteria 2296
121 Ga0068855_100610875 3300005563 Bacteria 1175
122 Ga0070664_100012768 3300005564 Bacteria 6834
123 Ga0070664_100031855 3300005564 Bacteria 4408
124 Ga0068857_100107264 3300005577 Bacteria 2508
125 Ga0068857_100362586 3300005577 Bacteria 1343
126 Ga0068854_100157576 3300005578 Bacteria 1756
127 Ga0068854_101000924 3300005578 Bacteria 740
128 Ga0068854_101087652 3300005578 Bacteria 712
129 Ga0068852_100016390 3300005616 Bacteria 5776
130 Ga0068852_100229803 3300005616 Bacteria 1768
131 Ga0068851_10014139 3300005834 Bacteria 3786
132 Ga0068858_100804872 3300005842 Bacteria 917
133 Ga0068862_100011728 3300005844 Bacteria 7234
134 Ga0075365_10024063 3300006038 Bacteria 3837
135 Ga0075363_100086618 3300006048 Bacteria 1720
136 Ga0075364_10069982 3300006051 Bacteria 2309
137 Ga0075364_10075286 3300006051 Bacteria 2227
138 Ga0075364_10132379 3300006051 Bacteria 1674
139 Ga0075432_10007264 3300006058 Bacteria 3773
140 Ga0075432_10065093 3300006058 Bacteria 1303
141 Ga0075432_10107833 3300006058 Bacteria 1035
142 Ga0075362_10014486 3300006177 Bacteria 3184
143 Ga0075362_10028411 3300006177 Bacteria 2402
144 Ga0075362_10031463 3300006177 Bacteria 2296
145 Ga0075362_10048721 3300006177 Bacteria 1891
146 Ga0075362_10209693 3300006177 Bacteria 950
147 Ga0075367_10092119 3300006178 Bacteria 1845
148 Ga0075367_10150449 3300006178 Bacteria 1444
149 Ga0075367_10437290 3300006178 Bacteria 829
150 Ga0075369_10023885 3300006186 Bacteria 2530
151 Ga0075366_10009278 3300006195 Bacteria 5493
152 Ga0075366_10017692 3300006195 Bacteria 4107
153 Ga0075366_10056332 3300006195 Bacteria 2335
154 Ga0075366_10140381 3300006195 Bacteria 1460
155 Ga0097621_100388322 3300006237 Bacteria 1248
156 Ga0097621_100459103 3300006237 Bacteria 1148
157 Ga0075370_10000282 3300006353 Bacteria 18351
158 Ga0075370_10000918 3300006353 Bacteria 12102
159 Ga0075370_10018552 3300006353 Bacteria 3777
160 Ga0075370_10028661 3300006353 Bacteria 3096
161 Ga0075370_10047822 3300006353 Bacteria 2422
162 Ga0075370_10132707 3300006353 Bacteria 1454
163 Ga0075429_100488514 3300006880 Bacteria 1079
164 Ga0068865_100572676 3300006881 Bacteria 951
165 Ga0079104_1000055 3300006946 Bacteria 166522
166 Ga0079104_1000714 3300006946 Bacteria 30116
167 Ga0105244_10004556 3300009036 Bacteria 9491
168 Ga0105250_10000934 3300009092 Bacteria 17188
169 Ga0105240_10281395 3300009093 Bacteria 1910
170 Ga0105240_10651654 3300009093 Bacteria 1154
171 Ga0105245_10197255 3300009098 Bacteria 1932
172 Ga0105243_10003653 3300009148 Bacteria 12382
173 Ga0105243_10012778 3300009148 Bacteria 6342
174 Ga0105241_10056465 3300009174 Bacteria 3010
175 Ga0105242_10002298 3300009176 Bacteria 15099
176 Ga0105242_10051506 3300009176 Bacteria 3355
177 Ga0105248_10409986 3300009177 Bacteria 1526
178 Ga0105237_10121150 3300009545 Bacteria 2611
179 Ga0105238_10235490 3300009551 Bacteria 1808
180 Ga0105239_10146308 3300010375 Bacteria 2635
181 Ga0105239_10499729 3300010375 Bacteria 1382
182 Ga0105246_10086033 3300011119 Bacteria 2253
183 Ga0105246_10170122 3300011119 Bacteria 1668
184 Ga0105246_10194393 3300011119 Bacteria 1573
185 Ga0105246_10209400 3300011119 Bacteria 1521
186 Ga0157326_1001779 3300012513 Bacteria 2350
187 Ga0157373_10055234 3300013100 Bacteria 2821
188 Ga0157373_10081013 3300013100 Bacteria 2289
189 Ga0157371_10141288 3300013102 Bacteria 1715
190 Ga0157370_10003589 3300013104 Bacteria 18150
191 Ga0157369_10037069 3300013105 Bacteria 5340
192 Ga0157374_10103917 3300013296 Bacteria 2727
193 Ga0163162_10186099 3300013306 Bacteria 2204
194 Ga0163162_10542396 3300013306 Bacteria 1292
195 Ga0157372_10043961 3300013307 Bacteria 4948
196 Ga0157375_10317222 3300013308 Bacteria 1723
197 Ga0157375_10656933 3300013308 Bacteria 1204
198 Ga0182008_10002011 3300014497 Bacteria 13053
199 Ga0182008_10003005 3300014497 Bacteria 10376
200 Ga0182008_10010313 3300014497 Bacteria 5003
201 Ga0182008_10049350 3300014497 Bacteria 2089
202 Ga0157376_10002202 3300014969 Bacteria 13148
203 Ga0182006_1028312 3300015261 Bacteria 2279
204 Ga0182006_1085716 3300015261 Bacteria 1142
205 Ga0182006_1109726 3300015261 Bacteria 970
206 Ga0182007_10000674 3300015262 Bacteria 19632
207 Ga0182007_10008930 3300015262 Bacteria 4082
208 Ga0182005_1067553 3300015265 Bacteria 980
209 Ga0183362_10005 3300015683 Bacteria 437616
210 Ga0163161_10000114 3300017792 Bacteria 76397
211 Ga0163161_10101536 3300017792 Bacteria 2141
212 Ga0163161_10122410 3300017792 Bacteria 1956
213 Ga0163161_10129392 3300017792 Bacteria 1903
214 Ga0163161_10268375 3300017792 Bacteria 1335
215 Ga0163161_10454163 3300017792 Bacteria 1036
216 Ga0213872_10004249 3300021361 Bacteria 7679
217 Ga0209435_100003 3300025206 Bacteria 669534
218 Ga0209436_106469 3300025208 Bacteria 2562
219 Ga0209436_109896 3300025208 Bacteria 1780
220 Ga0209672_104078 3300025228 Bacteria 2812
221 Ga0209147_105455 3300025229 Bacteria 1899
222 Ga0209258_100568 3300025242 Bacteria 31666
223 Ga0207425_1001221 3300025245 Bacteria 11309
224 Ga0207425_1002159 3300025245 Bacteria 7193
225 Ga0207425_1011740 3300025245 Bacteria 2075
226 Ga0207425_1012211 3300025245 Bacteria 2022
227 Ga0209646_1000008 3300025246 Bacteria 669534
228 Ga0209026_1000007 3300025250 Bacteria 669534
229 Ga0209148_1000033 3300025254 Bacteria 555508
230 Ga0209759_1000019 3300025256 Bacteria 357908
231 Ga0209129_1000227 3300025258 Bacteria 63512
232 Ga0209129_1000294 3300025258 Bacteria 47351
233 Ga0209129_1006379 3300025258 Bacteria 3832
234 Ga0209129_1010140 3300025258 Bacteria 2387
235 Ga0209129_1011664 3300025258 Bacteria 2082
236 Ga0209565_1000020 3300025263 Bacteria 432627
237 Ga0209565_1000116 3300025263 Bacteria 114340
238 Ga0209565_1000171 3300025263 Bacteria 84566
239 Ga0209565_1005961 3300025263 Bacteria 3486
240 Ga0209565_1009957 3300025263 Bacteria 2379
241 Ga0209673_1000295 3300025273 Bacteria 92499
242 Ga0209673_1001210 3300025273 Bacteria 27444
243 Ga0209673_1001360 3300025273 Bacteria 24264
244 Ga0209673_1001942 3300025273 Bacteria 16305
245 Ga0209673_1020479 3300025273 Bacteria 2340
246 Ga0209673_1029925 3300025273 Bacteria 1725
247 Ga0209673_1032115 3300025273 Bacteria 1622
248 Ga0209130_1000095 3300025284 Bacteria 145126
249 Ga0209130_1000134 3300025284 Bacteria 119102
250 Ga0209130_1000193 3300025284 Bacteria 84550
251 Ga0209130_1000560 3300025284 Bacteria 36900
252 Ga0209675_1000014 3300025291 Bacteria 421902
253 Ga0209675_1001804 3300025291 Bacteria 11691
254 Ga0209675_1003215 3300025291 Bacteria 7913
255 Ga0209675_1008491 3300025291 Bacteria 3765
256 Ga0209675_1012282 3300025291 Bacteria 2771
257 Ga0209675_1017248 3300025291 Bacteria 2068
258 Ga0209675_1026281 3300025291 Bacteria 1451
259 Ga0209676_1000048 3300025292 Bacteria 403716
260 Ga0209676_1000098 3300025292 Bacteria 234305
261 Ga0209676_1000124 3300025292 Bacteria 194206
262 Ga0209676_1000145 3300025292 Bacteria 174391
263 Ga0209676_1016118 3300025292 Bacteria 2716
264 Ga0209676_1022886 3300025292 Bacteria 2058
265 Ga0209676_1027050 3300025292 Bacteria 1810
266 Ga0209025_1000204 3300025294 Bacteria 142193
267 Ga0209025_1000264 3300025294 Bacteria 123411
268 Ga0209025_1000348 3300025294 Bacteria 100228
269 Ga0209025_1003744 3300025294 Bacteria 13938
270 Ga0209025_1005205 3300025294 Bacteria 10733
271 Ga0209025_1009410 3300025294 Bacteria 6812
272 Ga0209025_1017213 3300025294 Bacteria 4193
273 Ga0209025_1019826 3300025294 Bacteria 3716
274 Ga0209025_1024711 3300025294 Bacteria 3090
275 Ga0209025_1068041 3300025294 Bacteria 1282
276 Ga0209564_1000231 3300025295 Bacteria 123417
277 Ga0209564_1000300 3300025295 Bacteria 98386
278 Ga0209564_1000728 3300025295 Bacteria 46991
279 Ga0209564_1001669 3300025295 Bacteria 21246
280 Ga0209564_1006632 3300025295 Bacteria 6186
281 Ga0209758_1000222 3300025297 Bacteria 123411
282 Ga0209758_1000453 3300025297 Bacteria 68482
283 Ga0209758_1000605 3300025297 Bacteria 55552
284 Ga0209758_1015212 3300025297 Bacteria 4008
285 Ga0209758_1025105 3300025297 Bacteria 2626
286 Ga0209758_1047085 3300025297 Bacteria 1548
287 Ga0209050_1000012 3300025298 Bacteria 813717
288 Ga0209050_1000023 3300025298 Bacteria 537172
289 Ga0209050_1000252 3300025298 Bacteria 115215
290 Ga0209050_1003801 3300025298 Bacteria 10778
291 Ga0209050_1003829 3300025298 Bacteria 10730
292 Ga0209256_1000003 3300025299 Bacteria 1661127
293 Ga0209256_1000049 3300025299 Bacteria 310696
294 Ga0209256_1000095 3300025299 Bacteria 206120
295 Ga0209256_1000749 3300025299 Bacteria 42336
296 Ga0209256_1024835 3300025299 Bacteria 1757
297 Ga0209256_1040713 3300025299 Bacteria 1185
298 Ga0207426_1000058 3300025302 Bacteria 363857
299 Ga0207426_1000349 3300025302 Bacteria 84546
300 Ga0207426_1000397 3300025302 Bacteria 73966
301 Ga0207426_1001961 3300025302 Bacteria 14639
302 Ga0209051_1000017 3300025303 Bacteria 537172
303 Ga0209051_1000019 3300025303 Bacteria 511268
304 Ga0209051_1000098 3300025303 Bacteria 165284
305 Ga0209051_1000099 3300025303 Bacteria 165161
306 Ga0209051_1000247 3300025303 Bacteria 91122
307 Ga0209051_1000456 3300025303 Bacteria 54000
308 Ga0209051_1000579 3300025303 Bacteria 43794
309 Ga0209051_1067993 3300025303 Bacteria 1086
310 Ga0209051_1086562 3300025303 Bacteria 886
311 Ga0209257_1000015 3300025304 Bacteria 908141
312 Ga0209257_1000024 3300025304 Bacteria 726068
313 Ga0209257_1000041 3300025304 Bacteria 537172
314 Ga0209257_1000141 3300025304 Bacteria 201130
315 Ga0209257_1000258 3300025304 Bacteria 122220
316 Ga0209257_1006531 3300025304 Bacteria 7455
317 Ga0209257_1021034 3300025304 Bacteria 2385
318 Ga0207656_10136058 3300025321 Bacteria 1155
319 Ga0207696_1002314 3300025711 Bacteria 9448
320 Ga0207655_1008069 3300025728 Bacteria 6743
321 Ga0207682_10081227 3300025893 Bacteria 1390
322 Ga0207645_10030133 3300025907 Bacteria 3496
323 Ga0207657_10333452 3300025919 Bacteria 1198
324 Ga0207649_10000335 3300025920 Bacteria 35710
325 Ga0207681_10011235 3300025923 Bacteria 5500
326 Ga0207681_10263225 3300025923 Bacteria 1351
327 Ga0207694_10664360 3300025924 Bacteria 878
328 Ga0207650_10291841 3300025925 Bacteria 1330
329 Ga0207690_10000176 3300025932 Bacteria 49560
330 Ga0207706_10005101 3300025933 Bacteria 12262
331 Ga0207706_10474020 3300025933 Bacteria 1082
332 Ga0207686_10011578 3300025934 Bacteria 4833
333 Ga0207686_10470623 3300025934 Bacteria 970
334 Ga0207709_10000331 3300025935 Bacteria 50983
335 Ga0207709_10000728 3300025935 Bacteria 26361
336 Ga0207709_10007073 3300025935 Bacteria 6272
337 Ga0207669_10317294 3300025937 Bacteria 1191
338 Ga0207669_10587753 3300025937 Bacteria 903
339 Ga0207691_10050413 3300025940 Bacteria 3811
340 Ga0207691_10225673 3300025940 Bacteria 1623
341 Ga0207689_10317804 3300025942 Bacteria 1292
342 Ga0207679_10000168 3300025945 Bacteria 54187
343 Ga0207679_10698259 3300025945 Bacteria 920
344 Ga0207667_10210076 3300025949 Bacteria 1995
345 Ga0207667_10474508 3300025949 Bacteria 1270
346 Ga0207651_10144391 3300025960 Bacteria 1843
347 Ga0207651_10160010 3300025960 Bacteria 1764
348 Ga0207651_10332355 3300025960 Bacteria 1274
349 Ga0207668_10302357 3300025972 Bacteria 1321
350 Ga0207658_10054381 3300025986 Bacteria 2962
351 Ga0207677_10112838 3300026023 Bacteria 2028
352 Ga0207677_10445882 3300026023 Bacteria 1108
353 Ga0207639_10114287 3300026041 Bacteria 2206
354 Ga0207639_10141709 3300026041 Bacteria 2003
355 Ga0207639_10164284 3300026041 Bacteria 1874
356 Ga0207648_10065975 3300026089 Bacteria 3156
357 Ga0207676_11259737 3300026095 Bacteria 734
358 Ga0207674_10133308 3300026116 Bacteria 2447
359 Ga0207683_10061823 3300026121 Bacteria 3297
360 Ga0207683_10111598 3300026121 Bacteria 2448
361 Ga0207683_10372091 3300026121 Bacteria 1313
362 Ga0207698_10029695 3300026142 Bacteria 3919
363 Ga0207698_10173197 3300026142 Bacteria 1903
364 Ga0209281_1000007 3300027111 Bacteria 938265
365 Ga0209281_1001190 3300027111 Bacteria 17791
366 Ga0209970_1000068 3300027614 Bacteria 14109
367 Ga0209282_1000501 3300027666 Bacteria 19021
368 Ga0209971_1002743 3300027682 Bacteria 4207
369 Ga0209998_10012096 3300027717 Bacteria 1791
370 Ga0209974_10025576 3300027876 Bacteria 1954
371 Ga0207428_10472031 3300027907 Bacteria 913
372 Ga0268266_10017420 3300028379 Bacteria 6127
373 Ga0268265_10024287 3300028380 Bacteria 4287
374 Ga0268265_10045754 3300028380 Bacteria 3268
375 Ga0307515_10000040 3300028794 Bacteria 322704
376 Ga0307515_10000257 3300028794 Bacteria 131732
377 Ga0307515_10235199 3300028794 Bacteria 1615
378 Ga0307512_10122949 3300030522 Bacteria 1659
379 Ga0316176_1014050 3300030732 Bacteria 1792
380 Ga0314311_1003705 3300030733 Bacteria 9220
381 Ga0316178_1010462 3300030735 Bacteria 4027
382 Ga0316183_1067419 3300030742 Bacteria 8873
383 Ga0316181_1007566 3300030744 Bacteria 1026
384 Ga0316182_1188730 3300030745 Bacteria 1381
385 Ga0265330_10000046 3300031235 Bacteria 108853
386 Ga0265332_10000005 3300031238 Bacteria 377525
387 Ga0265332_10000028 3300031238 Bacteria 184029
388 Ga0265320_10079453 3300031240 Bacteria 1533
389 Ga0265325_10001397 3300031241 Bacteria 17039
390 Ga0265340_10037610 3300031247 Bacteria 2397
391 Ga0265327_10000235 3300031251 Bacteria 111362
392 Ga0265327_10001208 3300031251 Bacteria 34808
393 Ga0265327_10037618 3300031251 Bacteria 2647
394 Ga0265316_10000332 3300031344 Bacteria 52832
395 Ga0307513_10000113 3300031456 Bacteria 114576
396 Ga0307513_10004582 3300031456 Bacteria 18428
397 Ga0307513_10011506 3300031456 Bacteria 10991
398 Ga0307513_10361629 3300031456 Bacteria 1196
399 Ga0307408_100000101 3300031548 Bacteria 94089
400 Ga0307408_100013522 3300031548 Bacteria 5417
401 Ga0307408_100102668 3300031548 Bacteria 2181
402 Ga0307408_100167065 3300031548 Bacteria 1753
403 Ga0307408_100650033 3300031548 Bacteria 943
404 Ga0307514_10000928 3300031649 Bacteria 44600
405 Ga0307514_10133587 3300031649 Bacteria 1703
406 Ga0265314_10000054 3300031711 Bacteria 184029
407 Ga0307516_10058267 3300031730 Bacteria 3760
408 Ga0307516_10063255 3300031730 Bacteria 3583
409 Ga0307405_10008898 3300031731 Bacteria 5119
410 Ga0307405_10080257 3300031731 Bacteria 2129
411 Ga0307413_10287365 3300031824 Bacteria 1240
412 Ga0307410_10185345 3300031852 Bacteria 1579
413 Ga0307406_10000497 3300031901 Bacteria 22565
414 Ga0307406_10031294 3300031901 Bacteria 3238
415 Ga0307407_10210180 3300031903 Bacteria 1309
416 Ga0307412_10008057 3300031911 Bacteria 6003
417 Ga0307412_10052422 3300031911 Bacteria 2701
418 Ga0307412_10237912 3300031911 Bacteria 1406
419 Ga0307412_10260067 3300031911 Bacteria 1352
420 Ga0307412_10293715 3300031911 Bacteria 1281
421 Ga0307412_10465026 3300031911 Bacteria 1045
422 Ga0307412_10640307 3300031911 Bacteria 905
423 Ga0307409_100738712 3300031995 Bacteria 987
424 Ga0307416_100106996 3300032002 Bacteria 2453
425 Ga0307416_100126451 3300032002 Bacteria 2290
426 Ga0307416_100216767 3300032002 Bacteria 1831
427 Ga0307416_100334462 3300032002 Bacteria 1524
428 Ga0307414_10290726 3300032004 Bacteria 1377
429 Ga0307411_10053721 3300032005 Bacteria 2641
430 Ga0307411_10062461 3300032005 Bacteria 2485
431 Ga0307411_11033111 3300032005 Bacteria 737
432 Ga0307415_100239472 3300032126 Bacteria 1467
433 Ga0395899_0006932 3300037312 Bacteria 8777
434 Ga0395900_0032376 3300037418 Bacteria 5377
435 Ga0395900_0036214 3300037418 Bacteria 5086
436 Ga0395898_0023156 3300037466 Bacteria 6278
437 Ga0395898_0035122 3300037466 Bacteria 4989
438 Ga0395905_0000212 3300037471 Bacteria 89838
439 Ga0395905_0000607 3300037471 Bacteria 47962
440 Ga0395905_0004023 3300037471 Bacteria 15426
441 Ga0395905_0099475 3300037471 Bacteria 2731
442 Ga0395905_0134600 3300037471 Bacteria 2324
443 Ga0395905_0392916 3300037471 Bacteria 1281
444 Ga0395905_0493229 3300037471 Bacteria 1125
445 Ga0395905_0665289 3300037471 Bacteria 943
446 Ga0395901_0133122 3300038443 Bacteria 2612
447 Ga0395901_0141343 3300038443 Bacteria 2530
448 Ga0395901_0161929 3300038443 Bacteria 2350
449 Ga0436361_0247854 3300039447 Bacteria 31958
450 Ga0439436_0000562 3300041404 Bacteria 9794
451 Ga0439436_0002238 3300041404 Bacteria 5788
452 Ga0439436_0022773 3300041404 Bacteria 1855
453 Ga0439438_022578 3300041405 Bacteria 1744
454 Ga0439439_0008098 3300041406 Bacteria 2472
455 Ga0439439_0019130 3300041406 Bacteria 1697
456 Ga0439466_0010304 3300041411 Bacteria 3475
457 Ga0439466_0014211 3300041411 Bacteria 2902
458 Ga0439466_0022944 3300041411 Bacteria 2198
459 Ga0439465_0000277 3300041413 Bacteria 14344
460 Ga0439465_0122542 3300041413 Bacteria 912
461 Ga0451791_1838390 3300041451 Bacteria 3287
462 Ga0451793_1782101 3300041452 Bacteria 1192
463 Ga0451795_0347533 3300041456 Bacteria 996
464 Ga0451795_0584715 3300041456 Bacteria 2323
465 Ga0451802_0579892 3300041460 Bacteria 913
466 Ga0451807_0649746 3300041486 Bacteria 1023
467 Ga0451807_0729911 3300041486 Bacteria 1160
468 Ga0451807_2730351 3300041486 Bacteria 1305
469 Ga0451853_1882879 3300041512 Bacteria 759
470 Ga0439433_0001048 3300041999 Bacteria 5613
471 Ga0439437_008399 3300042000 Bacteria 1161
472 Ga0439437_011307 3300042000 Bacteria 1022
473 Ga0439441_039044 3300042001 Bacteria 946
474 Ga0439442_007320 3300042002 Bacteria 2219
475 Ga0439445_0000763 3300042004 Bacteria 6751
476 Ga0439445_0020134 3300042004 Bacteria 1668
477 Ga0439445_0109876 3300042004 Bacteria 786
478 Ga0439432_001936 3300042006 Bacteria 7821
479 Ga0439432_003064 3300042006 Bacteria 6225
480 Ga0439432_039445 3300042006 Bacteria 1501
481 Ga0439449_0000120 3300042007 Bacteria 25953
482 Ga0439449_0000453 3300042007 Bacteria 15268
483 Ga0439449_0002248 3300042007 Bacteria 7592
484 Ga0439449_0080899 3300042007 Bacteria 1198
485 Ga0439452_002310 3300042010 Bacteria 7105
486 Ga0439452_011741 3300042010 Bacteria 2509
487 Ga0439462_0004564 3300042015 Bacteria 3387
488 Ga0439462_0008753 3300042015 Bacteria 2558
489 Ga0439462_0010910 3300042015 Bacteria 2307
490 Ga0439462_0079854 3300042015 Bacteria 893
491 Ga0439462_0092446 3300042015 Bacteria 831
492 Ga0439463_097418 3300042016 Bacteria 758
493 Ga0450911_000351 3300042115 Bacteria 15672
494 Ga0450919_001118 3300042121 Bacteria 3472
495 Ga0450923_007069 3300042125 Bacteria 1884
496 Ga0450923_025754 3300042125 Bacteria 1174
497 Ga0450888_006212 3300042126 Bacteria 1294
498 Ga0450890_006779 3300042127 Bacteria 1462
499 Ga0450890_009757 3300042127 Bacteria 1233
500 Ga0450894_010502 3300042131 Bacteria 1201
501 Ga0450896_002703 3300042133 Bacteria 2309
502 Ga0450898_004060 3300042134 Bacteria 2140
503 Ga0450898_004975 3300042134 Bacteria 1989
504 Ga0450898_008896 3300042134 Bacteria 1597
505 Ga0450899_009056 3300042135 Bacteria 1094
506 Ga0450906_000192 3300042145 Bacteria 11600
507 Ga0450906_016518 3300042145 Bacteria 1335
508 Ga0450910_001673 3300042147 Bacteria 2843
509 Ga0450908_000821 3300042184 Bacteria 5979
510 Ga0450908_002821 3300042184 Bacteria 3377
511 Ga0439434_0000289 3300042435 Bacteria 14374
512 Ga0439434_0028083 3300042435 Bacteria 1703
513 Ga0439434_0120115 3300042435 Bacteria 856
514 Ga0439464_0054046 3300042439 Bacteria 1166
515 Ga0450918_000077 3300042531 Bacteria 20527
516 Ga0450918_000437 3300042531 Bacteria 8985
517 Ga0451577_0679486 3300042876 Bacteria 933
518 Ga0466969_0017993 3300044656 Bacteria 3686
519 Ga0466969_0049594 3300044656 Bacteria 2071
520 Ga0466972_0059783 3300044658 Bacteria 1829
521 Ga0453683_0001887 3300044673 Bacteria 17174
522 Ga0453683_0003653 3300044673 Bacteria 11274
523 Ga0466965_0007028 3300044683 Bacteria 5151
524 Ga0466966_0018603 3300044684 Bacteria 4578
525 Ga0466961_0014170 3300044693 Bacteria 5116
526 Ga0466961_0076262 3300044693 Bacteria 2125
527 Ga0453684_0018472 3300044712 Bacteria 10699
528 Ga0453684_0713528 3300044712 Bacteria 1089
529 Ga0466971_0346123 3300044719 Bacteria 719
530 Ga0466970_0201719 3300044765 Bacteria 1107
531 Ga0466957_0151992 3300044842 Bacteria 1498
532 Ga0466957_0257573 3300044842 Bacteria 1162
533 Ga0466957_0262072 3300044842 Bacteria 1152
534 Ga0466960_0469123 3300044901 Bacteria 734
535 Ga0466959_0088349 3300045049 Bacteria 2228
536 Ga0451576_0026738 3300045051 Bacteria 6203
537 Ga0451576_0120857 3300045051 Bacteria 2727
538 Ga0466967_0495772 3300045976 Bacteria 1198
539 Ga0495627_016376 3300046453 Bacteria 2538
540 Ga0495627_017833 3300046453 Bacteria 2404
541 Ga0495629_0146988 3300046459 Bacteria 1639
542 Ga0495638_0075820 3300046460 Bacteria 2049
543 Ga0495639_0016063 3300046475 Bacteria 3247
544 Ga0495616_0023910 3300046513 Bacteria 3283
545 Ga0495620_0019241 3300046515 Bacteria 3363
546 Ga0495631_0000927 3300046518 Bacteria 18232
547 Ga0495632_0005292 3300046519 Bacteria 8572
548 Ga0495637_0001152 3300046520 Bacteria 16212
549 Ga0495637_0061649 3300046520 Bacteria 1537
550 Ga0495643_0145643 3300046522 Bacteria 1177
551 Ga0495642_0002659 3300046528 Bacteria 7190
552 Ga0495642_0260407 3300046528 Bacteria 758
553 Ga0495654_0001504 3300046530 Bacteria 15939
554 Ga0495654_0044568 3300046530 Bacteria 2194
555 Ga0495654_0096826 3300046530 Bacteria 1363
556 Ga0495621_0031312 3300046539 Bacteria 1824
557 Ga0495622_0033391 3300046557 Bacteria 2402
558 Ga0495633_0001809 3300046558 Bacteria 15760
559 Ga0495633_0156063 3300046558 Bacteria 1053
560 Ga0495656_0002859 3300046615 Bacteria 5785
561 Ga0495625_0000045 3300046660 Bacteria 202475
562 Ga0495625_0041165 3300046660 Bacteria 3364
563 Ga0495635_0132374 3300046663 Bacteria 1700
564 Ga0495661_0087152 3300046665 Bacteria 1786
565 Ga0495588_0009189 3300046674 Bacteria 4563
566 Ga0495658_0012053 3300046683 Bacteria 4366
567 Ga0495669_0111828 3300046684 Bacteria 1276
568 Ga0495670_0048023 3300046691 Bacteria 2135
569 Ga0495671_0010658 3300046692 Bacteria 5085
570 Ga0495660_0326335 3300046810 Bacteria 688
571 Ga0495674_0086548 3300047319 Bacteria 2683
572 Ga0495676_0013815 3300047321 Bacteria 7239
573 Ga0495677_0057140 3300047445 Bacteria 1442
574 Ga0495677_0065683 3300047445 Bacteria 1349
575 Ga0495685_031458 3300047447 Bacteria 1824
576 Ga0495685_116524 3300047447 Bacteria 878
577 Ga0495593_0012980 3300047673 Bacteria 4758
578 Ga0495614_0049081 3300048089 Bacteria 1809
579 Ga0495615_0007612 3300048090 Bacteria 2062
580 Ga0495615_0018928 3300048090 Bacteria 1523
581 Ga0495615_0086480 3300048090 Bacteria 867
582 Ga0496100_0038094 3300048903 Bacteria 3044
583 Ga0496101_0024578 3300048904 Bacteria 4170
584 Ga0496102_0048128 3300048905 Bacteria 3876
585 Ga0496103_0039550 3300048906 Bacteria 2898
586 Ga0496104_0100676 3300048907 Bacteria 2766
587 Ga0496105_0047749 3300048908 Bacteria 3533
588 Ga0496106_0049724 3300048909 Bacteria 3159
589 Ga0496106_0248819 3300048909 Bacteria 1421
590 Ga0496107_0012575 3300048910 Bacteria 5911
591 Ga0496110_0132482 3300048913 Bacteria 2251
592 Ga0496110_0451658 3300048913 Bacteria 1171
593 Ga0496111_0046348 3300048914 Bacteria 3130
594 Ga0496114_0046024 3300048917 Bacteria 3625
595 Ga0496116_0043465 3300048919 Bacteria 3061
596 Ga0496116_0101509 3300048919 Bacteria 1717
597 Ga0496117_0014880 3300048920 Bacteria 6673
598 Ga0496117_0093107 3300048920 Bacteria 1934
599 Ga0496117_0100631 3300048920 Bacteria 1830
600 Ga0496117_0130005 3300048920 Bacteria 1528
601 Ga0496118_0015707 3300048921 Bacteria 6991
602 Ga0496118_0019070 3300048921 Bacteria 6148
603 Ga0496118_0409245 3300048921 Bacteria 702
604 Ga0496121_0049634 3300048924 Bacteria 3555
605 Ga0496121_0056714 3300048924 Bacteria 3251
606 Ga0496121_0143935 3300048924 Bacteria 1764
607 Ga0496122_0000331 3300048925 Bacteria 102617
608 Ga0496122_0088660 3300048925 Bacteria 2119
609 Ga0496122_0093309 3300048925 Bacteria 2042
610 Ga0496122_0162766 3300048925 Bacteria 1358
611 Ga0496122_0355111 3300048925 Bacteria 763
612 Ga0496123_0001132 3300048926 Bacteria 39831
613 Ga0496123_0036698 3300048926 Bacteria 3471
614 Ga0496123_0132987 3300048926 Bacteria 1374
615 Ga0496123_0137343 3300048926 Bacteria 1343
616 Ga0496124_0053987 3300048927 Bacteria 3403
617 Ga0496124_0089765 3300048927 Bacteria 2508
618 Ga0496124_0315773 3300048927 Bacteria 1121
619 Ga0496124_0323394 3300048927 Bacteria 1103
620 Ga0496124_0458238 3300048927 Bacteria 867
621 Ga0496125_0001189 3300048928 Bacteria 39370
622 Ga0496125_0024091 3300048928 Bacteria 5604
623 Ga0496125_0046129 3300048928 Bacteria 3659
624 Ga0496125_0085887 3300048928 Bacteria 2382
625 Ga0496125_0214612 3300048928 Bacteria 1246
626 Ga0496125_0292292 3300048928 Bacteria 1003
627 Ga0496126_0001477 3300048929 Bacteria 36534
628 Ga0496126_0057238 3300048929 Bacteria 3521
629 Ga0496126_0443543 3300048929 Bacteria 1046
630 Ga0496126_0940626 3300048929 Bacteria 652
631 Ga0501034_0622574 3300049571 Bacteria 983
632 Ga0501036_0218417 3300049572 Bacteria 1601
633 Ga0501047_0057504 3300049581 Bacteria 3761
634 Ga0501249_002182 3300049679 Bacteria 3988
635 Ga0501225_0092914 3300049705 Bacteria 875
636 Ga0501262_000434 3300049759 Bacteria 5015
637 Ga0501266_034053 3300049763 Bacteria 737
638 nmdc:mga03683_103713_c1 3300050489 Bacteria 1252
639 nmdc:mga03683_151260_c1 3300050489 Bacteria 1047
640 nmdc:mga03683_15696_c1 3300050489 Bacteria 2831
641 nmdc:mga03683_183083_c1 3300050489 Bacteria 956
642 nmdc:mga03683_235671_c1 3300050489 Bacteria 847
643 nmdc:mga03683_52700_c1 3300050489 Bacteria 1701
644 nmdc:mga03683_7472_c1 3300050489 Bacteria 3794
645 nmdc:mga03n38_19715_c1 3300050490 Bacteria 2684
646 nmdc:mga03n38_20085_c1 3300050490 Bacteria 2667
647 nmdc:mga03n38_98848_c1 3300050490 Bacteria 1404
648 nmdc:mga00v17_31009_c1 3300050491 Bacteria 3150
649 nmdc:mga00v17_51844_c1 3300050491 Bacteria 2495
650 nmdc:mga0yw44_38982_c1 3300050492 Bacteria 2814
651 nmdc:mga0yw44_43614_c1 3300050492 Bacteria 2679
652 nmdc:mga0k408_17127_c1 3300050493 Bacteria 4032
653 nmdc:mga0k408_197950_c1 3300050493 Bacteria 1199
654 nmdc:mga0k408_203247_c1 3300050493 Bacteria 1183
655 nmdc:mga0k408_40803_c1 3300050493 Bacteria 2672
656 nmdc:mga0k408_43251_c2 3300050493 Bacteria 703
657 nmdc:mga0k408_506192_c1 3300050493 Bacteria 715
658 nmdc:mga0k408_52414_c1 3300050493 Bacteria 2365
659 nmdc:mga0k408_59892_c1 3300050493 Bacteria 2212
660 nmdc:mga07m45_158071_c1 3300050496 Bacteria 1315
661 nmdc:mga07m45_161406_c1 3300050496 Bacteria 1301
662 nmdc:mga07m45_21021_c1 3300050496 Bacteria 3063
663 nmdc:mga07m45_30257_c1 3300050496 Bacteria 2998
664 nmdc:mga07m45_53694_c1 3300050496 Bacteria 2277
665 nmdc:mga07m45_59868_c1 3300050496 Bacteria 2155
666 nmdc:mga09592_20553_c1 3300050508 Bacteria 5431
667 nmdc:mga0qj67_153805_c1 3300050509 Bacteria 1866
668 nmdc:mga0sz30_39319_c1 3300050516 Bacteria 1984
669 Ga0500610_0001980 3300053079 Bacteria 7301
670 Ga0500610_0006936 3300053079 Bacteria 4802
671 Ga0500578_0000025 3300053086 Bacteria 151485
672 Ga0500646_0019599 3300053090 Bacteria 1790
673 Ga0500651_0000112 3300053093 Bacteria 49988
674 Ga0500651_0013143 3300053093 Bacteria 5034
675 Ga0500651_0062947 3300053093 Bacteria 2316
676 Ga0500566_0186619 3300053094 Bacteria 1059
677 Ga0500641_0087128 3300053096 Bacteria 1330
678 Ga0500569_071464 3300053109 Bacteria 1093
679 Ga0500571_027167 3300053110 Bacteria 3165
680 Ga0500572_098750 3300053111 Bacteria 932
681 Ga0500593_003265 3300053117 Bacteria 6104
682 Ga0500593_006316 3300053117 Bacteria 4735
683 Ga0500626_063714 3300053128 Bacteria 1647
684 Ga0500628_061466 3300053129 Bacteria 918
685 Ga0500628_125924 3300053129 Bacteria 699
686 Ga0500652_000177 3300053131 Bacteria 24784
687 Ga0500655_000471 3300053133 Bacteria 8190
688 Ga0500658_0001561 3300053134 Bacteria 9140
689 Ga0500658_0001686 3300053134 Bacteria 8759
690 Ga0500559_0012676 3300053136 Bacteria 3578
691 Ga0500559_0105712 3300053136 Bacteria 1301
692 Ga0500568_0002695 3300053139 Bacteria 10296
693 Ga0500568_0153622 3300053139 Bacteria 851
694 Ga0500622_0000087 3300053156 Bacteria 98385
695 Ga0500622_0067097 3300053156 Bacteria 1820
696 Ga0500634_0055091 3300053161 Bacteria 2129
697 Ga0500638_000683 3300053162 Bacteria 8972
698 Ga0500625_081534 3300053729 Bacteria 1411
699 Ga0500645_000661 3300053730 Bacteria 21613
700 Ga0500645_031433 3300053730 Bacteria 1595
701 Ga0500661_001056 3300055283 Bacteria 5200
702 Ga0590075_014569 3300059424 Bacteria 1923
703 2511242748 2511231002 Bacteria 5042903
704 2513229625 2513020051 Bacteria 6053213
705 2548498969 2547132374 Bacteria 5530232
706 2587725541 2585428057 Bacteria 6737412
707 2599627984 2599185214 Bacteria 8209958
708 2599677795 2599185226 Bacteria 8233575
709 2599685613 2599185227 Bacteria 8246414
710 2599697466 2599185229 Bacteria 8216126
711 2643867813 2643221570 Bacteria 5103772
712 2643970056 2643221592 Bacteria 6608788
713 2643991677 2643221596 Bacteria 5006805
714 2644071330 2643221611 Bacteria 6820941
715 2644142970 2643221625 Bacteria 6512927
716 2644161763 2643221628 Bacteria 5745828
717 2644271970 2643221648 Bacteria 6521465
718 2644325770 2643221658 Bacteria 6064537
719 2644338569 2643221660 Bacteria 4208257
720 2644399692 2643221672 Bacteria 6322190
721 2644465196 2643221683 Bacteria 5749203
722 2644648428 2643221717 Bacteria 5676132
723 2722882029 2721755523 Bacteria 6430384
724 2738723983 2738541277 Bacteria 7458140
725 2738880601 2738541307 Bacteria 8606193
726 2739246482 2738543012 Bacteria 7115078
727 2739247884 2738543013 Bacteria 5618633
728 2739284668 2738543019 Bacteria 7459457
729 2816476336 2816332133 Bacteria 7249298
730 2819602816 2818991446 Bacteria 7757362
731 2831268109 2831265667 Bacteria 7184833
732 2838059151 2838054893 Bacteria 7451788
733 2839142538 2839138175 Bacteria 6549354
734 2842679734 2842677519 Bacteria 5615038
735 2842718774 2842718218 Bacteria 4560148
736 2842752553 2842747753 Bacteria 5578255
737 2881102648 2881101125 Bacteria 4590519
738 2885193036 2885192300 Bacteria 5882526
739 2885203114 2885198086 Bacteria 7212419
740 2885216489 2885211737 Bacteria 7212420
741 2899928048 2899924645 Bacteria 7487985
742 2904452536 2904449895 Bacteria 6927402
743 2904460865 2904456579 Bacteria 6819253
744 2904545250 2904541872 Bacteria 8915136
745 2919463834 2919462493 Bacteria 5817112
746 2928041052 2928037797 Bacteria 7273642
747 2928047894 2928044640 Bacteria 7271509
748 2928055789 2928051484 Bacteria 7773759
749 2928066737 2928064002 Bacteria 7419480
750 2928075253 2928070936 Bacteria 8062541
751 2928088586 2928084124 Bacteria 7159212
752 2928117299 2928115317 Bacteria 6477646
753 2929165442 2929160207 Bacteria 9075316
754 2929522831 2929520902 Bacteria 6765052
755 2932426391 2932422444 Bacteria 4678430
756 2939632132 2939631187 Bacteria 6118131
757 2945909915 2945909444 Bacteria 7065066
758 2945945956 2945945610 Bacteria 5951079
759 2945988124 2945984333 Bacteria 7358892
760 2954768981 2954767861 Bacteria 5535784
761 2974320342 2974320154 Bacteria 4571377
762 2990713877 2990710928 Bacteria 5002431
763 Ga0451577_0029663
764 JGI24740J21852_10009214
765 JGI24740J21852_10009701
766 JGI25155J39150_1000102
767 JGI25156J39149_1000010
768 JGI25154J39366_1000027
769 JGI25158J39367_1006527
770 JGI25157J39369_1000146
771 JGI25152J39213_1000516
772 JGI25152J39213_1010222
773 JGI25152J39213_1011717
774 JGI25150J39212_1003244
775 JGI25150J39212_1007486
776 JGI25150J39212_1009352
777 JGI25150J39212_1010392
778 JGI25159J45721_1000345
779 JGI25159J45721_1001064
780 JGI25159J45721_1012661
781 JGI25159J45721_1013590
782 JGI25151J46595_10010095
783 JGI25151J46595_10019873
784 JGI25151J46595_10029663
785 JGI25151J46595_10033026
786 JGI25151J46595_10033391
787 JGI25153J46596_10002374
788 JGI25153J46596_10003174
789 JGI25153J46596_10027356
790 JGI25160J50197_1000129
791 JGI25160J50197_1017895
792 JGI25160J50197_1020407
793 JGI25160J50197_1040051
794 JGI25161J50226_1000080
795 JGI25161J50226_1006781
796 Ga0006562J51391_1041255
797 Ga0006562J51391_1049985
798 Ga0006562J51391_1049987
799 Ga0055532_1010136
800 Ga0055535_1002183
801 Ga0055542_1000583
802 Ga0055526_1002127
803 Ga0055526_1008955
804 Ga0055526_1024178
805 Ga0055526_1024290
806 Ga0055526_1027178
807 Ga0055526_1033320
808 Ga0055537_1000049
809 Ga0055537_1000779
810 Ga0055537_1007736
811 Ga0055537_1010200
812 Ga0055537_1010260
813 Ga0055524_1000120
814 Ga0055524_1000247
815 Ga0055524_1023266
816 Ga0055536_1001351
817 Ga0055536_1002957
818 Ga0055536_1011940
819 Ga0055536_1015377
820 Ga0055536_1019458
821 Ga0055534_1000049
822 Ga0055534_1001408
823 Ga0055534_1010119
824 Ga0055528_1001145
825 Ga0055528_1002656
826 Ga0055528_1022011
827 Ga0055528_1022152
828 Ga0055528_1026378
829 Ga0055530_10001709
830 Ga0055530_10003781
831 Ga0055530_10010625
832 Ga0055530_10013164
833 Ga0055540_1000067
834 Ga0055540_1000260
835 Ga0055540_1006805
836 Ga0055540_1007545
837 Ga0055540_1009661
838 Ga0055540_1012700
839 Ga0055540_1017793
840 Ga0055531_10001090
841 Ga0055531_10001465
842 Ga0055531_10001523
843 Ga0055531_10006230
844 Ga0055531_10018314
845 Ga0055531_10019468
846 Ga0055531_10027088
847 Ga0055543_1000202
848 Ga0055543_1009803
849 Ga0065165_1001775
850 Ga0065165_1005815
851 Ga0065165_1014928
852 Ga0065165_1024230
853 Ga0065165_1050712
854 Ga0065165_1061976
855 Ga0065714_10014213
856 Ga0065704_10076112
857 Ga0070658_10629042
858 Ga0068869_100174378
859 Ga0068868_100338173
860 Ga0068868_100974123
861 Ga0070660_100201923
862 Ga0070661_100000361
863 Ga0070661_100021114
864 Ga0070661_100162841
865 Ga0070668_100107656
866 Ga0070669_100032646
867 Ga0070675_100415574
868 Ga0070674_100089594
869 Ga0070673_100145557
870 Ga0070673_100192083
871 Ga0070673_100368749
872 Ga0070673_100397158
873 Ga0070659_100002940
874 Ga0070710_10191055
875 Ga0070678_100050277
876 Ga0070678_100597495
877 Ga0070678_100602417
878 Ga0070662_100001973
879 Ga0068853_100084615
880 Ga0068853_100176055
881 Ga0068853_100203649
882 Ga0070672_100105050
883 Ga0068855_100610875
884 Ga0070664_100012768
885 Ga0070664_100031855
886 Ga0068857_100107264
887 Ga0068857_100362586
888 Ga0068854_100157576
889 Ga0068854_101000924
890 Ga0068854_101087652
891 Ga0068852_100016390
892 Ga0068852_100229803
893 Ga0068851_10014139
894 Ga0068858_100804872
895 Ga0068862_100011728
896 Ga0075365_10024063
897 Ga0075363_100086618
898 Ga0075364_10069982
899 Ga0075364_10075286
900 Ga0075364_10132379
901 Ga0075432_10007264
902 Ga0075432_10065093
903 Ga0075432_10107833
904 Ga0075362_10014486
905 Ga0075362_10028411
906 Ga0075362_10031463
907 Ga0075362_10048721
908 Ga0075362_10209693
909 Ga0075367_10092119
910 Ga0075367_10150449
911 Ga0075367_10437290
912 Ga0075369_10023885
913 Ga0075366_10009278
914 Ga0075366_10017692
915 Ga0075366_10056332
916 Ga0075366_10140381
917 Ga0097621_100388322
918 Ga0097621_100459103
919 Ga0075370_10000282
920 Ga0075370_10000918
921 Ga0075370_10018552
922 Ga0075370_10028661
923 Ga0075370_10047822
924 Ga0075370_10132707
925 Ga0075429_100488514
926 Ga0068865_100572676
927 Ga0079104_1000055
928 Ga0079104_1000714
929 Ga0105244_10004556
930 Ga0105250_10000934
931 Ga0105240_10281395
932 Ga0105240_10651654
933 Ga0105245_10197255
934 Ga0105243_10003653
935 Ga0105243_10012778
936 Ga0105241_10056465
937 Ga0105242_10002298
938 Ga0105242_10051506
939 Ga0105248_10409986
940 Ga0105237_10121150
941 Ga0105238_10235490
942 Ga0105239_10146308
943 Ga0105239_10499729
944 Ga0105246_10086033
945 Ga0105246_10170122
946 Ga0105246_10194393
947 Ga0105246_10209400
948 Ga0157326_1001779
949 Ga0157373_10055234
950 Ga0157373_10081013
951 Ga0157371_10141288
952 Ga0157370_10003589
953 Ga0157369_10037069
954 Ga0157374_10103917
955 Ga0163162_10186099
956 Ga0163162_10542396
957 Ga0157372_10043961
958 Ga0157375_10317222
959 Ga0157375_10656933
960 Ga0182008_10002011
961 Ga0182008_10003005
962 Ga0182008_10010313
963 Ga0182008_10049350
964 Ga0157376_10002202
965 Ga0182006_1028312
966 Ga0182006_1085716
967 Ga0182006_1109726
968 Ga0182007_10000674
969 Ga0182007_10008930
970 Ga0182005_1067553
971 Ga0183362_10005
972 Ga0163161_10000114
973 Ga0163161_10101536
974 Ga0163161_10122410
975 Ga0163161_10129392
976 Ga0163161_10268375
977 Ga0163161_10454163
978 Ga0213872_10004249
979 Ga0209435_100003
980 Ga0209436_106469
981 Ga0209436_109896
982 Ga0209672_104078
983 Ga0209147_105455
984 Ga0209258_100568
985 Ga0207425_1001221
986 Ga0207425_1002159
987 Ga0207425_1011740
988 Ga0207425_1012211
989 Ga0209646_1000008
990 Ga0209026_1000007
991 Ga0209148_1000033
992 Ga0209759_1000019
993 Ga0209129_1000227
994 Ga0209129_1000294
995 Ga0209129_1006379
996 Ga0209129_1010140
997 Ga0209129_1011664
998 Ga0209565_1000020
999 Ga0209565_1000116
1000 Ga0209565_1000171
1001 Ga0209565_1005961
1002 Ga0209565_1009957
1003 Ga0209673_1000295
1004 Ga0209673_1001210
1005 Ga0209673_1001360
1006 Ga0209673_1001942
1007 Ga0209673_1020479
1008 Ga0209673_1029925
1009 Ga0209673_1032115
1010 Ga0209130_1000095
1011 Ga0209130_1000134
1012 Ga0209130_1000193
1013 Ga0209130_1000560
1014 Ga0209675_1000014
1015 Ga0209675_1001804
1016 Ga0209675_1003215
1017 Ga0209675_1008491
1018 Ga0209675_1012282
1019 Ga0209675_1017248
1020 Ga0209675_1026281
1021 Ga0209676_1000048
1022 Ga0209676_1000098
1023 Ga0209676_1000124
1024 Ga0209676_1000145
1025 Ga0209676_1016118
1026 Ga0209676_1022886
1027 Ga0209676_1027050
1028 Ga0209025_1000204
1029 Ga0209025_1000264
1030 Ga0209025_1000348
1031 Ga0209025_1003744
1032 Ga0209025_1005205
1033 Ga0209025_1009410
1034 Ga0209025_1017213
1035 Ga0209025_1019826
1036 Ga0209025_1024711
1037 Ga0209025_1068041
1038 Ga0209564_1000231
1039 Ga0209564_1000300
1040 Ga0209564_1000728
1041 Ga0209564_1001669
1042 Ga0209564_1006632
1043 Ga0209758_1000222
1044 Ga0209758_1000453
1045 Ga0209758_1000605
1046 Ga0209758_1015212
1047 Ga0209758_1025105
1048 Ga0209758_1047085
1049 Ga0209050_1000012
1050 Ga0209050_1000023
1051 Ga0209050_1000252
1052 Ga0209050_1003801
1053 Ga0209050_1003829
1054 Ga0209256_1000003
1055 Ga0209256_1000049
1056 Ga0209256_1000095
1057 Ga0209256_1000749
1058 Ga0209256_1024835
1059 Ga0209256_1040713
1060 Ga0207426_1000058
1061 Ga0207426_1000349
1062 Ga0207426_1000397
1063 Ga0207426_1001961
1064 Ga0209051_1000017
1065 Ga0209051_1000019
1066 Ga0209051_1000098
1067 Ga0209051_1000099
1068 Ga0209051_1000247
1069 Ga0209051_1000456
1070 Ga0209051_1000579
1071 Ga0209051_1067993
1072 Ga0209051_1086562
1073 Ga0209257_1000015
1074 Ga0209257_1000024
1075 Ga0209257_1000041
1076 Ga0209257_1000141
1077 Ga0209257_1000258
1078 Ga0209257_1006531
1079 Ga0209257_1021034
1080 Ga0207656_10136058
1081 Ga0207696_1002314
1082 Ga0207655_1008069
1083 Ga0207682_10081227
1084 Ga0207645_10030133
1085 Ga0207657_10333452
1086 Ga0207649_10000335
1087 Ga0207681_10011235
1088 Ga0207681_10263225
1089 Ga0207694_10664360
1090 Ga0207650_10291841
1091 Ga0207690_10000176
1092 Ga0207706_10005101
1093 Ga0207706_10474020
1094 Ga0207686_10011578
1095 Ga0207686_10470623
1096 Ga0207709_10000331
1097 Ga0207709_10000728
1098 Ga0207709_10007073
1099 Ga0207669_10317294
1100 Ga0207669_10587753
1101 Ga0207691_10050413
1102 Ga0207691_10225673
1103 Ga0207689_10317804
1104 Ga0207679_10000168
1105 Ga0207679_10698259
1106 Ga0207667_10210076
1107 Ga0207667_10474508
1108 Ga0207651_10144391
1109 Ga0207651_10160010
1110 Ga0207651_10332355
1111 Ga0207668_10302357
1112 Ga0207658_10054381
1113 Ga0207677_10112838
1114 Ga0207677_10445882
1115 Ga0207639_10114287
1116 Ga0207639_10141709
1117 Ga0207639_10164284
1118 Ga0207648_10065975
1119 Ga0207676_11259737
1120 Ga0207674_10133308
1121 Ga0207683_10061823
1122 Ga0207683_10111598
1123 Ga0207683_10372091
1124 Ga0207698_10029695
1125 Ga0207698_10173197
1126 Ga0209281_1000007
1127 Ga0209281_1001190
1128 Ga0209970_1000068
1129 Ga0209282_1000501
1130 Ga0209971_1002743
1131 Ga0209998_10012096
1132 Ga0209974_10025576
1133 Ga0207428_10472031
1134 Ga0268266_10017420
1135 Ga0268265_10024287
1136 Ga0268265_10045754
1137 Ga0307515_10000040
1138 Ga0307515_10000257
1139 Ga0307515_10235199
1140 Ga0307512_10122949
1141 Ga0316176_1014050
1142 Ga0314311_1003705
1143 Ga0316178_1010462
1144 Ga0316183_1067419
1145 Ga0316181_1007566
1146 Ga0316182_1188730
1147 Ga0265330_10000046
1148 Ga0265332_10000005
1149 Ga0265332_10000028
1150 Ga0265320_10079453
1151 Ga0265325_10001397
1152 Ga0265340_10037610
1153 Ga0265327_10000235
1154 Ga0265327_10001208
1155 Ga0265327_10037618
1156 Ga0265316_10000332
1157 Ga0307513_10000113
1158 Ga0307513_10004582
1159 Ga0307513_10011506
1160 Ga0307513_10361629
1161 Ga0307408_100000101
1162 Ga0307408_100013522
1163 Ga0307408_100102668
1164 Ga0307408_100167065
1165 Ga0307408_100650033
1166 Ga0307514_10000928
1167 Ga0307514_10133587
1168 Ga0265314_10000054
1169 Ga0307516_10058267
1170 Ga0307516_10063255
1171 Ga0307405_10008898
1172 Ga0307405_10080257
1173 Ga0307413_10287365
1174 Ga0307410_10185345
1175 Ga0307406_10000497
1176 Ga0307406_10031294
1177 Ga0307407_10210180
1178 Ga0307412_10008057
1179 Ga0307412_10052422
1180 Ga0307412_10237912
1181 Ga0307412_10260067
1182 Ga0307412_10293715
1183 Ga0307412_10465026
1184 Ga0307412_10640307
1185 Ga0307409_100738712
1186 Ga0307416_100106996
1187 Ga0307416_100126451
1188 Ga0307416_100216767
1189 Ga0307416_100334462
1190 Ga0307414_10290726
1191 Ga0307411_10053721
1192 Ga0307411_10062461
1193 Ga0307411_11033111
1194 Ga0307415_100239472
1195 Ga0395899_0006932
1196 Ga0395900_0032376
1197 Ga0395900_0036214
1198 Ga0395898_0023156
1199 Ga0395898_0035122
1200 Ga0395905_0000212
1201 Ga0395905_0000607
1202 Ga0395905_0004023
1203 Ga0395905_0099475
1204 Ga0395905_0134600
1205 Ga0395905_0392916
1206 Ga0395905_0493229
1207 Ga0395905_0665289
1208 Ga0395901_0133122
1209 Ga0395901_0141343
1210 Ga0395901_0161929
1211 Ga0436361_0247854
1212 Ga0439436_0000562
1213 Ga0439436_0002238
1214 Ga0439436_0022773
1215 Ga0439438_022578
1216 Ga0439439_0008098
1217 Ga0439439_0019130
1218 Ga0439466_0010304
1219 Ga0439466_0014211
1220 Ga0439466_0022944
1221 Ga0439465_0000277
1222 Ga0439465_0122542
1223 Ga0451791_1838390
1224 Ga0451793_1782101
1225 Ga0451795_0347533
1226 Ga0451795_0584715
1227 Ga0451802_0579892
1228 Ga0451807_0649746
1229 Ga0451807_0729911
1230 Ga0451807_2730351
1231 Ga0451853_1882879
1232 Ga0439433_0001048
1233 Ga0439437_008399
1234 Ga0439437_011307
1235 Ga0439441_039044
1236 Ga0439442_007320
1237 Ga0439445_0000763
1238 Ga0439445_0020134
1239 Ga0439445_0109876
1240 Ga0439432_001936
1241 Ga0439432_003064
1242 Ga0439432_039445
1243 Ga0439449_0000120
1244 Ga0439449_0000453
1245 Ga0439449_0002248
1246 Ga0439449_0080899
1247 Ga0439452_002310
1248 Ga0439452_011741
1249 Ga0439462_0004564
1250 Ga0439462_0008753
1251 Ga0439462_0010910
1252 Ga0439462_0079854
1253 Ga0439462_0092446
1254 Ga0439463_097418
1255 Ga0450911_000351
1256 Ga0450919_001118
1257 Ga0450923_007069
1258 Ga0450923_025754
1259 Ga0450888_006212
1260 Ga0450890_006779
1261 Ga0450890_009757
1262 Ga0450894_010502
1263 Ga0450896_002703
1264 Ga0450898_004060
1265 Ga0450898_004975
1266 Ga0450898_008896
1267 Ga0450899_009056
1268 Ga0450906_000192
1269 Ga0450906_016518
1270 Ga0450910_001673
1271 Ga0450908_000821
1272 Ga0450908_002821
1273 Ga0439434_0000289
1274 Ga0439434_0028083
1275 Ga0439434_0120115
1276 Ga0439464_0054046
1277 Ga0450918_000077
1278 Ga0450918_000437
1279 Ga0451577_0679486
1280 Ga0466969_0017993
1281 Ga0466969_0049594
1282 Ga0466972_0059783
1283 Ga0453683_0001887
1284 Ga0453683_0003653
1285 Ga0466965_0007028
1286 Ga0466966_0018603
1287 Ga0466961_0014170
1288 Ga0466961_0076262
1289 Ga0453684_0018472
1290 Ga0453684_0713528
1291 Ga0466971_0346123
1292 Ga0466970_0201719
1293 Ga0466957_0151992
1294 Ga0466957_0257573
1295 Ga0466957_0262072
1296 Ga0466960_0469123
1297 Ga0466959_0088349
1298 Ga0451576_0026738
1299 Ga0451576_0120857
1300 Ga0466967_0495772
1301 Ga0495627_016376
1302 Ga0495627_017833
1303 Ga0495629_0146988
1304 Ga0495638_0075820
1305 Ga0495639_0016063
1306 Ga0495616_0023910
1307 Ga0495620_0019241
1308 Ga0495631_0000927
1309 Ga0495632_0005292
1310 Ga0495637_0001152
1311 Ga0495637_0061649
1312 Ga0495643_0145643
1313 Ga0495642_0002659
1314 Ga0495642_0260407
1315 Ga0495654_0001504
1316 Ga0495654_0044568
1317 Ga0495654_0096826
1318 Ga0495621_0031312
1319 Ga0495622_0033391
1320 Ga0495633_0001809
1321 Ga0495633_0156063
1322 Ga0495656_0002859
1323 Ga0495625_0000045
1324 Ga0495625_0041165
1325 Ga0495635_0132374
1326 Ga0495661_0087152
1327 Ga0495588_0009189
1328 Ga0495658_0012053
1329 Ga0495669_0111828
1330 Ga0495670_0048023
1331 Ga0495671_0010658
1332 Ga0495660_0326335
1333 Ga0495674_0086548
1334 Ga0495676_0013815
1335 Ga0495677_0057140
1336 Ga0495677_0065683
1337 Ga0495685_031458
1338 Ga0495685_116524
1339 Ga0495593_0012980
1340 Ga0495614_0049081
1341 Ga0495615_0007612
1342 Ga0495615_0018928
1343 Ga0495615_0086480
1344 Ga0496100_0038094
1345 Ga0496101_0024578
1346 Ga0496102_0048128
1347 Ga0496103_0039550
1348 Ga0496104_0100676
1349 Ga0496105_0047749
1350 Ga0496106_0049724
1351 Ga0496106_0248819
1352 Ga0496107_0012575
1353 Ga0496110_0132482
1354 Ga0496110_0451658
1355 Ga0496111_0046348
1356 Ga0496114_0046024
1357 Ga0496116_0043465
1358 Ga0496116_0101509
1359 Ga0496117_0014880
1360 Ga0496117_0093107
1361 Ga0496117_0100631
1362 Ga0496117_0130005
1363 Ga0496118_0015707
1364 Ga0496118_0019070
1365 Ga0496118_0409245
1366 Ga0496121_0049634
1367 Ga0496121_0056714
1368 Ga0496121_0143935
1369 Ga0496122_0000331
1370 Ga0496122_0088660
1371 Ga0496122_0093309
1372 Ga0496122_0162766
1373 Ga0496122_0355111
1374 Ga0496123_0001132
1375 Ga0496123_0036698
1376 Ga0496123_0132987
1377 Ga0496123_0137343
1378 Ga0496124_0053987
1379 Ga0496124_0089765
1380 Ga0496124_0315773
1381 Ga0496124_0323394
1382 Ga0496124_0458238
1383 Ga0496125_0001189
1384 Ga0496125_0024091
1385 Ga0496125_0046129
1386 Ga0496125_0085887
1387 Ga0496125_0214612
1388 Ga0496125_0292292
1389 Ga0496126_0001477
1390 Ga0496126_0057238
1391 Ga0496126_0443543
1392 Ga0496126_0940626
1393 Ga0501034_0622574
1394 Ga0501036_0218417
1395 Ga0501047_0057504
1396 Ga0501249_002182
1397 Ga0501225_0092914
1398 Ga0501262_000434
1399 Ga0501266_034053
1400 nmdc:mga03683_103713_c1
1401 nmdc:mga03683_151260_c1
1402 nmdc:mga03683_15696_c1
1403 nmdc:mga03683_183083_c1
1404 nmdc:mga03683_235671_c1
1405 nmdc:mga03683_52700_c1
1406 nmdc:mga03683_7472_c1
1407 nmdc:mga03n38_19715_c1
1408 nmdc:mga03n38_20085_c1
1409 nmdc:mga03n38_98848_c1
1410 nmdc:mga00v17_31009_c1
1411 nmdc:mga00v17_51844_c1
1412 nmdc:mga0yw44_38982_c1
1413 nmdc:mga0yw44_43614_c1
1414 nmdc:mga0k408_17127_c1
1415 nmdc:mga0k408_197950_c1
1416 nmdc:mga0k408_203247_c1
1417 nmdc:mga0k408_40803_c1
1418 nmdc:mga0k408_43251_c2
1419 nmdc:mga0k408_506192_c1
1420 nmdc:mga0k408_52414_c1
1421 nmdc:mga0k408_59892_c1
1422 nmdc:mga07m45_158071_c1
1423 nmdc:mga07m45_161406_c1
1424 nmdc:mga07m45_21021_c1
1425 nmdc:mga07m45_30257_c1
1426 nmdc:mga07m45_53694_c1
1427 nmdc:mga07m45_59868_c1
1428 nmdc:mga09592_20553_c1
1429 nmdc:mga0qj67_153805_c1
1430 nmdc:mga0sz30_39319_c1
1431 Ga0500610_0001980
1432 Ga0500610_0006936
1433 Ga0500578_0000025
1434 Ga0500646_0019599
1435 Ga0500651_0000112
1436 Ga0500651_0013143
1437 Ga0500651_0062947
1438 Ga0500566_0186619
1439 Ga0500641_0087128
1440 Ga0500569_071464
1441 Ga0500571_027167
1442 Ga0500572_098750
1443 Ga0500593_003265
1444 Ga0500593_006316
1445 Ga0500626_063714
1446 Ga0500628_061466
1447 Ga0500628_125924
1448 Ga0500652_000177
1449 Ga0500655_000471
1450 Ga0500658_0001561
1451 Ga0500658_0001686
1452 Ga0500559_0012676
1453 Ga0500559_0105712
1454 Ga0500568_0002695
1455 Ga0500568_0153622
1456 Ga0500622_0000087
1457 Ga0500622_0067097
1458 Ga0500634_0055091
1459 Ga0500638_000683
1460 Ga0500625_081534
1461 Ga0500645_000661
1462 Ga0500645_031433
1463 Ga0500661_001056
1464 Ga0590075_014569
1465 2511242748
1466 2513229625
1467 2548498969
1468 2587725541
1469 2599627984
1470 2599677795
1471 2599685613
1472 2599697466
1473 2643867813
1474 2643970056
1475 2643991677
1476 2644071330
1477 2644142970
1478 2644161763
1479 2644271970
1480 2644325770
1481 2644338569
1482 2644399692
1483 2644465196
1484 2644648428
1485 2722882029
1486 2738723983
1487 2738880601
1488 2739246482
1489 2739247884
1490 2739284668
1491 2816476336
1492 2819602816
1493 2831268109
1494 2838059151
1495 2839142538
1496 2842679734
1497 2842718774
1498 2842752553
1499 2881102648
1500 2885193036
1501 2885203114
1502 2885216489
1503 2899928048
1504 2904452536
1505 2904460865
1506 2904545250
1507 2919463834
1508 2928041052
1509 2928047894
1510 2928055789
1511 2928066737
1512 2928075253
1513 2928088586
1514 2928117299
1515 2929165442
1516 2929522831
1517 2932426391
1518 2939632132
1519 2945909915
1520 2945945956
1521 2945988124
1522 2954768981
1523 2974320342
1524 2990713877

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01195

Pept_tRNA_hydro

Peptidyl-tRNA hydrolase

17

200

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qd3-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from pseudomonas aeruginosa with 5-azacytidine at 1.89 angstrom resolution 0.9832 2 189
8axp-assembly1.cif.gz_B neisseria gonorrhoeae peptidyl-trna hydrolase complexed with an xchem hit. 0.9801 2 188
4fyj-assembly1.cif.gz_A crystal structure of p. aeruginosa peptidyl-trna hydrolase 0.9774 2 190
4p7b-assembly2.cif.gz_C crystal structure of s. typhimurium peptidyl-trna hydrolase 0.9705 1 187
6ix6-assembly1.cif.gz_A crystal structure of the complex of peptidyl-trna hydrolase with n-propanol at 1.43 a resolution 0.9701 2 192
ID Description Score Start End Superfamily
5ektA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9583 2 187 3.40.50.1470
4q55B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9448 1 188 3.40.50.1470
3neaA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9355 2 185 3.40.50.1470
4q55B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9353 1 188 3.40.50.1470
af_Q54V95_265_452_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9294 60 188 3.40.50.1470
ID Description Score Start End GO Terms
AF-A0A433SDN1-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9924 1 192 GO:0004045
GO:0005737
GO:0006412
AF-A0A1D2U791-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9924 1 190 GO:0004045
GO:0005737
GO:0006412
AF-A0A357JRN5-F1-model_v4 deleted 0.9863 2 169
AF-A0A1D2U791-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9821 1 190 GO:0004045
GO:0005737
GO:0006412
AF-A0A533ZYX7-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9809 2 187 GO:0004045
GO:0005737
GO:0006412

Map