F479672
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 763 | 209 | 763 | 257 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10035738|Ga0070658_100357382 |
| Length | 265 |
| Sequence | MRLIDSHCHLNYEGLAERQGEVLDNARSRGVEGFLNISTRQREWRDVVSVAERNADVWATVGVHPHEADSHPDLGASALIEAADHPRVIAIGECGLDYYYDKSDRNAQRERFQAHIEAARQTGLPLVVHTRDAEDDTAEILTEAVREGGVTGVLHCFTGSAELARKGLDLGFYVSLSGIVTFKNAQDLQATAKWLPADQMLVETDSPFLAPVPHRGQKCEPAFVADTAAFVAELRGEDSAALGEQTTANFFRLFNKAKPGSALEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 95 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 152 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 153 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 155 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 156 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 157 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 158 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 160 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 161 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 162 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 163 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 164 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 165 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 166 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 168 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 169 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 170 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 171 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 172 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 173 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 174 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 175 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 176 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 177 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 178 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 179 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 180 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 181 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 182 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 183 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 184 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 185 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 186 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 191 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 192 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 193 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 194 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 197 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 198 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 199 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 200 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 201 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 202 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 203 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 205 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 206 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.87 |
| Metatranscriptomes | 0.13 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.19 |
| Rhizosphere | 95.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1010039 | 3300001904 | Bacteria | 1552 |
| 2 | JGI24752J21851_1001448 | 3300001976 | Bacteria | 3194 |
| 3 | JGI24740J21852_10026698 | 3300001979 | Bacteria | 1931 |
| 4 | JGI24740J21852_10072747 | 3300001979 | Bacteria | 917 |
| 5 | JGI24739J22299_10020884 | 3300001989 | Bacteria | 2337 |
| 6 | JGI24737J22298_10004542 | 3300001990 | Bacteria | 4828 |
| 7 | JGI24737J22298_10029935 | 3300001990 | Bacteria | 1706 |
| 8 | JGI24735J21928_10002442 | 3300002067 | Bacteria | 6453 |
| 9 | JGI24735J21928_10015099 | 3300002067 | Bacteria | 2413 |
| 10 | JGI24748J21848_1005549 | 3300002074 | Bacteria | 1465 |
| 11 | JGI24738J21930_10000519 | 3300002075 | Bacteria | 10982 |
| 12 | JGI24738J21930_10001338 | 3300002075 | Bacteria | 6851 |
| 13 | Ga0065715_10216415 | 3300005293 | Bacteria | 1274 |
| 14 | Ga0065715_10299105 | 3300005293 | Bacteria | 1045 |
| 15 | Ga0070658_10000210 | 3300005327 | Bacteria | 51793 |
| 16 | Ga0070658_10002051 | 3300005327 | Bacteria | 16895 |
| 17 | Ga0070658_10027021 | 3300005327 | Bacteria | 4608 |
| 18 | Ga0070658_10032286 | 3300005327 | Bacteria | 4209 |
| 19 | Ga0070658_10035738 | 3300005327 | Bacteria | 4003 |
| 20 | Ga0070658_10053738 | 3300005327 | Bacteria | 3270 |
| 21 | Ga0070658_10103714 | 3300005327 | Bacteria | 2352 |
| 22 | Ga0070658_10135207 | 3300005327 | Bacteria | 2056 |
| 23 | Ga0070658_10696483 | 3300005327 | Bacteria | 882 |
| 24 | Ga0070676_10033711 | 3300005328 | Bacteria | 2938 |
| 25 | Ga0070676_10315834 | 3300005328 | Bacteria | 1064 |
| 26 | Ga0070683_100011635 | 3300005329 | Bacteria | 7616 |
| 27 | Ga0070683_100014420 | 3300005329 | Bacteria | 6913 |
| 28 | Ga0070683_100072189 | 3300005329 | Bacteria | 3221 |
| 29 | Ga0070683_100255352 | 3300005329 | Bacteria | 1667 |
| 30 | Ga0070690_100055977 | 3300005330 | Bacteria | 2527 |
| 31 | Ga0070670_100048761 | 3300005331 | Bacteria | 3644 |
| 32 | Ga0070670_100066971 | 3300005331 | Bacteria | 3082 |
| 33 | Ga0070670_100144718 | 3300005331 | Bacteria | 2056 |
| 34 | Ga0068869_100035811 | 3300005334 | Bacteria | 3520 |
| 35 | Ga0068869_100195737 | 3300005334 | Bacteria | 1592 |
| 36 | Ga0070666_10003943 | 3300005335 | Bacteria | 9013 |
| 37 | Ga0070666_10007639 | 3300005335 | Bacteria | 6674 |
| 38 | Ga0070666_10014857 | 3300005335 | Bacteria | 4961 |
| 39 | Ga0070680_100004678 | 3300005336 | Bacteria | 10294 |
| 40 | Ga0070680_100022929 | 3300005336 | Bacteria | 4975 |
| 41 | Ga0070680_100231716 | 3300005336 | Bacteria | 1560 |
| 42 | Ga0070680_100240100 | 3300005336 | Bacteria | 1531 |
| 43 | Ga0068868_100073687 | 3300005338 | Bacteria | 2726 |
| 44 | Ga0068868_100234829 | 3300005338 | Bacteria | 1539 |
| 45 | Ga0068868_100699824 | 3300005338 | Bacteria | 906 |
| 46 | Ga0070660_100000033 | 3300005339 | Bacteria | 83079 |
| 47 | Ga0070660_100001411 | 3300005339 | Bacteria | 16351 |
| 48 | Ga0070660_100004042 | 3300005339 | Bacteria | 10126 |
| 49 | Ga0070660_100005709 | 3300005339 | Bacteria | 8618 |
| 50 | Ga0070660_100006275 | 3300005339 | Bacteria | 8236 |
| 51 | Ga0070660_100015215 | 3300005339 | Bacteria | 5551 |
| 52 | Ga0070660_100217206 | 3300005339 | Bacteria | 1553 |
| 53 | Ga0070661_100001507 | 3300005344 | Bacteria | 16195 |
| 54 | Ga0070661_100255379 | 3300005344 | Bacteria | 1354 |
| 55 | Ga0070661_100270269 | 3300005344 | Bacteria | 1316 |
| 56 | Ga0070692_10009692 | 3300005345 | Bacteria | 4355 |
| 57 | Ga0070692_10032234 | 3300005345 | Bacteria | 2633 |
| 58 | Ga0070692_10071044 | 3300005345 | Bacteria | 1854 |
| 59 | Ga0070692_10083830 | 3300005345 | Bacteria | 1722 |
| 60 | Ga0070668_100056138 | 3300005347 | Bacteria | 3041 |
| 61 | Ga0070668_100071060 | 3300005347 | Bacteria | 2711 |
| 62 | Ga0070668_100078788 | 3300005347 | Bacteria | 2578 |
| 63 | Ga0070668_100160041 | 3300005347 | Bacteria | 1826 |
| 64 | Ga0070668_100654799 | 3300005347 | Bacteria | 923 |
| 65 | Ga0070669_100000384 | 3300005353 | Bacteria | 33927 |
| 66 | Ga0070669_100031751 | 3300005353 | Bacteria | 3814 |
| 67 | Ga0070669_100057236 | 3300005353 | Bacteria | 2860 |
| 68 | Ga0070669_100057967 | 3300005353 | Bacteria | 2842 |
| 69 | Ga0070669_100125162 | 3300005353 | Bacteria | 1966 |
| 70 | Ga0070669_100167808 | 3300005353 | Bacteria | 1710 |
| 71 | Ga0070669_100296729 | 3300005353 | Bacteria | 1299 |
| 72 | Ga0070675_100087663 | 3300005354 | Bacteria | 2603 |
| 73 | Ga0070675_100119331 | 3300005354 | Bacteria | 2240 |
| 74 | Ga0070675_100279937 | 3300005354 | Bacteria | 1465 |
| 75 | Ga0070671_100005846 | 3300005355 | Bacteria | 9800 |
| 76 | Ga0070671_100013189 | 3300005355 | Bacteria | 6657 |
| 77 | Ga0070671_100020564 | 3300005355 | Bacteria | 5384 |
| 78 | Ga0070671_100082566 | 3300005355 | Bacteria | 2687 |
| 79 | Ga0070674_100011935 | 3300005356 | Bacteria | 5313 |
| 80 | Ga0070674_100059687 | 3300005356 | Bacteria | 2656 |
| 81 | Ga0070674_100076527 | 3300005356 | Bacteria | 2379 |
| 82 | Ga0070673_100000180 | 3300005364 | Bacteria | 30888 |
| 83 | Ga0070673_100001134 | 3300005364 | Bacteria | 15327 |
| 84 | Ga0070673_100001423 | 3300005364 | Bacteria | 13976 |
| 85 | Ga0070673_100096168 | 3300005364 | Bacteria | 2430 |
| 86 | Ga0070673_100296477 | 3300005364 | Bacteria | 1422 |
| 87 | Ga0070659_100000688 | 3300005366 | Bacteria | 24629 |
| 88 | Ga0070659_100001983 | 3300005366 | Bacteria | 14621 |
| 89 | Ga0070659_100002226 | 3300005366 | Bacteria | 13779 |
| 90 | Ga0070659_100011081 | 3300005366 | Bacteria | 6661 |
| 91 | Ga0070659_100018486 | 3300005366 | Bacteria | 5259 |
| 92 | Ga0070659_100028355 | 3300005366 | Bacteria | 4322 |
| 93 | Ga0070659_100069967 | 3300005366 | Bacteria | 2786 |
| 94 | Ga0070659_100122620 | 3300005366 | Bacteria | 2106 |
| 95 | Ga0070659_100123612 | 3300005366 | Bacteria | 2098 |
| 96 | Ga0070659_100125179 | 3300005366 | Bacteria | 2085 |
| 97 | Ga0070659_100534123 | 3300005366 | Bacteria | 1003 |
| 98 | Ga0070667_100001415 | 3300005367 | Bacteria | 21477 |
| 99 | Ga0070667_100018647 | 3300005367 | Bacteria | 5755 |
| 100 | Ga0070667_100020557 | 3300005367 | Bacteria | 5481 |
| 101 | Ga0070667_100063857 | 3300005367 | Bacteria | 3122 |
| 102 | Ga0070667_100076610 | 3300005367 | Bacteria | 2856 |
| 103 | Ga0070667_100210961 | 3300005367 | Bacteria | 1726 |
| 104 | Ga0070667_100288268 | 3300005367 | Bacteria | 1476 |
| 105 | Ga0070714_100150950 | 3300005435 | Bacteria | 2094 |
| 106 | Ga0070713_100006979 | 3300005436 | Bacteria | 7886 |
| 107 | Ga0070663_100001870 | 3300005455 | Bacteria | 11747 |
| 108 | Ga0070663_100011800 | 3300005455 | Bacteria | 5502 |
| 109 | Ga0070663_100055625 | 3300005455 | Bacteria | 2833 |
| 110 | Ga0070663_100140485 | 3300005455 | Bacteria | 1843 |
| 111 | Ga0070663_100189537 | 3300005455 | Bacteria | 1600 |
| 112 | Ga0070678_100001830 | 3300005456 | Bacteria | 11471 |
| 113 | Ga0070678_100083138 | 3300005456 | Bacteria | 2433 |
| 114 | Ga0070678_100271214 | 3300005456 | Bacteria | 1431 |
| 115 | Ga0070678_100432991 | 3300005456 | Bacteria | 1149 |
| 116 | Ga0070662_100000022 | 3300005457 | Bacteria | 92004 |
| 117 | Ga0070662_100000994 | 3300005457 | Bacteria | 17351 |
| 118 | Ga0070662_100008505 | 3300005457 | Bacteria | 6695 |
| 119 | Ga0070662_100021691 | 3300005457 | Bacteria | 4389 |
| 120 | Ga0070662_100024525 | 3300005457 | Bacteria | 4156 |
| 121 | Ga0070662_100039594 | 3300005457 | Bacteria | 3352 |
| 122 | Ga0070662_100087128 | 3300005457 | Bacteria | 2337 |
| 123 | Ga0070662_100104064 | 3300005457 | Bacteria | 2153 |
| 124 | Ga0070662_100144560 | 3300005457 | Bacteria | 1846 |
| 125 | Ga0070662_100234228 | 3300005457 | Bacteria | 1470 |
| 126 | Ga0070662_100249869 | 3300005457 | Bacteria | 1425 |
| 127 | Ga0070662_100421755 | 3300005457 | Bacteria | 1104 |
| 128 | Ga0070681_10012722 | 3300005458 | Bacteria | 8353 |
| 129 | Ga0070681_10020058 | 3300005458 | Bacteria | 6697 |
| 130 | Ga0070681_10118182 | 3300005458 | Bacteria | 2588 |
| 131 | Ga0070681_10291326 | 3300005458 | Bacteria | 1542 |
| 132 | Ga0070681_10577588 | 3300005458 | Bacteria | 1038 |
| 133 | Ga0068867_100001815 | 3300005459 | Bacteria | 14879 |
| 134 | Ga0068867_100127570 | 3300005459 | Bacteria | 1973 |
| 135 | Ga0068867_100499597 | 3300005459 | Bacteria | 1045 |
| 136 | Ga0070679_100104841 | 3300005530 | Bacteria | 2813 |
| 137 | Ga0070679_100143075 | 3300005530 | Bacteria | 2370 |
| 138 | Ga0070679_100497261 | 3300005530 | Bacteria | 1163 |
| 139 | Ga0070684_100023033 | 3300005535 | Bacteria | 5202 |
| 140 | Ga0070684_100104388 | 3300005535 | Bacteria | 2535 |
| 141 | Ga0070684_100137352 | 3300005535 | Bacteria | 2209 |
| 142 | Ga0068853_100000591 | 3300005539 | Bacteria | 24849 |
| 143 | Ga0068853_100000664 | 3300005539 | Bacteria | 23670 |
| 144 | Ga0068853_100023270 | 3300005539 | Bacteria | 5183 |
| 145 | Ga0068853_100063702 | 3300005539 | Bacteria | 3193 |
| 146 | Ga0068853_100069569 | 3300005539 | Bacteria | 3062 |
| 147 | Ga0068853_100243764 | 3300005539 | Bacteria | 1648 |
| 148 | Ga0070672_100012585 | 3300005543 | Bacteria | 5947 |
| 149 | Ga0070672_100014102 | 3300005543 | Bacteria | 5656 |
| 150 | Ga0070672_100058072 | 3300005543 | Bacteria | 3039 |
| 151 | Ga0070672_100071600 | 3300005543 | Bacteria | 2758 |
| 152 | Ga0070672_100074192 | 3300005543 | Bacteria | 2713 |
| 153 | Ga0070672_100160844 | 3300005543 | Bacteria | 1863 |
| 154 | Ga0070693_100013537 | 3300005547 | Bacteria | 4158 |
| 155 | Ga0070665_100003092 | 3300005548 | Bacteria | 17918 |
| 156 | Ga0070665_100003345 | 3300005548 | Bacteria | 17168 |
| 157 | Ga0070665_100022398 | 3300005548 | Bacteria | 6357 |
| 158 | Ga0070665_100025282 | 3300005548 | Bacteria | 5982 |
| 159 | Ga0070665_100212622 | 3300005548 | Bacteria | 1935 |
| 160 | Ga0070665_100334485 | 3300005548 | Bacteria | 1519 |
| 161 | Ga0068855_100001504 | 3300005563 | Bacteria | 29210 |
| 162 | Ga0068855_100008834 | 3300005563 | Bacteria | 12177 |
| 163 | Ga0068855_100165343 | 3300005563 | Bacteria | 2509 |
| 164 | Ga0068855_100183695 | 3300005563 | Bacteria | 2363 |
| 165 | Ga0068855_100734265 | 3300005563 | Bacteria | 1054 |
| 166 | Ga0070664_100002414 | 3300005564 | Bacteria | 15014 |
| 167 | Ga0070664_100006323 | 3300005564 | Bacteria | 9557 |
| 168 | Ga0070664_100053717 | 3300005564 | Bacteria | 3416 |
| 169 | Ga0070664_100064561 | 3300005564 | Bacteria | 3123 |
| 170 | Ga0070664_100126696 | 3300005564 | Bacteria | 2241 |
| 171 | Ga0070664_100477409 | 3300005564 | Bacteria | 1147 |
| 172 | Ga0068857_100009165 | 3300005577 | Bacteria | 8589 |
| 173 | Ga0068857_100053172 | 3300005577 | Bacteria | 3593 |
| 174 | Ga0068857_100134817 | 3300005577 | Bacteria | 2229 |
| 175 | Ga0068854_100012325 | 3300005578 | Bacteria | 5595 |
| 176 | Ga0068854_100115954 | 3300005578 | Bacteria | 2027 |
| 177 | Ga0068854_100171967 | 3300005578 | Bacteria | 1686 |
| 178 | Ga0068854_100172126 | 3300005578 | Bacteria | 1686 |
| 179 | Ga0068856_100000081 | 3300005614 | Bacteria | 88388 |
| 180 | Ga0068856_100042235 | 3300005614 | Bacteria | 4485 |
| 181 | Ga0068856_100066903 | 3300005614 | Bacteria | 3551 |
| 182 | Ga0068856_100073561 | 3300005614 | Bacteria | 3384 |
| 183 | Ga0068856_100169573 | 3300005614 | Bacteria | 2194 |
| 184 | Ga0068856_100249380 | 3300005614 | Bacteria | 1790 |
| 185 | Ga0068852_100002794 | 3300005616 | Bacteria | 12096 |
| 186 | Ga0068852_100004132 | 3300005616 | Bacteria | 10221 |
| 187 | Ga0068852_100004538 | 3300005616 | Bacteria | 9824 |
| 188 | Ga0068852_100007865 | 3300005616 | Bacteria | 7807 |
| 189 | Ga0068852_100017147 | 3300005616 | Bacteria | 5675 |
| 190 | Ga0068852_100019552 | 3300005616 | Bacteria | 5363 |
| 191 | Ga0068852_100067434 | 3300005616 | Bacteria | 3128 |
| 192 | Ga0068852_100080029 | 3300005616 | Bacteria | 2896 |
| 193 | Ga0068859_100002250 | 3300005617 | Bacteria | 19574 |
| 194 | Ga0068859_100006621 | 3300005617 | Bacteria | 11765 |
| 195 | Ga0068859_100057530 | 3300005617 | Bacteria | 3916 |
| 196 | Ga0068859_100144035 | 3300005617 | Bacteria | 2457 |
| 197 | Ga0068859_100528037 | 3300005617 | Bacteria | 1275 |
| 198 | Ga0068864_100000399 | 3300005618 | Bacteria | 37643 |
| 199 | Ga0068864_100001958 | 3300005618 | Bacteria | 16928 |
| 200 | Ga0068864_100042444 | 3300005618 | Bacteria | 3892 |
| 201 | Ga0068864_100048016 | 3300005618 | Bacteria | 3669 |
| 202 | Ga0068864_100108696 | 3300005618 | Bacteria | 2468 |
| 203 | Ga0068866_10054091 | 3300005718 | Bacteria | 2055 |
| 204 | Ga0068851_10138216 | 3300005834 | Bacteria | 1323 |
| 205 | Ga0068870_10055435 | 3300005840 | Bacteria | 2112 |
| 206 | Ga0068863_100001885 | 3300005841 | Bacteria | 20821 |
| 207 | Ga0068863_100002337 | 3300005841 | Bacteria | 18844 |
| 208 | Ga0068863_100005049 | 3300005841 | Bacteria | 13013 |
| 209 | Ga0068863_100084392 | 3300005841 | Bacteria | 3010 |
| 210 | Ga0068863_100233684 | 3300005841 | Bacteria | 1774 |
| 211 | Ga0068858_100000377 | 3300005842 | Bacteria | 46611 |
| 212 | Ga0068858_100002864 | 3300005842 | Bacteria | 17346 |
| 213 | Ga0068858_100031323 | 3300005842 | Bacteria | 4939 |
| 214 | Ga0068858_100208895 | 3300005842 | Bacteria | 1847 |
| 215 | Ga0068858_100276445 | 3300005842 | Bacteria | 1599 |
| 216 | Ga0068860_100001953 | 3300005843 | Bacteria | 21801 |
| 217 | Ga0068860_100024432 | 3300005843 | Bacteria | 5839 |
| 218 | Ga0068860_100112596 | 3300005843 | Bacteria | 2602 |
| 219 | Ga0068860_100130569 | 3300005843 | Bacteria | 2410 |
| 220 | Ga0068860_100183469 | 3300005843 | Bacteria | 2023 |
| 221 | Ga0068860_100324388 | 3300005843 | Bacteria | 1512 |
| 222 | Ga0068862_100018887 | 3300005844 | Bacteria | 5744 |
| 223 | Ga0068862_100089431 | 3300005844 | Bacteria | 2680 |
| 224 | Ga0081539_10025870 | 3300005985 | Bacteria | 3761 |
| 225 | Ga0081539_10028220 | 3300005985 | Bacteria | 3533 |
| 226 | Ga0070717_10002916 | 3300006028 | Bacteria | 12148 |
| 227 | Ga0070717_10115799 | 3300006028 | Bacteria | 2291 |
| 228 | Ga0070716_100017245 | 3300006173 | Bacteria | 3740 |
| 229 | Ga0070712_100037853 | 3300006175 | Bacteria | 3292 |
| 230 | Ga0097621_100018861 | 3300006237 | Bacteria | 5282 |
| 231 | Ga0097621_100755332 | 3300006237 | Bacteria | 898 |
| 232 | Ga0068871_100003403 | 3300006358 | Bacteria | 10933 |
| 233 | Ga0068871_100085956 | 3300006358 | Bacteria | 2613 |
| 234 | Ga0068871_100139177 | 3300006358 | Bacteria | 2063 |
| 235 | Ga0068871_100665566 | 3300006358 | Bacteria | 951 |
| 236 | Ga0075428_100181532 | 3300006844 | Bacteria | 2277 |
| 237 | Ga0068865_100012956 | 3300006881 | Bacteria | 5258 |
| 238 | Ga0068865_100751559 | 3300006881 | Bacteria | 837 |
| 239 | Ga0097620_100002250 | 3300006931 | Bacteria | 19574 |
| 240 | Ga0097620_100006620 | 3300006931 | Bacteria | 11765 |
| 241 | Ga0097620_100057530 | 3300006931 | Bacteria | 3916 |
| 242 | Ga0097620_100144036 | 3300006931 | Bacteria | 2457 |
| 243 | Ga0097620_100528011 | 3300006931 | Bacteria | 1275 |
| 244 | Ga0105250_10026963 | 3300009092 | Bacteria | 2316 |
| 245 | Ga0105240_10010807 | 3300009093 | Bacteria | 12786 |
| 246 | Ga0105245_10000632 | 3300009098 | Bacteria | 32005 |
| 247 | Ga0105245_10006502 | 3300009098 | Bacteria | 10268 |
| 248 | Ga0105245_10212807 | 3300009098 | Bacteria | 1861 |
| 249 | Ga0105247_10231661 | 3300009101 | Bacteria | 1255 |
| 250 | Ga0105243_10230191 | 3300009148 | Bacteria | 1644 |
| 251 | Ga0105243_10617254 | 3300009148 | Bacteria | 1046 |
| 252 | Ga0105241_10015111 | 3300009174 | Bacteria | 5655 |
| 253 | Ga0105241_10026027 | 3300009174 | Bacteria | 4352 |
| 254 | Ga0105241_10434353 | 3300009174 | Bacteria | 1158 |
| 255 | Ga0105242_10042103 | 3300009176 | Bacteria | 3686 |
| 256 | Ga0105242_10094764 | 3300009176 | Bacteria | 2519 |
| 257 | Ga0105242_10439607 | 3300009176 | Bacteria | 1227 |
| 258 | Ga0105248_10000075 | 3300009177 | Bacteria | 114243 |
| 259 | Ga0105248_10002385 | 3300009177 | Bacteria | 20869 |
| 260 | Ga0105248_10089405 | 3300009177 | Bacteria | 3467 |
| 261 | Ga0105237_10020419 | 3300009545 | Bacteria | 6828 |
| 262 | Ga0105238_10007509 | 3300009551 | Bacteria | 10921 |
| 263 | Ga0105238_10012987 | 3300009551 | Bacteria | 8406 |
| 264 | Ga0105238_10057312 | 3300009551 | Bacteria | 3907 |
| 265 | Ga0105238_10120040 | 3300009551 | Bacteria | 2609 |
| 266 | Ga0105249_10085760 | 3300009553 | Bacteria | 2935 |
| 267 | Ga0105249_10126151 | 3300009553 | Bacteria | 2437 |
| 268 | Ga0105249_10189745 | 3300009553 | Bacteria | 2005 |
| 269 | Ga0105239_10035405 | 3300010375 | Bacteria | 5483 |
| 270 | Ga0105246_10004062 | 3300011119 | Bacteria | 8891 |
| 271 | Ga0105246_10574609 | 3300011119 | Bacteria | 970 |
| 272 | Ga0157373_10001646 | 3300013100 | Bacteria | 17058 |
| 273 | Ga0157373_10004476 | 3300013100 | Bacteria | 10519 |
| 274 | Ga0157373_10018175 | 3300013100 | Bacteria | 5120 |
| 275 | Ga0157373_10020793 | 3300013100 | Bacteria | 4765 |
| 276 | Ga0157373_10042056 | 3300013100 | Bacteria | 3267 |
| 277 | Ga0157373_10108772 | 3300013100 | Bacteria | 1949 |
| 278 | Ga0157373_10145328 | 3300013100 | Bacteria | 1668 |
| 279 | Ga0157371_10001127 | 3300013102 | Bacteria | 28864 |
| 280 | Ga0157371_10001295 | 3300013102 | Bacteria | 26323 |
| 281 | Ga0157371_10004826 | 3300013102 | Bacteria | 11596 |
| 282 | Ga0157371_10072516 | 3300013102 | Bacteria | 2438 |
| 283 | Ga0157371_10097947 | 3300013102 | Bacteria | 2079 |
| 284 | Ga0157371_10109732 | 3300013102 | Bacteria | 1958 |
| 285 | Ga0157371_10371347 | 3300013102 | Bacteria | 1043 |
| 286 | Ga0157370_10001502 | 3300013104 | Bacteria | 28833 |
| 287 | Ga0157370_10029822 | 3300013104 | Bacteria | 5348 |
| 288 | Ga0157370_10058430 | 3300013104 | Bacteria | 3666 |
| 289 | Ga0157370_10082441 | 3300013104 | Bacteria | 3025 |
| 290 | Ga0157370_10141158 | 3300013104 | Bacteria | 2244 |
| 291 | Ga0157370_10153389 | 3300013104 | Bacteria | 2143 |
| 292 | Ga0157370_10156051 | 3300013104 | Bacteria | 2123 |
| 293 | Ga0157370_10159903 | 3300013104 | Bacteria | 2096 |
| 294 | Ga0157370_10225432 | 3300013104 | Bacteria | 1735 |
| 295 | Ga0157369_10003885 | 3300013105 | Bacteria | 17727 |
| 296 | Ga0157369_10006781 | 3300013105 | Bacteria | 13211 |
| 297 | Ga0157369_10014674 | 3300013105 | Bacteria | 8841 |
| 298 | Ga0157369_10029478 | 3300013105 | Bacteria | 6063 |
| 299 | Ga0157369_10042744 | 3300013105 | Bacteria | 4943 |
| 300 | Ga0157369_10086043 | 3300013105 | Bacteria | 3358 |
| 301 | Ga0157369_10099143 | 3300013105 | Bacteria | 3106 |
| 302 | Ga0157369_10197505 | 3300013105 | Bacteria | 2112 |
| 303 | Ga0157369_10225343 | 3300013105 | Bacteria | 1961 |
| 304 | Ga0157369_10722799 | 3300013105 | Bacteria | 1025 |
| 305 | Ga0157374_10001130 | 3300013296 | Bacteria | 22903 |
| 306 | Ga0157374_10003689 | 3300013296 | Bacteria | 12872 |
| 307 | Ga0157374_10009255 | 3300013296 | Bacteria | 8445 |
| 308 | Ga0157374_10047790 | 3300013296 | Bacteria | 3969 |
| 309 | Ga0157374_10057469 | 3300013296 | Bacteria | 3634 |
| 310 | Ga0157378_10124707 | 3300013297 | Bacteria | 2378 |
| 311 | Ga0157378_10328698 | 3300013297 | Bacteria | 1487 |
| 312 | Ga0157378_10357941 | 3300013297 | Bacteria | 1428 |
| 313 | Ga0163162_10002867 | 3300013306 | Bacteria | 16409 |
| 314 | Ga0157372_10010537 | 3300013307 | Bacteria | 9835 |
| 315 | Ga0157372_10140991 | 3300013307 | Bacteria | 2777 |
| 316 | Ga0157372_10212709 | 3300013307 | Bacteria | 2241 |
| 317 | Ga0157375_10001954 | 3300013308 | Bacteria | 17763 |
| 318 | Ga0157375_10002415 | 3300013308 | Bacteria | 16179 |
| 319 | Ga0157375_10074795 | 3300013308 | Bacteria | 3410 |
| 320 | Ga0157375_10131646 | 3300013308 | Bacteria | 2621 |
| 321 | Ga0157375_10181516 | 3300013308 | Bacteria | 2256 |
| 322 | Ga0163163_10000161 | 3300014325 | Bacteria | 70120 |
| 323 | Ga0163163_10008545 | 3300014325 | Bacteria | 9102 |
| 324 | Ga0157380_10108512 | 3300014326 | Bacteria | 2327 |
| 325 | Ga0157379_10111071 | 3300014968 | Bacteria | 2462 |
| 326 | Ga0157379_10136152 | 3300014968 | Bacteria | 2213 |
| 327 | Ga0157379_10252639 | 3300014968 | Bacteria | 1601 |
| 328 | Ga0157379_10284011 | 3300014968 | Bacteria | 1506 |
| 329 | Ga0163161_10265283 | 3300017792 | Bacteria | 1342 |
| 330 | Ga0206354_10156462 | 3300020081 | Bacteria | 1364 |
| 331 | Ga0213876_10106864 | 3300021384 | Bacteria | 1485 |
| 332 | Ga0207697_10000146 | 3300025315 | Bacteria | 34541 |
| 333 | Ga0207697_10034037 | 3300025315 | Bacteria | 2086 |
| 334 | Ga0207697_10044910 | 3300025315 | Bacteria | 1818 |
| 335 | Ga0207656_10068927 | 3300025321 | Bacteria | 1568 |
| 336 | Ga0207656_10168660 | 3300025321 | Bacteria | 1045 |
| 337 | Ga0207682_10011792 | 3300025893 | Bacteria | 3414 |
| 338 | Ga0207688_10054764 | 3300025901 | Bacteria | 2238 |
| 339 | Ga0207688_10082364 | 3300025901 | Bacteria | 1839 |
| 340 | Ga0207680_10005331 | 3300025903 | Bacteria | 6138 |
| 341 | Ga0207680_10039327 | 3300025903 | Bacteria | 2744 |
| 342 | Ga0207680_10077934 | 3300025903 | Bacteria | 2074 |
| 343 | Ga0207647_10000073 | 3300025904 | Bacteria | 76404 |
| 344 | Ga0207647_10000793 | 3300025904 | Bacteria | 24512 |
| 345 | Ga0207647_10001334 | 3300025904 | Bacteria | 18961 |
| 346 | Ga0207647_10005112 | 3300025904 | Bacteria | 9659 |
| 347 | Ga0207647_10014030 | 3300025904 | Bacteria | 5543 |
| 348 | Ga0207647_10038156 | 3300025904 | Bacteria | 3039 |
| 349 | Ga0207647_10087290 | 3300025904 | Bacteria | 1863 |
| 350 | Ga0207647_10155200 | 3300025904 | Bacteria | 1337 |
| 351 | Ga0207645_10163576 | 3300025907 | Bacteria | 1456 |
| 352 | Ga0207645_10205215 | 3300025907 | Bacteria | 1297 |
| 353 | Ga0207645_10387394 | 3300025907 | Bacteria | 939 |
| 354 | Ga0207705_10000050 | 3300025909 | Bacteria | 170078 |
| 355 | Ga0207705_10000395 | 3300025909 | Bacteria | 38278 |
| 356 | Ga0207705_10002032 | 3300025909 | Bacteria | 15753 |
| 357 | Ga0207705_10004793 | 3300025909 | Bacteria | 10186 |
| 358 | Ga0207705_10021648 | 3300025909 | Bacteria | 4588 |
| 359 | Ga0207705_10023507 | 3300025909 | Bacteria | 4397 |
| 360 | Ga0207705_10032951 | 3300025909 | Bacteria | 3703 |
| 361 | Ga0207705_10045186 | 3300025909 | Bacteria | 3166 |
| 362 | Ga0207705_10054861 | 3300025909 | Bacteria | 2872 |
| 363 | Ga0207705_10060811 | 3300025909 | Bacteria | 2729 |
| 364 | Ga0207705_10113335 | 3300025909 | Bacteria | 2005 |
| 365 | Ga0207705_10328269 | 3300025909 | Bacteria | 1176 |
| 366 | Ga0207705_10470744 | 3300025909 | Bacteria | 975 |
| 367 | Ga0207705_10580165 | 3300025909 | Bacteria | 872 |
| 368 | Ga0207654_10016807 | 3300025911 | Bacteria | 3815 |
| 369 | Ga0207654_10283100 | 3300025911 | Bacteria | 1122 |
| 370 | Ga0207707_10009817 | 3300025912 | Bacteria | 8301 |
| 371 | Ga0207707_10156620 | 3300025912 | Bacteria | 1992 |
| 372 | Ga0207695_10023346 | 3300025913 | Bacteria | 6991 |
| 373 | Ga0207693_10021371 | 3300025915 | Bacteria | 5143 |
| 374 | Ga0207660_10032955 | 3300025917 | Bacteria | 3579 |
| 375 | Ga0207660_10132361 | 3300025917 | Bacteria | 1899 |
| 376 | Ga0207660_10136580 | 3300025917 | Bacteria | 1871 |
| 377 | Ga0207660_10387967 | 3300025917 | Bacteria | 1123 |
| 378 | Ga0207657_10000015 | 3300025919 | Bacteria | 175776 |
| 379 | Ga0207657_10000020 | 3300025919 | Bacteria | 157826 |
| 380 | Ga0207657_10000827 | 3300025919 | Bacteria | 32729 |
| 381 | Ga0207657_10000923 | 3300025919 | Bacteria | 31101 |
| 382 | Ga0207657_10001975 | 3300025919 | Bacteria | 22131 |
| 383 | Ga0207657_10002961 | 3300025919 | Bacteria | 18210 |
| 384 | Ga0207657_10003761 | 3300025919 | Bacteria | 16125 |
| 385 | Ga0207657_10013058 | 3300025919 | Bacteria | 8162 |
| 386 | Ga0207657_10038237 | 3300025919 | Bacteria | 4275 |
| 387 | Ga0207657_10094837 | 3300025919 | Bacteria | 2484 |
| 388 | Ga0207649_10000198 | 3300025920 | Bacteria | 49957 |
| 389 | Ga0207649_10006045 | 3300025920 | Bacteria | 6569 |
| 390 | Ga0207649_10165412 | 3300025920 | Bacteria | 1536 |
| 391 | Ga0207649_10212863 | 3300025920 | Bacteria | 1372 |
| 392 | Ga0207649_10449481 | 3300025920 | Bacteria | 972 |
| 393 | Ga0207652_10030934 | 3300025921 | Bacteria | 4489 |
| 394 | Ga0207652_10092698 | 3300025921 | Bacteria | 2657 |
| 395 | Ga0207652_10144260 | 3300025921 | Bacteria | 2130 |
| 396 | Ga0207652_10641924 | 3300025921 | Bacteria | 950 |
| 397 | Ga0207681_10019621 | 3300025923 | Bacteria | 4274 |
| 398 | Ga0207681_10120753 | 3300025923 | Bacteria | 1921 |
| 399 | Ga0207681_10121866 | 3300025923 | Bacteria | 1913 |
| 400 | Ga0207681_10350703 | 3300025923 | Bacteria | 1181 |
| 401 | Ga0207694_10001107 | 3300025924 | Bacteria | 23324 |
| 402 | Ga0207694_10033941 | 3300025924 | Bacteria | 3911 |
| 403 | Ga0207694_10066828 | 3300025924 | Bacteria | 2805 |
| 404 | Ga0207694_10518100 | 3300025924 | Bacteria | 999 |
| 405 | Ga0207650_10009139 | 3300025925 | Bacteria | 6773 |
| 406 | Ga0207650_10563787 | 3300025925 | Bacteria | 956 |
| 407 | Ga0207659_10011817 | 3300025926 | Bacteria | 5528 |
| 408 | Ga0207659_10029192 | 3300025926 | Bacteria | 3756 |
| 409 | Ga0207659_10033653 | 3300025926 | Bacteria | 3530 |
| 410 | Ga0207659_10076771 | 3300025926 | Bacteria | 2457 |
| 411 | Ga0207659_10138284 | 3300025926 | Bacteria | 1888 |
| 412 | Ga0207687_10042488 | 3300025927 | Bacteria | 3128 |
| 413 | Ga0207687_10046828 | 3300025927 | Bacteria | 2995 |
| 414 | Ga0207687_10055427 | 3300025927 | Bacteria | 2778 |
| 415 | Ga0207664_10020756 | 3300025929 | Bacteria | 4875 |
| 416 | Ga0207664_10039174 | 3300025929 | Bacteria | 3678 |
| 417 | Ga0207664_10175506 | 3300025929 | Bacteria | 1837 |
| 418 | Ga0207644_10000597 | 3300025931 | Bacteria | 23001 |
| 419 | Ga0207644_10002779 | 3300025931 | Bacteria | 11273 |
| 420 | Ga0207644_10017950 | 3300025931 | Bacteria | 4784 |
| 421 | Ga0207644_10042981 | 3300025931 | Bacteria | 3205 |
| 422 | Ga0207644_10113340 | 3300025931 | Bacteria | 2053 |
| 423 | Ga0207644_10165669 | 3300025931 | Bacteria | 1722 |
| 424 | Ga0207690_10000241 | 3300025932 | Bacteria | 39820 |
| 425 | Ga0207690_10000593 | 3300025932 | Bacteria | 23445 |
| 426 | Ga0207690_10002603 | 3300025932 | Bacteria | 10874 |
| 427 | Ga0207690_10011543 | 3300025932 | Bacteria | 5277 |
| 428 | Ga0207690_10024639 | 3300025932 | Bacteria | 3770 |
| 429 | Ga0207690_10044900 | 3300025932 | Bacteria | 2916 |
| 430 | Ga0207690_10104547 | 3300025932 | Bacteria | 2029 |
| 431 | Ga0207690_10142790 | 3300025932 | Bacteria | 1766 |
| 432 | Ga0207690_10187261 | 3300025932 | Unclassified | 1563 |
| 433 | Ga0207690_10491451 | 3300025932 | Bacteria | 992 |
| 434 | Ga0207690_10564332 | 3300025932 | Bacteria | 926 |
| 435 | Ga0207706_10000308 | 3300025933 | Bacteria | 52928 |
| 436 | Ga0207706_10000560 | 3300025933 | Bacteria | 39632 |
| 437 | Ga0207706_10000645 | 3300025933 | Bacteria | 36863 |
| 438 | Ga0207706_10000707 | 3300025933 | Bacteria | 34824 |
| 439 | Ga0207706_10010906 | 3300025933 | Bacteria | 8293 |
| 440 | Ga0207706_10013139 | 3300025933 | Bacteria | 7533 |
| 441 | Ga0207706_10018590 | 3300025933 | Bacteria | 6253 |
| 442 | Ga0207706_10027576 | 3300025933 | Bacteria | 5077 |
| 443 | Ga0207706_10068857 | 3300025933 | Bacteria | 3113 |
| 444 | Ga0207706_10072494 | 3300025933 | Bacteria | 3029 |
| 445 | Ga0207706_10115838 | 3300025933 | Bacteria | 2357 |
| 446 | Ga0207706_10143074 | 3300025933 | Bacteria | 2104 |
| 447 | Ga0207706_10143334 | 3300025933 | Bacteria | 2102 |
| 448 | Ga0207706_10560121 | 3300025933 | Bacteria | 983 |
| 449 | Ga0207686_10024214 | 3300025934 | Bacteria | 3515 |
| 450 | Ga0207686_10029420 | 3300025934 | Bacteria | 3240 |
| 451 | Ga0207686_10291985 | 3300025934 | Bacteria | 1208 |
| 452 | Ga0207670_10049689 | 3300025936 | Bacteria | 2807 |
| 453 | Ga0207670_10387583 | 3300025936 | Bacteria | 1114 |
| 454 | Ga0207669_10023211 | 3300025937 | Bacteria | 3310 |
| 455 | Ga0207669_10117746 | 3300025937 | Bacteria | 1796 |
| 456 | Ga0207669_10393513 | 3300025937 | Bacteria | 1083 |
| 457 | Ga0207704_10051890 | 3300025938 | Bacteria | 2483 |
| 458 | Ga0207704_10072850 | 3300025938 | Bacteria | 2185 |
| 459 | Ga0207665_10020709 | 3300025939 | Bacteria | 4323 |
| 460 | Ga0207691_10002641 | 3300025940 | Bacteria | 17508 |
| 461 | Ga0207691_10007120 | 3300025940 | Bacteria | 10798 |
| 462 | Ga0207691_10026778 | 3300025940 | Bacteria | 5410 |
| 463 | Ga0207691_10055642 | 3300025940 | Bacteria | 3605 |
| 464 | Ga0207691_10066906 | 3300025940 | Bacteria | 3250 |
| 465 | Ga0207691_10083249 | 3300025940 | Bacteria | 2873 |
| 466 | Ga0207691_10148009 | 3300025940 | Bacteria | 2066 |
| 467 | Ga0207691_10230859 | 3300025940 | Bacteria | 1603 |
| 468 | Ga0207711_10000281 | 3300025941 | Bacteria | 54787 |
| 469 | Ga0207711_10002308 | 3300025941 | Bacteria | 17097 |
| 470 | Ga0207711_10042683 | 3300025941 | Bacteria | 3864 |
| 471 | Ga0207711_10060865 | 3300025941 | Bacteria | 3254 |
| 472 | Ga0207711_10071606 | 3300025941 | Bacteria | 3008 |
| 473 | Ga0207689_10000327 | 3300025942 | Bacteria | 44239 |
| 474 | Ga0207689_10033285 | 3300025942 | Bacteria | 4283 |
| 475 | Ga0207661_10001459 | 3300025944 | Bacteria | 15988 |
| 476 | Ga0207661_10019801 | 3300025944 | Bacteria | 5022 |
| 477 | Ga0207661_10043126 | 3300025944 | Bacteria | 3559 |
| 478 | Ga0207661_10052386 | 3300025944 | Bacteria | 3260 |
| 479 | Ga0207661_10525885 | 3300025944 | Bacteria | 1082 |
| 480 | Ga0207679_10000270 | 3300025945 | Bacteria | 39375 |
| 481 | Ga0207679_10004603 | 3300025945 | Bacteria | 8584 |
| 482 | Ga0207679_10088396 | 3300025945 | Bacteria | 2389 |
| 483 | Ga0207667_10009922 | 3300025949 | Bacteria | 11171 |
| 484 | Ga0207667_10010078 | 3300025949 | Bacteria | 11080 |
| 485 | Ga0207667_10164879 | 3300025949 | Bacteria | 2278 |
| 486 | Ga0207667_10202547 | 3300025949 | Bacteria | 2036 |
| 487 | Ga0207667_10537461 | 3300025949 | Bacteria | 1183 |
| 488 | Ga0207667_10611641 | 3300025949 | Bacteria | 1098 |
| 489 | Ga0207651_10003823 | 3300025960 | Bacteria | 7462 |
| 490 | Ga0207651_10017953 | 3300025960 | Bacteria | 4195 |
| 491 | Ga0207651_10046901 | 3300025960 | Bacteria | 2909 |
| 492 | Ga0207651_10053927 | 3300025960 | Bacteria | 2751 |
| 493 | Ga0207651_10195736 | 3300025960 | Bacteria | 1616 |
| 494 | Ga0207651_10197557 | 3300025960 | Bacteria | 1609 |
| 495 | Ga0207651_10699573 | 3300025960 | Bacteria | 893 |
| 496 | Ga0207712_10001394 | 3300025961 | Bacteria | 16514 |
| 497 | Ga0207712_10004567 | 3300025961 | Bacteria | 8734 |
| 498 | Ga0207668_10000064 | 3300025972 | Bacteria | 87025 |
| 499 | Ga0207668_10079160 | 3300025972 | Bacteria | 2376 |
| 500 | Ga0207668_10125306 | 3300025972 | Bacteria | 1952 |
| 501 | Ga0207668_10206220 | 3300025972 | Bacteria | 1569 |
| 502 | Ga0207640_10200773 | 3300025981 | Bacteria | 1511 |
| 503 | Ga0207658_10003940 | 3300025986 | Bacteria | 10432 |
| 504 | Ga0207658_10015584 | 3300025986 | Bacteria | 5215 |
| 505 | Ga0207658_10020796 | 3300025986 | Bacteria | 4546 |
| 506 | Ga0207658_10083894 | 3300025986 | Bacteria | 2450 |
| 507 | Ga0207658_10090330 | 3300025986 | Bacteria | 2373 |
| 508 | Ga0207658_10183740 | 3300025986 | Bacteria | 1732 |
| 509 | Ga0207658_10204289 | 3300025986 | Bacteria | 1651 |
| 510 | Ga0207677_10345949 | 3300026023 | Bacteria | 1244 |
| 511 | Ga0207677_10435659 | 3300026023 | Bacteria | 1120 |
| 512 | Ga0207703_10001696 | 3300026035 | Bacteria | 19817 |
| 513 | Ga0207703_10004890 | 3300026035 | Bacteria | 10894 |
| 514 | Ga0207703_10026157 | 3300026035 | Bacteria | 4592 |
| 515 | Ga0207703_10256272 | 3300026035 | Bacteria | 1579 |
| 516 | Ga0207639_10000491 | 3300026041 | Bacteria | 27307 |
| 517 | Ga0207639_10000758 | 3300026041 | Bacteria | 21974 |
| 518 | Ga0207639_10042669 | 3300026041 | Bacteria | 3400 |
| 519 | Ga0207639_10484929 | 3300026041 | Bacteria | 1127 |
| 520 | Ga0207639_10555941 | 3300026041 | Bacteria | 1054 |
| 521 | Ga0207639_10571923 | 3300026041 | Bacteria | 1039 |
| 522 | Ga0207678_10008352 | 3300026067 | Bacteria | 9130 |
| 523 | Ga0207678_10024329 | 3300026067 | Bacteria | 5290 |
| 524 | Ga0207678_10087437 | 3300026067 | Bacteria | 2663 |
| 525 | Ga0207678_10142210 | 3300026067 | Bacteria | 2048 |
| 526 | Ga0207678_10210071 | 3300026067 | Bacteria | 1665 |
| 527 | Ga0207702_10003123 | 3300026078 | Bacteria | 15360 |
| 528 | Ga0207702_10061496 | 3300026078 | Bacteria | 3203 |
| 529 | Ga0207702_10079635 | 3300026078 | Bacteria | 2840 |
| 530 | Ga0207702_10258547 | 3300026078 | Bacteria | 1638 |
| 531 | Ga0207641_10000140 | 3300026088 | Bacteria | 105699 |
| 532 | Ga0207641_10002968 | 3300026088 | Bacteria | 15350 |
| 533 | Ga0207648_10001988 | 3300026089 | Bacteria | 22335 |
| 534 | Ga0207648_10027990 | 3300026089 | Bacteria | 5001 |
| 535 | Ga0207648_10028963 | 3300026089 | Bacteria | 4910 |
| 536 | Ga0207676_10000630 | 3300026095 | Bacteria | 28536 |
| 537 | Ga0207676_10007347 | 3300026095 | Bacteria | 7814 |
| 538 | Ga0207676_10029780 | 3300026095 | Bacteria | 4090 |
| 539 | Ga0207676_10236392 | 3300026095 | Bacteria | 1636 |
| 540 | Ga0207676_10291979 | 3300026095 | Bacteria | 1485 |
| 541 | Ga0207674_10001813 | 3300026116 | Bacteria | 27264 |
| 542 | Ga0207674_10002906 | 3300026116 | Bacteria | 21279 |
| 543 | Ga0207674_10051721 | 3300026116 | Bacteria | 4192 |
| 544 | Ga0207683_10001404 | 3300026121 | Bacteria | 21746 |
| 545 | Ga0207683_10003619 | 3300026121 | Bacteria | 13452 |
| 546 | Ga0207683_10047469 | 3300026121 | Bacteria | 3761 |
| 547 | Ga0207683_10409191 | 3300026121 | Bacteria | 1248 |
| 548 | Ga0207698_10000667 | 3300026142 | Bacteria | 19940 |
| 549 | Ga0207698_10002079 | 3300026142 | Bacteria | 11802 |
| 550 | Ga0207698_10003636 | 3300026142 | Bacteria | 9309 |
| 551 | Ga0207698_10022319 | 3300026142 | Bacteria | 4395 |
| 552 | Ga0207698_10026419 | 3300026142 | Bacteria | 4107 |
| 553 | Ga0209974_10060878 | 3300027876 | Bacteria | 1278 |
| 554 | Ga0268266_10000186 | 3300028379 | Bacteria | 110448 |
| 555 | Ga0268266_10004639 | 3300028379 | Bacteria | 13103 |
| 556 | Ga0268266_10023412 | 3300028379 | Bacteria | 5260 |
| 557 | Ga0268266_10091691 | 3300028379 | Bacteria | 2665 |
| 558 | Ga0268266_10166575 | 3300028379 | Bacteria | 1997 |
| 559 | Ga0268266_10231159 | 3300028379 | Bacteria | 1703 |
| 560 | Ga0268266_10322794 | 3300028379 | Bacteria | 1445 |
| 561 | Ga0268265_10002519 | 3300028380 | Bacteria | 13718 |
| 562 | Ga0268265_10005214 | 3300028380 | Bacteria | 8903 |
| 563 | Ga0268265_10272546 | 3300028380 | Bacteria | 1510 |
| 564 | Ga0268264_10000864 | 3300028381 | Bacteria | 32127 |
| 565 | Ga0268264_10005957 | 3300028381 | Bacteria | 10316 |
| 566 | Ga0268264_10006156 | 3300028381 | Bacteria | 10136 |
| 567 | Ga0268264_10055890 | 3300028381 | Bacteria | 3299 |
| 568 | Ga0268264_10142011 | 3300028381 | Bacteria | 2142 |
| 569 | Ga0268264_10331582 | 3300028381 | Bacteria | 1442 |
| 570 | Ga0307513_10319637 | 3300031456 | Bacteria | 1311 |
| 571 | Ga0307408_100052221 | 3300031548 | Bacteria | 2948 |
| 572 | Ga0307408_100074949 | 3300031548 | Bacteria | 2512 |
| 573 | Ga0307408_100209848 | 3300031548 | Bacteria | 1582 |
| 574 | Ga0307405_10121714 | 3300031731 | Bacteria | 1786 |
| 575 | Ga0307413_10025225 | 3300031824 | Bacteria | 3255 |
| 576 | Ga0307413_10089997 | 3300031824 | Bacteria | 1995 |
| 577 | Ga0307413_10091877 | 3300031824 | Bacteria | 1979 |
| 578 | Ga0307413_10183230 | 3300031824 | Bacteria | 1495 |
| 579 | Ga0307410_10272182 | 3300031852 | Bacteria | 1325 |
| 580 | Ga0307406_10016926 | 3300031901 | Bacteria | 4242 |
| 581 | Ga0307406_10114530 | 3300031901 | Bacteria | 1862 |
| 582 | Ga0307406_10147673 | 3300031901 | Bacteria | 1673 |
| 583 | Ga0307406_10252598 | 3300031901 | Bacteria | 1329 |
| 584 | Ga0307406_10271765 | 3300031901 | Bacteria | 1288 |
| 585 | Ga0307407_10011287 | 3300031903 | Bacteria | 4247 |
| 586 | Ga0307407_10084960 | 3300031903 | Bacteria | 1924 |
| 587 | Ga0307407_10127184 | 3300031903 | Bacteria | 1625 |
| 588 | Ga0307412_10124397 | 3300031911 | Bacteria | 1862 |
| 589 | Ga0307409_100004257 | 3300031995 | Bacteria | 7993 |
| 590 | Ga0307409_100035158 | 3300031995 | Bacteria | 3668 |
| 591 | Ga0307409_100049101 | 3300031995 | Bacteria | 3215 |
| 592 | Ga0307409_100354541 | 3300031995 | Bacteria | 1385 |
| 593 | Ga0307416_100052594 | 3300032002 | Bacteria | 3262 |
| 594 | Ga0307416_100080627 | 3300032002 | Bacteria | 2748 |
| 595 | Ga0307416_100160258 | 3300032002 | Bacteria | 2079 |
| 596 | Ga0307416_100303181 | 3300032002 | Bacteria | 1589 |
| 597 | Ga0307416_100916982 | 3300032002 | Bacteria | 977 |
| 598 | Ga0307416_101190407 | 3300032002 | Bacteria | 867 |
| 599 | Ga0307414_10014825 | 3300032004 | Bacteria | 4687 |
| 600 | Ga0307414_10117984 | 3300032004 | Bacteria | 2034 |
| 601 | Ga0307414_10145306 | 3300032004 | Bacteria | 1862 |
| 602 | Ga0307411_10000215 | 3300032005 | Bacteria | 18597 |
| 603 | Ga0307411_10003374 | 3300032005 | Bacteria | 7396 |
| 604 | Ga0307411_10014763 | 3300032005 | Bacteria | 4360 |
| 605 | Ga0307411_10039650 | 3300032005 | Bacteria | 2981 |
| 606 | Ga0307411_10068269 | 3300032005 | Bacteria | 2395 |
| 607 | Ga0307411_10101491 | 3300032005 | Bacteria | 2036 |
| 608 | Ga0307411_10219675 | 3300032005 | Bacteria | 1473 |
| 609 | Ga0307415_100041719 | 3300032126 | Bacteria | 3049 |
| 610 | Ga0307415_100057128 | 3300032126 | Bacteria | 2680 |
| 611 | Ga0307415_100193861 | 3300032126 | Bacteria | 1605 |
| 612 | Ga0307415_100628739 | 3300032126 | Bacteria | 959 |
| 613 | Ga0373930_0014989 | 3300034816 | Bacteria | 1451 |
| 614 | Ga0373939_0079559 | 3300035114 | Bacteria | 1086 |
| 615 | Ga0373935_0066871 | 3300035692 | Bacteria | 2310 |
| 616 | Ga0395899_0000317 | 3300037312 | Bacteria | 61581 |
| 617 | Ga0395899_0001361 | 3300037312 | Bacteria | 20965 |
| 618 | Ga0395899_0005719 | 3300037312 | Bacteria | 9649 |
| 619 | Ga0395899_0021568 | 3300037312 | Bacteria | 4884 |
| 620 | Ga0395899_0081349 | 3300037312 | Bacteria | 2357 |
| 621 | Ga0395899_0150922 | 3300037312 | Bacteria | 1647 |
| 622 | Ga0395900_0000238 | 3300037418 | Bacteria | 86469 |
| 623 | Ga0395900_0002081 | 3300037418 | Bacteria | 22441 |
| 624 | Ga0395900_0006436 | 3300037418 | Bacteria | 12241 |
| 625 | Ga0395900_0012091 | 3300037418 | Bacteria | 8821 |
| 626 | Ga0395900_0024061 | 3300037418 | Bacteria | 6233 |
| 627 | Ga0395900_0045409 | 3300037418 | Bacteria | 4525 |
| 628 | Ga0395900_0050400 | 3300037418 | Bacteria | 4288 |
| 629 | Ga0395900_0067426 | 3300037418 | Bacteria | 3676 |
| 630 | Ga0395900_0090625 | 3300037418 | Bacteria | 3143 |
| 631 | Ga0395900_0092306 | 3300037418 | Bacteria | 3110 |
| 632 | Ga0395900_0100537 | 3300037418 | Bacteria | 2970 |
| 633 | Ga0395900_0181684 | 3300037418 | Bacteria | 2137 |
| 634 | Ga0395900_0230531 | 3300037418 | Bacteria | 1863 |
| 635 | Ga0395900_0243676 | 3300037418 | Bacteria | 1802 |
| 636 | Ga0395900_0245439 | 3300037418 | Bacteria | 1794 |
| 637 | Ga0395900_0260079 | 3300037418 | Bacteria | 1734 |
| 638 | Ga0395900_0264355 | 3300037418 | Bacteria | 1717 |
| 639 | Ga0395900_0302675 | 3300037418 | Bacteria | 1585 |
| 640 | Ga0395900_0515593 | 3300037418 | Bacteria | 1144 |
| 641 | Ga0395900_0552900 | 3300037418 | Bacteria | 1095 |
| 642 | Ga0395898_0000245 | 3300037466 | Bacteria | 136315 |
| 643 | Ga0395898_0001564 | 3300037466 | Bacteria | 31366 |
| 644 | Ga0395898_0008573 | 3300037466 | Bacteria | 10791 |
| 645 | Ga0395898_0011731 | 3300037466 | Bacteria | 9085 |
| 646 | Ga0395898_0020204 | 3300037466 | Bacteria | 6765 |
| 647 | Ga0395898_0020443 | 3300037466 | Bacteria | 6723 |
| 648 | Ga0395898_0031578 | 3300037466 | Bacteria | 5291 |
| 649 | Ga0395898_0070760 | 3300037466 | Bacteria | 3372 |
| 650 | Ga0395898_0608003 | 3300037466 | Bacteria | 1036 |
| 651 | Ga0395905_0000006 | 3300037471 | Bacteria | 549428 |
| 652 | Ga0395905_0000207 | 3300037471 | Bacteria | 91620 |
| 653 | Ga0395905_0000434 | 3300037471 | Bacteria | 58335 |
| 654 | Ga0395905_0002185 | 3300037471 | Bacteria | 22103 |
| 655 | Ga0395905_0004985 | 3300037471 | Bacteria | 13678 |
| 656 | Ga0395905_0008954 | 3300037471 | Bacteria | 9824 |
| 657 | Ga0395905_0009061 | 3300037471 | Bacteria | 9761 |
| 658 | Ga0395905_0010784 | 3300037471 | Bacteria | 8854 |
| 659 | Ga0395905_0011336 | 3300037471 | Bacteria | 8620 |
| 660 | Ga0395905_0038483 | 3300037471 | Bacteria | 4488 |
| 661 | Ga0395905_0052871 | 3300037471 | Bacteria | 3802 |
| 662 | Ga0395905_0057995 | 3300037471 | Bacteria | 3621 |
| 663 | Ga0395905_0091218 | 3300037471 | Bacteria | 2857 |
| 664 | Ga0395905_0097680 | 3300037471 | Bacteria | 2758 |
| 665 | Ga0395905_0099231 | 3300037471 | Bacteria | 2735 |
| 666 | Ga0395905_0108789 | 3300037471 | Bacteria | 2602 |
| 667 | Ga0395905_0216005 | 3300037471 | Bacteria | 1796 |
| 668 | Ga0395905_0224832 | 3300037471 | Bacteria | 1756 |
| 669 | Ga0395905_0241482 | 3300037471 | Bacteria | 1688 |
| 670 | Ga0395905_0453500 | 3300037471 | Bacteria | 1180 |
| 671 | Ga0395905_0542921 | 3300037471 | Bacteria | 1063 |
| 672 | Ga0395905_0709223 | 3300037471 | Bacteria | 908 |
| 673 | Ga0436364_0280944 | 3300037853 | Bacteria | 14524 |
| 674 | Ga0395901_0000156 | 3300038443 | Bacteria | 88513 |
| 675 | Ga0395901_0000348 | 3300038443 | Bacteria | 56412 |
| 676 | Ga0395901_0004971 | 3300038443 | Bacteria | 13415 |
| 677 | Ga0395901_0013342 | 3300038443 | Bacteria | 8347 |
| 678 | Ga0395901_0039909 | 3300038443 | Bacteria | 4859 |
| 679 | Ga0395901_0057493 | 3300038443 | Bacteria | 4045 |
| 680 | Ga0395901_0081036 | 3300038443 | Bacteria | 3390 |
| 681 | Ga0395901_0143345 | 3300038443 | Bacteria | 2511 |
| 682 | Ga0395901_0248358 | 3300038443 | Unclassified | 1854 |
| 683 | Ga0395901_0256906 | 3300038443 | Bacteria | 1819 |
| 684 | Ga0395901_0378489 | 3300038443 | Bacteria | 1457 |
| 685 | Ga0395901_0542849 | 3300038443 | Bacteria | 1179 |
| 686 | Ga0439432_043747 | 3300042006 | Bacteria | 1412 |
| 687 | Ga0439464_0000478 | 3300042439 | Bacteria | 8085 |
| 688 | Ga0466966_0023978 | 3300044684 | Bacteria | 3993 |
| 689 | Ga0466966_0142803 | 3300044684 | Bacteria | 1462 |
| 690 | Ga0466961_0125587 | 3300044693 | Bacteria | 1610 |
| 691 | Ga0466963_0005150 | 3300044694 | Bacteria | 7632 |
| 692 | Ga0466963_0227234 | 3300044694 | Bacteria | 1307 |
| 693 | Ga0466963_0295208 | 3300044694 | Bacteria | 1139 |
| 694 | Ga0466963_0447335 | 3300044694 | Bacteria | 912 |
| 695 | Ga0466964_0038669 | 3300044706 | Bacteria | 1919 |
| 696 | Ga0466964_0063900 | 3300044706 | Bacteria | 1539 |
| 697 | Ga0466964_0218763 | 3300044706 | Bacteria | 924 |
| 698 | Ga0466971_0148185 | 3300044719 | Bacteria | 1095 |
| 699 | Ga0466968_0017723 | 3300044735 | Bacteria | 2850 |
| 700 | Ga0466970_0214532 | 3300044765 | Bacteria | 1073 |
| 701 | Ga0466957_0002219 | 3300044842 | Bacteria | 10414 |
| 702 | Ga0466957_0150487 | 3300044842 | Bacteria | 1505 |
| 703 | Ga0466957_0240294 | 3300044842 | Bacteria | 1201 |
| 704 | Ga0466957_0241449 | 3300044842 | Bacteria | 1199 |
| 705 | Ga0466959_0156395 | 3300045049 | Bacteria | 1604 |
| 706 | Ga0466959_0282209 | 3300045049 | Bacteria | 1140 |
| 707 | Ga0466958_0001937 | 3300045836 | Bacteria | 10153 |
| 708 | Ga0466958_0087083 | 3300045836 | Bacteria | 1928 |
| 709 | Ga0466958_0253408 | 3300045836 | Bacteria | 1126 |
| 710 | Ga0466967_0000114 | 3300045976 | Bacteria | 29801 |
| 711 | Ga0466967_0002108 | 3300045976 | Bacteria | 12201 |
| 712 | Ga0466967_0020865 | 3300045976 | Bacteria | 5307 |
| 713 | Ga0466967_0068398 | 3300045976 | Bacteria | 3171 |
| 714 | Ga0466967_0129278 | 3300045976 | Bacteria | 2343 |
| 715 | Ga0466967_0229652 | 3300045976 | Bacteria | 1766 |
| 716 | Ga0466967_0261319 | 3300045976 | Bacteria | 1656 |
| 717 | Ga0466967_0273918 | 3300045976 | Bacteria | 1618 |
| 718 | Ga0466967_0445007 | 3300045976 | Bacteria | 1266 |
| 719 | Ga0466967_0457145 | 3300045976 | Bacteria | 1248 |
| 720 | Ga0466967_0563088 | 3300045976 | Bacteria | 1122 |
| 721 | Ga0495584_0104666 | 3300046491 | Bacteria | 1431 |
| 722 | Ga0495668_0013522 | 3300046616 | Bacteria | 4810 |
| 723 | Ga0496100_0053033 | 3300048903 | Bacteria | 2639 |
| 724 | Ga0496100_0199089 | 3300048903 | Bacteria | 1459 |
| 725 | Ga0496101_0110091 | 3300048904 | Bacteria | 2072 |
| 726 | Ga0496103_0079576 | 3300048906 | Bacteria | 2060 |
| 727 | Ga0496105_0175002 | 3300048908 | Bacteria | 1758 |
| 728 | Ga0496106_0372670 | 3300048909 | Bacteria | 1147 |
| 729 | Ga0496107_0030547 | 3300048910 | Bacteria | 3840 |
| 730 | Ga0496107_0078019 | 3300048910 | Bacteria | 2413 |
| 731 | Ga0496108_0000918 | 3300048911 | Bacteria | 22958 |
| 732 | Ga0496108_0037109 | 3300048911 | Bacteria | 4058 |
| 733 | Ga0496108_0079103 | 3300048911 | Bacteria | 2783 |
| 734 | Ga0496109_0004342 | 3300048912 | Bacteria | 11847 |
| 735 | Ga0496109_0105471 | 3300048912 | Bacteria | 2617 |
| 736 | Ga0496109_0127820 | 3300048912 | Bacteria | 2370 |
| 737 | Ga0496109_0337752 | 3300048912 | Bacteria | 1422 |
| 738 | Ga0496110_0002254 | 3300048913 | Bacteria | 14427 |
| 739 | Ga0496110_0119914 | 3300048913 | Bacteria | 2369 |
| 740 | Ga0496110_0126684 | 3300048913 | Bacteria | 2304 |
| 741 | Ga0496111_0002556 | 3300048914 | Bacteria | 10989 |
| 742 | Ga0496111_0025524 | 3300048914 | Bacteria | 4170 |
| 743 | Ga0496111_0153540 | 3300048914 | Bacteria | 1708 |
| 744 | Ga0496111_0189828 | 3300048914 | Bacteria | 1527 |
| 745 | Ga0496112_0002859 | 3300048915 | Bacteria | 14027 |
| 746 | Ga0496112_0010416 | 3300048915 | Bacteria | 8432 |
| 747 | Ga0496112_0075975 | 3300048915 | Bacteria | 3322 |
| 748 | Ga0496113_0001331 | 3300048916 | Bacteria | 13670 |
| 749 | Ga0496113_0017854 | 3300048916 | Bacteria | 4932 |
| 750 | Ga0496113_0062660 | 3300048916 | Bacteria | 2809 |
| 751 | Ga0496113_0192380 | 3300048916 | Bacteria | 1619 |
| 752 | Ga0496114_0000021 | 3300048917 | Bacteria | 227038 |
| 753 | Ga0496114_0071165 | 3300048917 | Bacteria | 2922 |
| 754 | Ga0496115_0098562 | 3300048918 | Bacteria | 2394 |
| 755 | Ga0501296_031454 | 3300049519 | Bacteria | 717 |
| 756 | Ga0501070_0020255 | 3300049586 | Bacteria | 5579 |
| 757 | Ga0501221_005254 | 3300049704 | Bacteria | 2160 |
| 758 | Ga0501225_0035811 | 3300049705 | Bacteria | 1367 |
| 759 | Ga0501044_0403241 | 3300049823 | Bacteria | 1280 |
| 760 | nmdc:mga05p37_746331_c1 | 3300050507 | Bacteria | 1079 |
| 761 | nmdc:mga0rr50_234760_c1 | 3300050513 | Bacteria | 1518 |
| 762 | Ga0466962_0050222 | 3300061719 | Bacteria | 1994 |
| 763 | Ga0466962_0054073 | 3300061719 | Bacteria | 1919 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300002067 | JGI24735J21928_10002442 | JGI24735J21928_100024425 | 222 |
| 2 | 3300005327 | Ga0070658_10696483 | Ga0070658_106964831 | 222 |
| 3 | 3300005336 | Ga0070680_100231716 | Ga0070680_1002317161 | 222 |
| 4 | 3300005339 | Ga0070660_100005709 | Ga0070660_1000057099 | 222 |
| 5 | 3300005366 | Ga0070659_100011081 | Ga0070659_1000110814 | 222 |
| 6 | 3300005458 | Ga0070681_10012722 | Ga0070681_100127229 | 222 |
| 7 | 3300005530 | Ga0070679_100104841 | Ga0070679_1001048413 | 222 |
| 8 | 3300005539 | Ga0068853_100069569 | Ga0068853_1000695692 | 222 |
| 9 | 3300005563 | Ga0068855_100008834 | Ga0068855_1000088342 | 222 |
| 10 | 3300005564 | Ga0070664_100053717 | Ga0070664_1000537173 | 222 |
| 11 | 3300005577 | Ga0068857_100053172 | Ga0068857_1000531723 | 222 |
| 12 | 3300005578 | Ga0068854_100172126 | Ga0068854_1001721262 | 222 |
| 13 | 3300005616 | Ga0068852_100007865 | Ga0068852_1000078654 | 222 |
| 14 | 3300009093 | Ga0105240_10010807 | Ga0105240_1001080712 | 222 |
| 15 | 3300009174 | Ga0105241_10026027 | Ga0105241_100260272 | 222 |
| 16 | 3300009545 | Ga0105237_10020419 | Ga0105237_100204195 | 222 |
| 17 | 3300009551 | Ga0105238_10007509 | Ga0105238_100075099 | 222 |
| 18 | 3300013105 | Ga0157369_10029478 | Ga0157369_100294784 | 222 |
| 19 | 3300013307 | Ga0157372_10010537 | Ga0157372_100105379 | 222 |
| 20 | 3300025904 | Ga0207647_10005112 | Ga0207647_100051125 | 222 |
| 21 | 3300025909 | Ga0207705_10470744 | Ga0207705_104707442 | 222 |
| 22 | 3300025913 | Ga0207695_10023346 | Ga0207695_100233467 | 222 |
| 23 | 3300025917 | Ga0207660_10387967 | Ga0207660_103879672 | 222 |
| 24 | 3300025919 | Ga0207657_10001975 | Ga0207657_100019754 | 222 |
| 25 | 3300025920 | Ga0207649_10006045 | Ga0207649_100060456 | 222 |
| 26 | 3300025921 | Ga0207652_10144260 | Ga0207652_101442602 | 222 |
| 27 | 3300025924 | Ga0207694_10001107 | Ga0207694_1000110720 | 222 |
| 28 | 3300025932 | Ga0207690_10011543 | Ga0207690_100115432 | 222 |
| 29 | 3300025949 | Ga0207667_10010078 | Ga0207667_100100784 | 222 |
| 30 | 3300026041 | Ga0207639_10000758 | Ga0207639_100007582 | 222 |
| 31 | 3300026116 | Ga0207674_10002906 | Ga0207674_100029063 | 222 |
| 32 | 3300026142 | Ga0207698_10000667 | Ga0207698_1000066713 | 222 |
| 33 | 3300037466 | Ga0395898_0011731 | Ga0395898_0011731_439_1215 | 222 |
| 34 | 3300038443 | Ga0395901_0013342 | Ga0395901_0013342_715_1491 | 222 |
| 35 | 3300005548 | Ga0070665_100003345 | Ga0070665_1000033455 | 223 |
| 36 | 3300028379 | Ga0268266_10023412 | Ga0268266_100234123 | 223 |
| 37 | 3300044684 | Ga0466966_0023978 | Ga0466966_0023978_2773_3549 | 224 |
| 38 | 3300044765 | Ga0466970_0214532 | Ga0466970_0214532_148_924 | 224 |
| 39 | 3300044694 | Ga0466963_0447335 | Ga0466963_0447335_26_802 | 225 |
| 40 | 3300045976 | Ga0466967_0129278 | Ga0466967_0129278_195_971 | 225 |
| 41 | 3300049519 | Ga0501296_031454 | Ga0501296_031454_17_700 | 227 |
| 42 | 3300026041 | Ga0207639_10571923 | Ga0207639_105719232 | 228 |
| 43 | 3300028379 | Ga0268266_10091691 | Ga0268266_100916914 | 228 |
| 44 | 3300045836 | Ga0466958_0087083 | Ga0466958_0087083_20_706 | 228 |
| 45 | 3300049823 | Ga0501044_0403241 | Ga0501044_0403241_346_1122 | 230 |
| 46 | 3300031456 | Ga0307513_10319637 | Ga0307513_103196372 | 233 |
| 47 | 3300044706 | Ga0466964_0063900 | Ga0466964_0063900_223_1008 | 233 |
| 48 | 3300045976 | Ga0466967_0229652 | Ga0466967_0229652_593_1378 | 233 |
| 49 | 3300005535 | Ga0070684_100137352 | Ga0070684_1001373522 | 235 |
| 50 | 3300005459 | Ga0068867_100499597 | Ga0068867_1004995971 | 238 |
| 51 | 3300025926 | Ga0207659_10033653 | Ga0207659_100336532 | 244 |
| 52 | 3300037418 | Ga0395900_0230531 | Ga0395900_0230531_607_1383 | 244 |
| 53 | 3300037312 | Ga0395899_0021568 | Ga0395899_0021568_351_1091 | 245 |
| 54 | 3300037418 | Ga0395900_0092306 | Ga0395900_0092306_1540_2280 | 245 |
| 55 | 3300037466 | Ga0395898_0020204 | Ga0395898_0020204_5446_6186 | 245 |
| 56 | 3300037471 | Ga0395905_0108789 | Ga0395905_0108789_1595_2335 | 245 |
| 57 | 3300038443 | Ga0395901_0039909 | Ga0395901_0039909_3289_4029 | 245 |
| 58 | 3300044684 | Ga0466966_0142803 | Ga0466966_0142803_175_960 | 246 |
| 59 | 3300037471 | Ga0395905_0709223 | Ga0395905_0709223_33_821 | 248 |
| 60 | 3300038443 | Ga0395901_0081036 | Ga0395901_0081036_2339_3127 | 248 |
| 61 | 3300005334 | Ga0068869_100195737 | Ga0068869_1001957372 | 253 |
| 62 | 3300005353 | Ga0070669_100057236 | Ga0070669_1000572362 | 253 |
| 63 | 3300005355 | Ga0070671_100082566 | Ga0070671_1000825662 | 253 |
| 64 | 3300005364 | Ga0070673_100001423 | Ga0070673_10000142314 | 253 |
| 65 | 3300005367 | Ga0070667_100001415 | Ga0070667_10000141519 | 253 |
| 66 | 3300005457 | Ga0070662_100234228 | Ga0070662_1002342282 | 253 |
| 67 | 3300005617 | Ga0068859_100002250 | Ga0068859_10000225012 | 253 |
| 68 | 3300005618 | Ga0068864_100000399 | Ga0068864_10000039912 | 253 |
| 69 | 3300005841 | Ga0068863_100002337 | Ga0068863_1000023379 | 253 |
| 70 | 3300005842 | Ga0068858_100000377 | Ga0068858_10000037721 | 253 |
| 71 | 3300005843 | Ga0068860_100001953 | Ga0068860_1000019535 | 253 |
| 72 | 3300006931 | Ga0097620_100002250 | Ga0097620_1000022509 | 253 |
| 73 | 3300009092 | Ga0105250_10026963 | Ga0105250_100269631 | 253 |
| 74 | 3300009101 | Ga0105247_10231661 | Ga0105247_102316612 | 253 |
| 75 | 3300009177 | Ga0105248_10000075 | Ga0105248_1000007517 | 253 |
| 76 | 3300009553 | Ga0105249_10085760 | Ga0105249_100857603 | 253 |
| 77 | 3300014325 | Ga0163163_10000161 | Ga0163163_1000016135 | 253 |
| 78 | 3300014968 | Ga0157379_10111071 | Ga0157379_101110712 | 253 |
| 79 | 3300025923 | Ga0207681_10019621 | Ga0207681_100196212 | 253 |
| 80 | 3300025931 | Ga0207644_10042981 | Ga0207644_100429814 | 253 |
| 81 | 3300025933 | Ga0207706_10143074 | Ga0207706_101430742 | 253 |
| 82 | 3300025941 | Ga0207711_10000281 | Ga0207711_100002815 | 253 |
| 83 | 3300025960 | Ga0207651_10003823 | Ga0207651_100038238 | 253 |
| 84 | 3300025961 | Ga0207712_10004567 | Ga0207712_100045677 | 253 |
| 85 | 3300025986 | Ga0207658_10003940 | Ga0207658_100039402 | 253 |
| 86 | 3300026035 | Ga0207703_10001696 | Ga0207703_1000169619 | 253 |
| 87 | 3300026088 | Ga0207641_10000140 | Ga0207641_100001409 | 253 |
| 88 | 3300026095 | Ga0207676_10000630 | Ga0207676_1000063014 | 253 |
| 89 | 3300028381 | Ga0268264_10000864 | Ga0268264_100008642 | 253 |
| 90 | 3300037418 | Ga0395900_0264355 | Ga0395900_0264355_537_1325 | 253 |
| 91 | 3300037471 | Ga0395905_0009061 | Ga0395905_0009061_7033_7821 | 253 |
| 92 | 3300038443 | Ga0395901_0378489 | Ga0395901_0378489_171_959 | 253 |
| 93 | 3300009148 | Ga0105243_10617254 | Ga0105243_106172541 | 256 |
| 94 | 3300025929 | Ga0207664_10020756 | Ga0207664_100207563 | 257 |
| 95 | 3300025949 | Ga0207667_10164879 | Ga0207667_101648792 | 257 |
| 96 | 3300037466 | Ga0395898_0070760 | Ga0395898_0070760_1002_1778 | 257 |
| 97 | 3300037471 | Ga0395905_0038483 | Ga0395905_0038483_2729_3505 | 257 |
| 98 | 3300044694 | Ga0466963_0005150 | Ga0466963_0005150_1829_2605 | 257 |
| 99 | 3300044842 | Ga0466957_0240294 | Ga0466957_0240294_398_1174 | 257 |
| 100 | 3300048911 | Ga0496108_0000918 | Ga0496108_0000918_7954_8736 | 257 |
| 101 | 3300048912 | Ga0496109_0004342 | Ga0496109_0004342_6290_7072 | 257 |
| 102 | 3300048913 | Ga0496110_0002254 | Ga0496110_0002254_483_1265 | 257 |
| 103 | 3300048914 | Ga0496111_0189828 | Ga0496111_0189828_621_1403 | 257 |
| 104 | 3300048915 | Ga0496112_0002859 | Ga0496112_0002859_7899_8681 | 257 |
| 105 | 3300048916 | Ga0496113_0001331 | Ga0496113_0001331_7518_8300 | 257 |
| 106 | 3300001979 | JGI24740J21852_10072747 | JGI24740J21852_100727472 | 258 |
| 107 | 3300001989 | JGI24739J22299_10020884 | JGI24739J22299_100208842 | 258 |
| 108 | 3300002075 | JGI24738J21930_10000519 | JGI24738J21930_1000051910 | 258 |
| 109 | 3300005327 | Ga0070658_10027021 | Ga0070658_100270212 | 258 |
| 110 | 3300005327 | Ga0070658_10053738 | Ga0070658_100537384 | 258 |
| 111 | 3300005327 | Ga0070658_10103714 | Ga0070658_101037141 | 258 |
| 112 | 3300005327 | Ga0070658_10135207 | Ga0070658_101352072 | 258 |
| 113 | 3300005328 | Ga0070676_10033711 | Ga0070676_100337113 | 258 |
| 114 | 3300005329 | Ga0070683_100072189 | Ga0070683_1000721892 | 258 |
| 115 | 3300005329 | Ga0070683_100255352 | Ga0070683_1002553522 | 258 |
| 116 | 3300005330 | Ga0070690_100055977 | Ga0070690_1000559772 | 258 |
| 117 | 3300005334 | Ga0068869_100035811 | Ga0068869_1000358112 | 258 |
| 118 | 3300005335 | Ga0070666_10007639 | Ga0070666_100076395 | 258 |
| 119 | 3300005338 | Ga0068868_100073687 | Ga0068868_1000736872 | 258 |
| 120 | 3300005338 | Ga0068868_100699824 | Ga0068868_1006998241 | 258 |
| 121 | 3300005339 | Ga0070660_100217206 | Ga0070660_1002172062 | 258 |
| 122 | 3300005344 | Ga0070661_100255379 | Ga0070661_1002553791 | 258 |
| 123 | 3300005345 | Ga0070692_10032234 | Ga0070692_100322342 | 258 |
| 124 | 3300005345 | Ga0070692_10071044 | Ga0070692_100710442 | 258 |
| 125 | 3300005345 | Ga0070692_10083830 | Ga0070692_100838302 | 258 |
| 126 | 3300005347 | Ga0070668_100056138 | Ga0070668_1000561382 | 258 |
| 127 | 3300005347 | Ga0070668_100071060 | Ga0070668_1000710602 | 258 |
| 128 | 3300005347 | Ga0070668_100078788 | Ga0070668_1000787882 | 258 |
| 129 | 3300005353 | Ga0070669_100000384 | Ga0070669_10000038433 | 258 |
| 130 | 3300005355 | Ga0070671_100005846 | Ga0070671_1000058469 | 258 |
| 131 | 3300005356 | Ga0070674_100059687 | Ga0070674_1000596872 | 258 |
| 132 | 3300005356 | Ga0070674_100076527 | Ga0070674_1000765272 | 258 |
| 133 | 3300005364 | Ga0070673_100000180 | Ga0070673_10000018021 | 258 |
| 134 | 3300005366 | Ga0070659_100000688 | Ga0070659_1000006889 | 258 |
| 135 | 3300005366 | Ga0070659_100018486 | Ga0070659_1000184864 | 258 |
| 136 | 3300005366 | Ga0070659_100069967 | Ga0070659_1000699673 | 258 |
| 137 | 3300005366 | Ga0070659_100125179 | Ga0070659_1001251792 | 258 |
| 138 | 3300005367 | Ga0070667_100018647 | Ga0070667_1000186475 | 258 |
| 139 | 3300005367 | Ga0070667_100076610 | Ga0070667_1000766102 | 258 |
| 140 | 3300005455 | Ga0070663_100140485 | Ga0070663_1001404852 | 258 |
| 141 | 3300005456 | Ga0070678_100083138 | Ga0070678_1000831382 | 258 |
| 142 | 3300005456 | Ga0070678_100432991 | Ga0070678_1004329912 | 258 |
| 143 | 3300005457 | Ga0070662_100104064 | Ga0070662_1001040642 | 258 |
| 144 | 3300005457 | Ga0070662_100144560 | Ga0070662_1001445602 | 258 |
| 145 | 3300005457 | Ga0070662_100421755 | Ga0070662_1004217552 | 258 |
| 146 | 3300005458 | Ga0070681_10118182 | Ga0070681_101181822 | 258 |
| 147 | 3300005459 | Ga0068867_100001815 | Ga0068867_10000181511 | 258 |
| 148 | 3300005459 | Ga0068867_100127570 | Ga0068867_1001275702 | 258 |
| 149 | 3300005535 | Ga0070684_100104388 | Ga0070684_1001043883 | 258 |
| 150 | 3300005539 | Ga0068853_100000664 | Ga0068853_10000066412 | 258 |
| 151 | 3300005539 | Ga0068853_100023270 | Ga0068853_1000232703 | 258 |
| 152 | 3300005539 | Ga0068853_100063702 | Ga0068853_1000637022 | 258 |
| 153 | 3300005543 | Ga0070672_100012585 | Ga0070672_1000125857 | 258 |
| 154 | 3300005543 | Ga0070672_100074192 | Ga0070672_1000741922 | 258 |
| 155 | 3300005547 | Ga0070693_100013537 | Ga0070693_1000135372 | 258 |
| 156 | 3300005548 | Ga0070665_100003092 | Ga0070665_1000030925 | 258 |
| 157 | 3300005548 | Ga0070665_100212622 | Ga0070665_1002126222 | 258 |
| 158 | 3300005563 | Ga0068855_100165343 | Ga0068855_1001653432 | 258 |
| 159 | 3300005564 | Ga0070664_100477409 | Ga0070664_1004774092 | 258 |
| 160 | 3300005577 | Ga0068857_100009165 | Ga0068857_1000091652 | 258 |
| 161 | 3300005577 | Ga0068857_100134817 | Ga0068857_1001348173 | 258 |
| 162 | 3300005578 | Ga0068854_100012325 | Ga0068854_1000123256 | 258 |
| 163 | 3300005578 | Ga0068854_100115954 | Ga0068854_1001159542 | 258 |
| 164 | 3300005578 | Ga0068854_100171967 | Ga0068854_1001719672 | 258 |
| 165 | 3300005614 | Ga0068856_100042235 | Ga0068856_1000422352 | 258 |
| 166 | 3300005614 | Ga0068856_100066903 | Ga0068856_1000669032 | 258 |
| 167 | 3300005614 | Ga0068856_100073561 | Ga0068856_1000735615 | 258 |
| 168 | 3300005616 | Ga0068852_100002794 | Ga0068852_1000027945 | 258 |
| 169 | 3300005616 | Ga0068852_100004132 | Ga0068852_1000041328 | 258 |
| 170 | 3300005616 | Ga0068852_100017147 | Ga0068852_1000171476 | 258 |
| 171 | 3300005616 | Ga0068852_100067434 | Ga0068852_1000674342 | 258 |
| 172 | 3300005617 | Ga0068859_100006621 | Ga0068859_1000066218 | 258 |
| 173 | 3300005617 | Ga0068859_100057530 | Ga0068859_1000575303 | 258 |
| 174 | 3300005618 | Ga0068864_100001958 | Ga0068864_1000019583 | 258 |
| 175 | 3300005718 | Ga0068866_10054091 | Ga0068866_100540912 | 258 |
| 176 | 3300005840 | Ga0068870_10055435 | Ga0068870_100554353 | 258 |
| 177 | 3300005841 | Ga0068863_100001885 | Ga0068863_10000188523 | 258 |
| 178 | 3300005841 | Ga0068863_100084392 | Ga0068863_1000843923 | 258 |
| 179 | 3300005842 | Ga0068858_100002864 | Ga0068858_1000028642 | 258 |
| 180 | 3300005842 | Ga0068858_100208895 | Ga0068858_1002088952 | 258 |
| 181 | 3300005843 | Ga0068860_100183469 | Ga0068860_1001834692 | 258 |
| 182 | 3300005843 | Ga0068860_100324388 | Ga0068860_1003243882 | 258 |
| 183 | 3300005844 | Ga0068862_100018887 | Ga0068862_1000188875 | 258 |
| 184 | 3300006028 | Ga0070717_10002916 | Ga0070717_100029168 | 258 |
| 185 | 3300006358 | Ga0068871_100665566 | Ga0068871_1006655661 | 258 |
| 186 | 3300006844 | Ga0075428_100181532 | Ga0075428_1001815322 | 258 |
| 187 | 3300006881 | Ga0068865_100012956 | Ga0068865_1000129563 | 258 |
| 188 | 3300006931 | Ga0097620_100006620 | Ga0097620_1000066208 | 258 |
| 189 | 3300006931 | Ga0097620_100057530 | Ga0097620_1000575303 | 258 |
| 190 | 3300009098 | Ga0105245_10000632 | Ga0105245_1000063234 | 258 |
| 191 | 3300009098 | Ga0105245_10006502 | Ga0105245_100065026 | 258 |
| 192 | 3300009174 | Ga0105241_10015111 | Ga0105241_100151115 | 258 |
| 193 | 3300009174 | Ga0105241_10434353 | Ga0105241_104343532 | 258 |
| 194 | 3300009176 | Ga0105242_10042103 | Ga0105242_100421032 | 258 |
| 195 | 3300009177 | Ga0105248_10002385 | Ga0105248_100023856 | 258 |
| 196 | 3300009551 | Ga0105238_10012987 | Ga0105238_100129878 | 258 |
| 197 | 3300009551 | Ga0105238_10057312 | Ga0105238_100573122 | 258 |
| 198 | 3300010375 | Ga0105239_10035405 | Ga0105239_100354053 | 258 |
| 199 | 3300011119 | Ga0105246_10004062 | Ga0105246_100040629 | 258 |
| 200 | 3300013100 | Ga0157373_10018175 | Ga0157373_100181753 | 258 |
| 201 | 3300013100 | Ga0157373_10145328 | Ga0157373_101453281 | 258 |
| 202 | 3300013102 | Ga0157371_10001127 | Ga0157371_100011275 | 258 |
| 203 | 3300013102 | Ga0157371_10097947 | Ga0157371_100979472 | 258 |
| 204 | 3300013104 | Ga0157370_10001502 | Ga0157370_1000150210 | 258 |
| 205 | 3300013104 | Ga0157370_10029822 | Ga0157370_100298222 | 258 |
| 206 | 3300013104 | Ga0157370_10082441 | Ga0157370_100824413 | 258 |
| 207 | 3300013104 | Ga0157370_10156051 | Ga0157370_101560512 | 258 |
| 208 | 3300013104 | Ga0157370_10159903 | Ga0157370_101599033 | 258 |
| 209 | 3300013105 | Ga0157369_10003885 | Ga0157369_100038855 | 258 |
| 210 | 3300013105 | Ga0157369_10006781 | Ga0157369_1000678114 | 258 |
| 211 | 3300013105 | Ga0157369_10014674 | Ga0157369_100146745 | 258 |
| 212 | 3300013105 | Ga0157369_10086043 | Ga0157369_100860433 | 258 |
| 213 | 3300013297 | Ga0157378_10124707 | Ga0157378_101247072 | 258 |
| 214 | 3300013297 | Ga0157378_10328698 | Ga0157378_103286982 | 258 |
| 215 | 3300013307 | Ga0157372_10212709 | Ga0157372_102127092 | 258 |
| 216 | 3300013308 | Ga0157375_10074795 | Ga0157375_100747955 | 258 |
| 217 | 3300013308 | Ga0157375_10181516 | Ga0157375_101815162 | 258 |
| 218 | 3300014968 | Ga0157379_10136152 | Ga0157379_101361522 | 258 |
| 219 | 3300017792 | Ga0163161_10265283 | Ga0163161_102652831 | 258 |
| 220 | 3300021384 | Ga0213876_10106864 | Ga0213876_101068642 | 258 |
| 221 | 3300025315 | Ga0207697_10000146 | Ga0207697_1000014630 | 258 |
| 222 | 3300025321 | Ga0207656_10068927 | Ga0207656_100689272 | 258 |
| 223 | 3300025903 | Ga0207680_10077934 | Ga0207680_100779342 | 258 |
| 224 | 3300025904 | Ga0207647_10001334 | Ga0207647_100013342 | 258 |
| 225 | 3300025904 | Ga0207647_10038156 | Ga0207647_100381562 | 258 |
| 226 | 3300025904 | Ga0207647_10155200 | Ga0207647_101552002 | 258 |
| 227 | 3300025907 | Ga0207645_10205215 | Ga0207645_102052152 | 258 |
| 228 | 3300025907 | Ga0207645_10387394 | Ga0207645_103873941 | 258 |
| 229 | 3300025909 | Ga0207705_10002032 | Ga0207705_1000203217 | 258 |
| 230 | 3300025909 | Ga0207705_10021648 | Ga0207705_100216485 | 258 |
| 231 | 3300025909 | Ga0207705_10032951 | Ga0207705_100329514 | 258 |
| 232 | 3300025909 | Ga0207705_10113335 | Ga0207705_101133352 | 258 |
| 233 | 3300025911 | Ga0207654_10016807 | Ga0207654_100168072 | 258 |
| 234 | 3300025911 | Ga0207654_10283100 | Ga0207654_102831002 | 258 |
| 235 | 3300025912 | Ga0207707_10009817 | Ga0207707_100098176 | 258 |
| 236 | 3300025919 | Ga0207657_10038237 | Ga0207657_100382372 | 258 |
| 237 | 3300025920 | Ga0207649_10165412 | Ga0207649_101654121 | 258 |
| 238 | 3300025921 | Ga0207652_10092698 | Ga0207652_100926982 | 258 |
| 239 | 3300025921 | Ga0207652_10641924 | Ga0207652_106419241 | 258 |
| 240 | 3300025923 | Ga0207681_10121866 | Ga0207681_101218662 | 258 |
| 241 | 3300025924 | Ga0207694_10066828 | Ga0207694_100668282 | 258 |
| 242 | 3300025924 | Ga0207694_10518100 | Ga0207694_105181002 | 258 |
| 243 | 3300025926 | Ga0207659_10029192 | Ga0207659_100291921 | 258 |
| 244 | 3300025927 | Ga0207687_10042488 | Ga0207687_100424882 | 258 |
| 245 | 3300025927 | Ga0207687_10055427 | Ga0207687_100554272 | 258 |
| 246 | 3300025931 | Ga0207644_10000597 | Ga0207644_1000059724 | 258 |
| 247 | 3300025932 | Ga0207690_10044900 | Ga0207690_100449004 | 258 |
| 248 | 3300025932 | Ga0207690_10142790 | Ga0207690_101427902 | 258 |
| 249 | 3300025933 | Ga0207706_10010906 | Ga0207706_100109064 | 258 |
| 250 | 3300025933 | Ga0207706_10072494 | Ga0207706_100724942 | 258 |
| 251 | 3300025934 | Ga0207686_10029420 | Ga0207686_100294203 | 258 |
| 252 | 3300025936 | Ga0207670_10049689 | Ga0207670_100496892 | 258 |
| 253 | 3300025937 | Ga0207669_10393513 | Ga0207669_103935132 | 258 |
| 254 | 3300025938 | Ga0207704_10051890 | Ga0207704_100518902 | 258 |
| 255 | 3300025938 | Ga0207704_10072850 | Ga0207704_100728502 | 258 |
| 256 | 3300025940 | Ga0207691_10002641 | Ga0207691_1000264118 | 258 |
| 257 | 3300025940 | Ga0207691_10083249 | Ga0207691_100832494 | 258 |
| 258 | 3300025941 | Ga0207711_10042683 | Ga0207711_100426834 | 258 |
| 259 | 3300025942 | Ga0207689_10000327 | Ga0207689_1000032722 | 258 |
| 260 | 3300025944 | Ga0207661_10043126 | Ga0207661_100431262 | 258 |
| 261 | 3300025944 | Ga0207661_10052386 | Ga0207661_100523862 | 258 |
| 262 | 3300025945 | Ga0207679_10088396 | Ga0207679_100883962 | 258 |
| 263 | 3300025949 | Ga0207667_10537461 | Ga0207667_105374611 | 258 |
| 264 | 3300025960 | Ga0207651_10053927 | Ga0207651_100539274 | 258 |
| 265 | 3300025972 | Ga0207668_10125306 | Ga0207668_101253062 | 258 |
| 266 | 3300025972 | Ga0207668_10206220 | Ga0207668_102062202 | 258 |
| 267 | 3300025981 | Ga0207640_10200773 | Ga0207640_102007732 | 258 |
| 268 | 3300025986 | Ga0207658_10090330 | Ga0207658_100903303 | 258 |
| 269 | 3300025986 | Ga0207658_10204289 | Ga0207658_102042892 | 258 |
| 270 | 3300026023 | Ga0207677_10435659 | Ga0207677_104356591 | 258 |
| 271 | 3300026035 | Ga0207703_10026157 | Ga0207703_100261574 | 258 |
| 272 | 3300026035 | Ga0207703_10256272 | Ga0207703_102562722 | 258 |
| 273 | 3300026041 | Ga0207639_10042669 | Ga0207639_100426691 | 258 |
| 274 | 3300026067 | Ga0207678_10210071 | Ga0207678_102100712 | 258 |
| 275 | 3300026078 | Ga0207702_10061496 | Ga0207702_100614964 | 258 |
| 276 | 3300026078 | Ga0207702_10258547 | Ga0207702_102585472 | 258 |
| 277 | 3300026089 | Ga0207648_10001988 | Ga0207648_1000198821 | 258 |
| 278 | 3300026089 | Ga0207648_10027990 | Ga0207648_100279907 | 258 |
| 279 | 3300026089 | Ga0207648_10028963 | Ga0207648_100289636 | 258 |
| 280 | 3300026095 | Ga0207676_10029780 | Ga0207676_100297802 | 258 |
| 281 | 3300026095 | Ga0207676_10236392 | Ga0207676_102363922 | 258 |
| 282 | 3300026116 | Ga0207674_10001813 | Ga0207674_1000181311 | 258 |
| 283 | 3300026121 | Ga0207683_10001404 | Ga0207683_1000140414 | 258 |
| 284 | 3300026121 | Ga0207683_10409191 | Ga0207683_104091912 | 258 |
| 285 | 3300026142 | Ga0207698_10003636 | Ga0207698_100036365 | 258 |
| 286 | 3300026142 | Ga0207698_10026419 | Ga0207698_100264193 | 258 |
| 287 | 3300028379 | Ga0268266_10000186 | Ga0268266_1000018686 | 258 |
| 288 | 3300028379 | Ga0268266_10166575 | Ga0268266_101665752 | 258 |
| 289 | 3300028380 | Ga0268265_10005214 | Ga0268265_100052143 | 258 |
| 290 | 3300028381 | Ga0268264_10142011 | Ga0268264_101420112 | 258 |
| 291 | 3300028381 | Ga0268264_10331582 | Ga0268264_103315822 | 258 |
| 292 | 3300031548 | Ga0307408_100074949 | Ga0307408_1000749492 | 258 |
| 293 | 3300031731 | Ga0307405_10121714 | Ga0307405_101217142 | 258 |
| 294 | 3300031824 | Ga0307413_10025225 | Ga0307413_100252252 | 258 |
| 295 | 3300031901 | Ga0307406_10114530 | Ga0307406_101145302 | 258 |
| 296 | 3300031903 | Ga0307407_10084960 | Ga0307407_100849602 | 258 |
| 297 | 3300031911 | Ga0307412_10124397 | Ga0307412_101243972 | 258 |
| 298 | 3300031995 | Ga0307409_100354541 | Ga0307409_1003545412 | 258 |
| 299 | 3300032004 | Ga0307414_10145306 | Ga0307414_101453062 | 258 |
| 300 | 3300032005 | Ga0307411_10068269 | Ga0307411_100682692 | 258 |
| 301 | 3300032126 | Ga0307415_100193861 | Ga0307415_1001938612 | 258 |
| 302 | 3300037312 | Ga0395899_0000317 | Ga0395899_0000317_36644_37420 | 258 |
| 303 | 3300037312 | Ga0395899_0005719 | Ga0395899_0005719_8717_9493 | 258 |
| 304 | 3300037312 | Ga0395899_0081349 | Ga0395899_0081349_783_1559 | 258 |
| 305 | 3300037418 | Ga0395900_0000238 | Ga0395900_0000238_5520_6296 | 258 |
| 306 | 3300037418 | Ga0395900_0006436 | Ga0395900_0006436_1319_2095 | 258 |
| 307 | 3300037418 | Ga0395900_0024061 | Ga0395900_0024061_5432_6208 | 258 |
| 308 | 3300037418 | Ga0395900_0090625 | Ga0395900_0090625_1553_2329 | 258 |
| 309 | 3300037418 | Ga0395900_0100537 | Ga0395900_0100537_465_1241 | 258 |
| 310 | 3300037418 | Ga0395900_0245439 | Ga0395900_0245439_207_983 | 258 |
| 311 | 3300037466 | Ga0395898_0000245 | Ga0395898_0000245_106524_107300 | 258 |
| 312 | 3300037466 | Ga0395898_0001564 | Ga0395898_0001564_13903_14679 | 258 |
| 313 | 3300037466 | Ga0395898_0020443 | Ga0395898_0020443_219_995 | 258 |
| 314 | 3300037471 | Ga0395905_0000006 | Ga0395905_0000006_186588_187364 | 258 |
| 315 | 3300037471 | Ga0395905_0000434 | Ga0395905_0000434_41715_42491 | 258 |
| 316 | 3300037471 | Ga0395905_0011336 | Ga0395905_0011336_7345_8121 | 258 |
| 317 | 3300037471 | Ga0395905_0091218 | Ga0395905_0091218_77_853 | 258 |
| 318 | 3300037471 | Ga0395905_0097680 | Ga0395905_0097680_1867_2643 | 258 |
| 319 | 3300037471 | Ga0395905_0241482 | Ga0395905_0241482_323_1099 | 258 |
| 320 | 3300038443 | Ga0395901_0000156 | Ga0395901_0000156_79356_80132 | 258 |
| 321 | 3300038443 | Ga0395901_0057493 | Ga0395901_0057493_2573_3349 | 258 |
| 322 | 3300038443 | Ga0395901_0248358 | Ga0395901_0248358_532_1308 | 258 |
| 323 | 3300044694 | Ga0466963_0227234 | Ga0466963_0227234_370_1146 | 258 |
| 324 | 3300044694 | Ga0466963_0295208 | Ga0466963_0295208_222_998 | 258 |
| 325 | 3300044842 | Ga0466957_0002219 | Ga0466957_0002219_1440_2216 | 258 |
| 326 | 3300044842 | Ga0466957_0150487 | Ga0466957_0150487_427_1203 | 258 |
| 327 | 3300045836 | Ga0466958_0001937 | Ga0466958_0001937_639_1415 | 258 |
| 328 | 3300045976 | Ga0466967_0002108 | Ga0466967_0002108_10310_11086 | 258 |
| 329 | 3300045976 | Ga0466967_0068398 | Ga0466967_0068398_1929_2705 | 258 |
| 330 | 3300045976 | Ga0466967_0261319 | Ga0466967_0261319_658_1434 | 258 |
| 331 | 3300045976 | Ga0466967_0273918 | Ga0466967_0273918_229_1005 | 258 |
| 332 | 3300045976 | Ga0466967_0445007 | Ga0466967_0445007_450_1226 | 258 |
| 333 | 3300045976 | Ga0466967_0563088 | Ga0466967_0563088_141_917 | 258 |
| 334 | 3300048903 | Ga0496100_0053033 | Ga0496100_0053033_378_1154 | 258 |
| 335 | 3300048904 | Ga0496101_0110091 | Ga0496101_0110091_1230_2006 | 258 |
| 336 | 3300048906 | Ga0496103_0079576 | Ga0496103_0079576_824_1600 | 258 |
| 337 | 3300048908 | Ga0496105_0175002 | Ga0496105_0175002_502_1278 | 258 |
| 338 | 3300048912 | Ga0496109_0105471 | Ga0496109_0105471_1207_1983 | 258 |
| 339 | 3300048913 | Ga0496110_0119914 | Ga0496110_0119914_633_1409 | 258 |
| 340 | 3300048914 | Ga0496111_0002556 | Ga0496111_0002556_9225_10001 | 258 |
| 341 | 3300048914 | Ga0496111_0153540 | Ga0496111_0153540_849_1625 | 258 |
| 342 | 3300048915 | Ga0496112_0010416 | Ga0496112_0010416_2214_2990 | 258 |
| 343 | 3300048916 | Ga0496113_0017854 | Ga0496113_0017854_3475_4251 | 258 |
| 344 | 3300048916 | Ga0496113_0062660 | Ga0496113_0062660_1405_2181 | 258 |
| 345 | 3300048917 | Ga0496114_0000021 | Ga0496114_0000021_118426_119202 | 258 |
| 346 | 3300049704 | Ga0501221_005254 | Ga0501221_005254_1368_2144 | 258 |
| 347 | 3300049705 | Ga0501225_0035811 | Ga0501225_0035811_202_978 | 258 |
| 348 | 3300050507 | nmdc:mga05p37_746331_c1 | nmdc:mga05p37_746331_c1_176_952 | 258 |
| 349 | 3300001904 | JGI24736J21556_1010039 | JGI24736J21556_10100392 | 259 |
| 350 | 3300001976 | JGI24752J21851_1001448 | JGI24752J21851_10014483 | 259 |
| 351 | 3300001979 | JGI24740J21852_10026698 | JGI24740J21852_100266982 | 259 |
| 352 | 3300001990 | JGI24737J22298_10004542 | JGI24737J22298_100045423 | 259 |
| 353 | 3300001990 | JGI24737J22298_10029935 | JGI24737J22298_100299352 | 259 |
| 354 | 3300002067 | JGI24735J21928_10015099 | JGI24735J21928_100150992 | 259 |
| 355 | 3300002074 | JGI24748J21848_1005549 | JGI24748J21848_10055492 | 259 |
| 356 | 3300002075 | JGI24738J21930_10001338 | JGI24738J21930_100013382 | 259 |
| 357 | 3300005293 | Ga0065715_10216415 | Ga0065715_102164152 | 259 |
| 358 | 3300005293 | Ga0065715_10299105 | Ga0065715_102991052 | 259 |
| 359 | 3300005327 | Ga0070658_10000210 | Ga0070658_1000021053 | 259 |
| 360 | 3300005327 | Ga0070658_10002051 | Ga0070658_1000205111 | 259 |
| 361 | 3300005327 | Ga0070658_10032286 | Ga0070658_100322863 | 259 |
| 362 | 3300005327 | Ga0070658_10035738 | Ga0070658_100357382 | 259 |
| 363 | 3300005328 | Ga0070676_10315834 | Ga0070676_103158342 | 259 |
| 364 | 3300005329 | Ga0070683_100011635 | Ga0070683_1000116352 | 259 |
| 365 | 3300005329 | Ga0070683_100014420 | Ga0070683_1000144203 | 259 |
| 366 | 3300005331 | Ga0070670_100048761 | Ga0070670_1000487612 | 259 |
| 367 | 3300005331 | Ga0070670_100066971 | Ga0070670_1000669711 | 259 |
| 368 | 3300005331 | Ga0070670_100144718 | Ga0070670_1001447182 | 259 |
| 369 | 3300005335 | Ga0070666_10003943 | Ga0070666_100039437 | 259 |
| 370 | 3300005335 | Ga0070666_10014857 | Ga0070666_100148573 | 259 |
| 371 | 3300005336 | Ga0070680_100004678 | Ga0070680_1000046788 | 259 |
| 372 | 3300005336 | Ga0070680_100022929 | Ga0070680_1000229295 | 259 |
| 373 | 3300005336 | Ga0070680_100240100 | Ga0070680_1002401002 | 259 |
| 374 | 3300005338 | Ga0068868_100234829 | Ga0068868_1002348292 | 259 |
| 375 | 3300005339 | Ga0070660_100000033 | Ga0070660_1000000332 | 259 |
| 376 | 3300005339 | Ga0070660_100001411 | Ga0070660_1000014117 | 259 |
| 377 | 3300005339 | Ga0070660_100004042 | Ga0070660_1000040425 | 259 |
| 378 | 3300005339 | Ga0070660_100006275 | Ga0070660_1000062757 | 259 |
| 379 | 3300005339 | Ga0070660_100015215 | Ga0070660_1000152155 | 259 |
| 380 | 3300005344 | Ga0070661_100001507 | Ga0070661_1000015079 | 259 |
| 381 | 3300005344 | Ga0070661_100270269 | Ga0070661_1002702692 | 259 |
| 382 | 3300005345 | Ga0070692_10009692 | Ga0070692_100096923 | 259 |
| 383 | 3300005347 | Ga0070668_100160041 | Ga0070668_1001600412 | 259 |
| 384 | 3300005347 | Ga0070668_100654799 | Ga0070668_1006547991 | 259 |
| 385 | 3300005353 | Ga0070669_100031751 | Ga0070669_1000317512 | 259 |
| 386 | 3300005353 | Ga0070669_100057967 | Ga0070669_1000579673 | 259 |
| 387 | 3300005353 | Ga0070669_100125162 | Ga0070669_1001251622 | 259 |
| 388 | 3300005353 | Ga0070669_100167808 | Ga0070669_1001678082 | 259 |
| 389 | 3300005353 | Ga0070669_100296729 | Ga0070669_1002967291 | 259 |
| 390 | 3300005354 | Ga0070675_100087663 | Ga0070675_1000876632 | 259 |
| 391 | 3300005354 | Ga0070675_100119331 | Ga0070675_1001193312 | 259 |
| 392 | 3300005354 | Ga0070675_100279937 | Ga0070675_1002799371 | 259 |
| 393 | 3300005355 | Ga0070671_100013189 | Ga0070671_1000131892 | 259 |
| 394 | 3300005355 | Ga0070671_100020564 | Ga0070671_1000205644 | 259 |
| 395 | 3300005356 | Ga0070674_100011935 | Ga0070674_1000119357 | 259 |
| 396 | 3300005364 | Ga0070673_100001134 | Ga0070673_10000113411 | 259 |
| 397 | 3300005364 | Ga0070673_100096168 | Ga0070673_1000961682 | 259 |
| 398 | 3300005364 | Ga0070673_100296477 | Ga0070673_1002964772 | 259 |
| 399 | 3300005366 | Ga0070659_100001983 | Ga0070659_10000198311 | 259 |
| 400 | 3300005366 | Ga0070659_100002226 | Ga0070659_1000022265 | 259 |
| 401 | 3300005366 | Ga0070659_100028355 | Ga0070659_1000283555 | 259 |
| 402 | 3300005366 | Ga0070659_100122620 | Ga0070659_1001226202 | 259 |
| 403 | 3300005366 | Ga0070659_100123612 | Ga0070659_1001236122 | 259 |
| 404 | 3300005366 | Ga0070659_100534123 | Ga0070659_1005341231 | 259 |
| 405 | 3300005367 | Ga0070667_100020557 | Ga0070667_1000205572 | 259 |
| 406 | 3300005367 | Ga0070667_100063857 | Ga0070667_1000638571 | 259 |
| 407 | 3300005367 | Ga0070667_100210961 | Ga0070667_1002109612 | 259 |
| 408 | 3300005367 | Ga0070667_100288268 | Ga0070667_1002882682 | 259 |
| 409 | 3300005435 | Ga0070714_100150950 | Ga0070714_1001509502 | 259 |
| 410 | 3300005436 | Ga0070713_100006979 | Ga0070713_1000069797 | 259 |
| 411 | 3300005455 | Ga0070663_100001870 | Ga0070663_1000018702 | 259 |
| 412 | 3300005455 | Ga0070663_100011800 | Ga0070663_1000118002 | 259 |
| 413 | 3300005455 | Ga0070663_100055625 | Ga0070663_1000556253 | 259 |
| 414 | 3300005455 | Ga0070663_100189537 | Ga0070663_1001895372 | 259 |
| 415 | 3300005456 | Ga0070678_100001830 | Ga0070678_1000018308 | 259 |
| 416 | 3300005456 | Ga0070678_100271214 | Ga0070678_1002712142 | 259 |
| 417 | 3300005457 | Ga0070662_100000022 | Ga0070662_10000002234 | 259 |
| 418 | 3300005457 | Ga0070662_100000994 | Ga0070662_1000009943 | 259 |
| 419 | 3300005457 | Ga0070662_100008505 | Ga0070662_1000085056 | 259 |
| 420 | 3300005457 | Ga0070662_100021691 | Ga0070662_1000216912 | 259 |
| 421 | 3300005457 | Ga0070662_100024525 | Ga0070662_1000245254 | 259 |
| 422 | 3300005457 | Ga0070662_100039594 | Ga0070662_1000395942 | 259 |
| 423 | 3300005457 | Ga0070662_100087128 | Ga0070662_1000871282 | 259 |
| 424 | 3300005457 | Ga0070662_100249869 | Ga0070662_1002498692 | 259 |
| 425 | 3300005458 | Ga0070681_10020058 | Ga0070681_100200585 | 259 |
| 426 | 3300005458 | Ga0070681_10291326 | Ga0070681_102913261 | 259 |
| 427 | 3300005458 | Ga0070681_10577588 | Ga0070681_105775882 | 259 |
| 428 | 3300005530 | Ga0070679_100143075 | Ga0070679_1001430752 | 259 |
| 429 | 3300005530 | Ga0070679_100497261 | Ga0070679_1004972612 | 259 |
| 430 | 3300005535 | Ga0070684_100023033 | Ga0070684_1000230332 | 259 |
| 431 | 3300005539 | Ga0068853_100000591 | Ga0068853_1000005912 | 259 |
| 432 | 3300005539 | Ga0068853_100243764 | Ga0068853_1002437642 | 259 |
| 433 | 3300005543 | Ga0070672_100014102 | Ga0070672_1000141023 | 259 |
| 434 | 3300005543 | Ga0070672_100058072 | Ga0070672_1000580724 | 259 |
| 435 | 3300005543 | Ga0070672_100071600 | Ga0070672_1000716003 | 259 |
| 436 | 3300005543 | Ga0070672_100160844 | Ga0070672_1001608442 | 259 |
| 437 | 3300005548 | Ga0070665_100022398 | Ga0070665_1000223985 | 259 |
| 438 | 3300005548 | Ga0070665_100025282 | Ga0070665_1000252828 | 259 |
| 439 | 3300005548 | Ga0070665_100334485 | Ga0070665_1003344852 | 259 |
| 440 | 3300005563 | Ga0068855_100001504 | Ga0068855_1000015046 | 259 |
| 441 | 3300005563 | Ga0068855_100183695 | Ga0068855_1001836952 | 259 |
| 442 | 3300005563 | Ga0068855_100734265 | Ga0068855_1007342652 | 259 |
| 443 | 3300005564 | Ga0070664_100002414 | Ga0070664_1000024148 | 259 |
| 444 | 3300005564 | Ga0070664_100006323 | Ga0070664_1000063235 | 259 |
| 445 | 3300005564 | Ga0070664_100064561 | Ga0070664_1000645612 | 259 |
| 446 | 3300005564 | Ga0070664_100126696 | Ga0070664_1001266962 | 259 |
| 447 | 3300005614 | Ga0068856_100000081 | Ga0068856_10000008132 | 259 |
| 448 | 3300005614 | Ga0068856_100169573 | Ga0068856_1001695732 | 259 |
| 449 | 3300005614 | Ga0068856_100249380 | Ga0068856_1002493802 | 259 |
| 450 | 3300005616 | Ga0068852_100004538 | Ga0068852_1000045385 | 259 |
| 451 | 3300005616 | Ga0068852_100019552 | Ga0068852_1000195522 | 259 |
| 452 | 3300005616 | Ga0068852_100080029 | Ga0068852_1000800293 | 259 |
| 453 | 3300005617 | Ga0068859_100144035 | Ga0068859_1001440352 | 259 |
| 454 | 3300005617 | Ga0068859_100528037 | Ga0068859_1005280372 | 259 |
| 455 | 3300005618 | Ga0068864_100042444 | Ga0068864_1000424443 | 259 |
| 456 | 3300005618 | Ga0068864_100048016 | Ga0068864_1000480163 | 259 |
| 457 | 3300005618 | Ga0068864_100108696 | Ga0068864_1001086962 | 259 |
| 458 | 3300005834 | Ga0068851_10138216 | Ga0068851_101382162 | 259 |
| 459 | 3300005841 | Ga0068863_100005049 | Ga0068863_1000050498 | 259 |
| 460 | 3300005841 | Ga0068863_100233684 | Ga0068863_1002336842 | 259 |
| 461 | 3300005842 | Ga0068858_100031323 | Ga0068858_1000313232 | 259 |
| 462 | 3300005842 | Ga0068858_100276445 | Ga0068858_1002764452 | 259 |
| 463 | 3300005843 | Ga0068860_100024432 | Ga0068860_1000244322 | 259 |
| 464 | 3300005843 | Ga0068860_100112596 | Ga0068860_1001125962 | 259 |
| 465 | 3300005843 | Ga0068860_100130569 | Ga0068860_1001305692 | 259 |
| 466 | 3300005844 | Ga0068862_100089431 | Ga0068862_1000894313 | 259 |
| 467 | 3300005985 | Ga0081539_10025870 | Ga0081539_100258703 | 259 |
| 468 | 3300005985 | Ga0081539_10028220 | Ga0081539_100282202 | 259 |
| 469 | 3300006028 | Ga0070717_10115799 | Ga0070717_101157992 | 259 |
| 470 | 3300006173 | Ga0070716_100017245 | Ga0070716_1000172454 | 259 |
| 471 | 3300006175 | Ga0070712_100037853 | Ga0070712_1000378534 | 259 |
| 472 | 3300006237 | Ga0097621_100018861 | Ga0097621_1000188614 | 259 |
| 473 | 3300006237 | Ga0097621_100755332 | Ga0097621_1007553321 | 259 |
| 474 | 3300006358 | Ga0068871_100003403 | Ga0068871_1000034033 | 259 |
| 475 | 3300006358 | Ga0068871_100085956 | Ga0068871_1000859562 | 259 |
| 476 | 3300006358 | Ga0068871_100139177 | Ga0068871_1001391772 | 259 |
| 477 | 3300006881 | Ga0068865_100751559 | Ga0068865_1007515591 | 259 |
| 478 | 3300006931 | Ga0097620_100144036 | Ga0097620_1001440363 | 259 |
| 479 | 3300006931 | Ga0097620_100528011 | Ga0097620_1005280112 | 259 |
| 480 | 3300009098 | Ga0105245_10212807 | Ga0105245_102128072 | 259 |
| 481 | 3300009148 | Ga0105243_10230191 | Ga0105243_102301912 | 259 |
| 482 | 3300009176 | Ga0105242_10094764 | Ga0105242_100947643 | 259 |
| 483 | 3300009176 | Ga0105242_10439607 | Ga0105242_104396072 | 259 |
| 484 | 3300009177 | Ga0105248_10089405 | Ga0105248_100894052 | 259 |
| 485 | 3300009551 | Ga0105238_10120040 | Ga0105238_101200402 | 259 |
| 486 | 3300009553 | Ga0105249_10126151 | Ga0105249_101261513 | 259 |
| 487 | 3300009553 | Ga0105249_10189745 | Ga0105249_101897452 | 259 |
| 488 | 3300011119 | Ga0105246_10574609 | Ga0105246_105746092 | 259 |
| 489 | 3300013100 | Ga0157373_10001646 | Ga0157373_1000164611 | 259 |
| 490 | 3300013100 | Ga0157373_10004476 | Ga0157373_100044764 | 259 |
| 491 | 3300013100 | Ga0157373_10020793 | Ga0157373_100207935 | 259 |
| 492 | 3300013100 | Ga0157373_10042056 | Ga0157373_100420562 | 259 |
| 493 | 3300013100 | Ga0157373_10108772 | Ga0157373_101087722 | 259 |
| 494 | 3300013102 | Ga0157371_10001295 | Ga0157371_100012959 | 259 |
| 495 | 3300013102 | Ga0157371_10004826 | Ga0157371_1000482611 | 259 |
| 496 | 3300013102 | Ga0157371_10072516 | Ga0157371_100725162 | 259 |
| 497 | 3300013102 | Ga0157371_10109732 | Ga0157371_101097322 | 259 |
| 498 | 3300013102 | Ga0157371_10371347 | Ga0157371_103713472 | 259 |
| 499 | 3300013104 | Ga0157370_10058430 | Ga0157370_100584303 | 259 |
| 500 | 3300013104 | Ga0157370_10141158 | Ga0157370_101411581 | 259 |
| 501 | 3300013104 | Ga0157370_10153389 | Ga0157370_101533893 | 259 |
| 502 | 3300013104 | Ga0157370_10225432 | Ga0157370_102254322 | 259 |
| 503 | 3300013105 | Ga0157369_10042744 | Ga0157369_100427445 | 259 |
| 504 | 3300013105 | Ga0157369_10099143 | Ga0157369_100991433 | 259 |
| 505 | 3300013105 | Ga0157369_10197505 | Ga0157369_101975052 | 259 |
| 506 | 3300013105 | Ga0157369_10225343 | Ga0157369_102253432 | 259 |
| 507 | 3300013105 | Ga0157369_10722799 | Ga0157369_107227992 | 259 |
| 508 | 3300013296 | Ga0157374_10001130 | Ga0157374_1000113013 | 259 |
| 509 | 3300013296 | Ga0157374_10003689 | Ga0157374_100036892 | 259 |
| 510 | 3300013296 | Ga0157374_10009255 | Ga0157374_100092558 | 259 |
| 511 | 3300013296 | Ga0157374_10047790 | Ga0157374_100477902 | 259 |
| 512 | 3300013296 | Ga0157374_10057469 | Ga0157374_100574694 | 259 |
| 513 | 3300013297 | Ga0157378_10357941 | Ga0157378_103579412 | 259 |
| 514 | 3300013306 | Ga0163162_10002867 | Ga0163162_100028679 | 259 |
| 515 | 3300013307 | Ga0157372_10140991 | Ga0157372_101409912 | 259 |
| 516 | 3300013308 | Ga0157375_10001954 | Ga0157375_1000195412 | 259 |
| 517 | 3300013308 | Ga0157375_10002415 | Ga0157375_1000241512 | 259 |
| 518 | 3300013308 | Ga0157375_10131646 | Ga0157375_101316462 | 259 |
| 519 | 3300014325 | Ga0163163_10008545 | Ga0163163_100085453 | 259 |
| 520 | 3300014326 | Ga0157380_10108512 | Ga0157380_101085122 | 259 |
| 521 | 3300014968 | Ga0157379_10252639 | Ga0157379_102526392 | 259 |
| 522 | 3300014968 | Ga0157379_10284011 | Ga0157379_102840112 | 259 |
| 523 | 3300020081 | Ga0206354_10156462 | Ga0206354_101564622 | 259 |
| 524 | 3300025315 | Ga0207697_10034037 | Ga0207697_100340372 | 259 |
| 525 | 3300025315 | Ga0207697_10044910 | Ga0207697_100449103 | 259 |
| 526 | 3300025321 | Ga0207656_10168660 | Ga0207656_101686602 | 259 |
| 527 | 3300025893 | Ga0207682_10011792 | Ga0207682_100117922 | 259 |
| 528 | 3300025901 | Ga0207688_10054764 | Ga0207688_100547642 | 259 |
| 529 | 3300025901 | Ga0207688_10082364 | Ga0207688_100823641 | 259 |
| 530 | 3300025903 | Ga0207680_10005331 | Ga0207680_100053315 | 259 |
| 531 | 3300025903 | Ga0207680_10039327 | Ga0207680_100393272 | 259 |
| 532 | 3300025904 | Ga0207647_10000073 | Ga0207647_100000738 | 259 |
| 533 | 3300025904 | Ga0207647_10000793 | Ga0207647_100007935 | 259 |
| 534 | 3300025904 | Ga0207647_10014030 | Ga0207647_100140301 | 259 |
| 535 | 3300025904 | Ga0207647_10087290 | Ga0207647_100872902 | 259 |
| 536 | 3300025907 | Ga0207645_10163576 | Ga0207645_101635762 | 259 |
| 537 | 3300025909 | Ga0207705_10000050 | Ga0207705_10000050173 | 259 |
| 538 | 3300025909 | Ga0207705_10000395 | Ga0207705_1000039515 | 259 |
| 539 | 3300025909 | Ga0207705_10004793 | Ga0207705_100047939 | 259 |
| 540 | 3300025909 | Ga0207705_10023507 | Ga0207705_100235072 | 259 |
| 541 | 3300025909 | Ga0207705_10045186 | Ga0207705_100451862 | 259 |
| 542 | 3300025909 | Ga0207705_10054861 | Ga0207705_100548612 | 259 |
| 543 | 3300025909 | Ga0207705_10060811 | Ga0207705_100608113 | 259 |
| 544 | 3300025909 | Ga0207705_10328269 | Ga0207705_103282692 | 259 |
| 545 | 3300025909 | Ga0207705_10580165 | Ga0207705_105801651 | 259 |
| 546 | 3300025912 | Ga0207707_10156620 | Ga0207707_101566202 | 259 |
| 547 | 3300025915 | Ga0207693_10021371 | Ga0207693_100213712 | 259 |
| 548 | 3300025917 | Ga0207660_10032955 | Ga0207660_100329554 | 259 |
| 549 | 3300025917 | Ga0207660_10132361 | Ga0207660_101323612 | 259 |
| 550 | 3300025917 | Ga0207660_10136580 | Ga0207660_101365802 | 259 |
| 551 | 3300025919 | Ga0207657_10000015 | Ga0207657_1000001526 | 259 |
| 552 | 3300025919 | Ga0207657_10000020 | Ga0207657_10000020117 | 259 |
| 553 | 3300025919 | Ga0207657_10000827 | Ga0207657_1000082717 | 259 |
| 554 | 3300025919 | Ga0207657_10000923 | Ga0207657_1000092316 | 259 |
| 555 | 3300025919 | Ga0207657_10002961 | Ga0207657_1000296119 | 259 |
| 556 | 3300025919 | Ga0207657_10003761 | Ga0207657_100037615 | 259 |
| 557 | 3300025919 | Ga0207657_10013058 | Ga0207657_100130583 | 259 |
| 558 | 3300025919 | Ga0207657_10094837 | Ga0207657_100948372 | 259 |
| 559 | 3300025920 | Ga0207649_10000198 | Ga0207649_1000019829 | 259 |
| 560 | 3300025920 | Ga0207649_10212863 | Ga0207649_102128632 | 259 |
| 561 | 3300025920 | Ga0207649_10449481 | Ga0207649_104494811 | 259 |
| 562 | 3300025921 | Ga0207652_10030934 | Ga0207652_100309342 | 259 |
| 563 | 3300025923 | Ga0207681_10120753 | Ga0207681_101207531 | 259 |
| 564 | 3300025923 | Ga0207681_10350703 | Ga0207681_103507032 | 259 |
| 565 | 3300025924 | Ga0207694_10033941 | Ga0207694_100339413 | 259 |
| 566 | 3300025925 | Ga0207650_10009139 | Ga0207650_100091392 | 259 |
| 567 | 3300025925 | Ga0207650_10563787 | Ga0207650_105637872 | 259 |
| 568 | 3300025926 | Ga0207659_10011817 | Ga0207659_100118176 | 259 |
| 569 | 3300025926 | Ga0207659_10076771 | Ga0207659_100767712 | 259 |
| 570 | 3300025926 | Ga0207659_10138284 | Ga0207659_101382842 | 259 |
| 571 | 3300025927 | Ga0207687_10046828 | Ga0207687_100468282 | 259 |
| 572 | 3300025929 | Ga0207664_10039174 | Ga0207664_100391742 | 259 |
| 573 | 3300025929 | Ga0207664_10175506 | Ga0207664_101755061 | 259 |
| 574 | 3300025931 | Ga0207644_10002779 | Ga0207644_100027797 | 259 |
| 575 | 3300025931 | Ga0207644_10017950 | Ga0207644_100179504 | 259 |
| 576 | 3300025931 | Ga0207644_10113340 | Ga0207644_101133402 | 259 |
| 577 | 3300025931 | Ga0207644_10165669 | Ga0207644_101656692 | 259 |
| 578 | 3300025932 | Ga0207690_10000241 | Ga0207690_1000024140 | 259 |
| 579 | 3300025932 | Ga0207690_10000593 | Ga0207690_100005939 | 259 |
| 580 | 3300025932 | Ga0207690_10002603 | Ga0207690_100026032 | 259 |
| 581 | 3300025932 | Ga0207690_10024639 | Ga0207690_100246393 | 259 |
| 582 | 3300025932 | Ga0207690_10104547 | Ga0207690_101045472 | 259 |
| 583 | 3300025932 | Ga0207690_10187261 | Ga0207690_101872612 | 259 |
| 584 | 3300025932 | Ga0207690_10491451 | Ga0207690_104914512 | 259 |
| 585 | 3300025932 | Ga0207690_10564332 | Ga0207690_105643322 | 259 |
| 586 | 3300025933 | Ga0207706_10000308 | Ga0207706_1000030832 | 259 |
| 587 | 3300025933 | Ga0207706_10000560 | Ga0207706_1000056022 | 259 |
| 588 | 3300025933 | Ga0207706_10000645 | Ga0207706_1000064526 | 259 |
| 589 | 3300025933 | Ga0207706_10000707 | Ga0207706_1000070723 | 259 |
| 590 | 3300025933 | Ga0207706_10013139 | Ga0207706_100131393 | 259 |
| 591 | 3300025933 | Ga0207706_10018590 | Ga0207706_100185903 | 259 |
| 592 | 3300025933 | Ga0207706_10027576 | Ga0207706_100275763 | 259 |
| 593 | 3300025933 | Ga0207706_10068857 | Ga0207706_100688572 | 259 |
| 594 | 3300025933 | Ga0207706_10115838 | Ga0207706_101158382 | 259 |
| 595 | 3300025933 | Ga0207706_10143334 | Ga0207706_101433342 | 259 |
| 596 | 3300025933 | Ga0207706_10560121 | Ga0207706_105601211 | 259 |
| 597 | 3300025934 | Ga0207686_10024214 | Ga0207686_100242143 | 259 |
| 598 | 3300025934 | Ga0207686_10291985 | Ga0207686_102919851 | 259 |
| 599 | 3300025936 | Ga0207670_10387583 | Ga0207670_103875831 | 259 |
| 600 | 3300025937 | Ga0207669_10023211 | Ga0207669_100232112 | 259 |
| 601 | 3300025937 | Ga0207669_10117746 | Ga0207669_101177463 | 259 |
| 602 | 3300025939 | Ga0207665_10020709 | Ga0207665_100207095 | 259 |
| 603 | 3300025940 | Ga0207691_10007120 | Ga0207691_100071207 | 259 |
| 604 | 3300025940 | Ga0207691_10026778 | Ga0207691_100267785 | 259 |
| 605 | 3300025940 | Ga0207691_10055642 | Ga0207691_100556422 | 259 |
| 606 | 3300025940 | Ga0207691_10066906 | Ga0207691_100669062 | 259 |
| 607 | 3300025940 | Ga0207691_10148009 | Ga0207691_101480092 | 259 |
| 608 | 3300025940 | Ga0207691_10230859 | Ga0207691_102308592 | 259 |
| 609 | 3300025941 | Ga0207711_10002308 | Ga0207711_1000230810 | 259 |
| 610 | 3300025941 | Ga0207711_10060865 | Ga0207711_100608653 | 259 |
| 611 | 3300025941 | Ga0207711_10071606 | Ga0207711_100716063 | 259 |
| 612 | 3300025942 | Ga0207689_10033285 | Ga0207689_100332856 | 259 |
| 613 | 3300025944 | Ga0207661_10001459 | Ga0207661_100014599 | 259 |
| 614 | 3300025944 | Ga0207661_10019801 | Ga0207661_100198017 | 259 |
| 615 | 3300025944 | Ga0207661_10525885 | Ga0207661_105258852 | 259 |
| 616 | 3300025945 | Ga0207679_10000270 | Ga0207679_100002702 | 259 |
| 617 | 3300025945 | Ga0207679_10004603 | Ga0207679_100046036 | 259 |
| 618 | 3300025949 | Ga0207667_10009922 | Ga0207667_100099223 | 259 |
| 619 | 3300025949 | Ga0207667_10202547 | Ga0207667_102025472 | 259 |
| 620 | 3300025949 | Ga0207667_10611641 | Ga0207667_106116411 | 259 |
| 621 | 3300025960 | Ga0207651_10017953 | Ga0207651_100179531 | 259 |
| 622 | 3300025960 | Ga0207651_10046901 | Ga0207651_100469014 | 259 |
| 623 | 3300025960 | Ga0207651_10195736 | Ga0207651_101957362 | 259 |
| 624 | 3300025960 | Ga0207651_10197557 | Ga0207651_101975572 | 259 |
| 625 | 3300025960 | Ga0207651_10699573 | Ga0207651_106995731 | 259 |
| 626 | 3300025961 | Ga0207712_10001394 | Ga0207712_1000139414 | 259 |
| 627 | 3300025972 | Ga0207668_10000064 | Ga0207668_100000645 | 259 |
| 628 | 3300025972 | Ga0207668_10079160 | Ga0207668_100791602 | 259 |
| 629 | 3300025986 | Ga0207658_10015584 | Ga0207658_100155845 | 259 |
| 630 | 3300025986 | Ga0207658_10020796 | Ga0207658_100207964 | 259 |
| 631 | 3300025986 | Ga0207658_10083894 | Ga0207658_100838942 | 259 |
| 632 | 3300025986 | Ga0207658_10183740 | Ga0207658_101837402 | 259 |
| 633 | 3300026023 | Ga0207677_10345949 | Ga0207677_103459492 | 259 |
| 634 | 3300026035 | Ga0207703_10004890 | Ga0207703_100048909 | 259 |
| 635 | 3300026041 | Ga0207639_10000491 | Ga0207639_1000049111 | 259 |
| 636 | 3300026041 | Ga0207639_10484929 | Ga0207639_104849292 | 259 |
| 637 | 3300026041 | Ga0207639_10555941 | Ga0207639_105559412 | 259 |
| 638 | 3300026067 | Ga0207678_10008352 | Ga0207678_100083526 | 259 |
| 639 | 3300026067 | Ga0207678_10024329 | Ga0207678_100243295 | 259 |
| 640 | 3300026067 | Ga0207678_10087437 | Ga0207678_100874373 | 259 |
| 641 | 3300026067 | Ga0207678_10142210 | Ga0207678_101422102 | 259 |
| 642 | 3300026078 | Ga0207702_10003123 | Ga0207702_100031237 | 259 |
| 643 | 3300026078 | Ga0207702_10079635 | Ga0207702_100796353 | 259 |
| 644 | 3300026088 | Ga0207641_10002968 | Ga0207641_100029689 | 259 |
| 645 | 3300026095 | Ga0207676_10007347 | Ga0207676_100073476 | 259 |
| 646 | 3300026095 | Ga0207676_10291979 | Ga0207676_102919792 | 259 |
| 647 | 3300026116 | Ga0207674_10051721 | Ga0207674_100517213 | 259 |
| 648 | 3300026121 | Ga0207683_10003619 | Ga0207683_100036197 | 259 |
| 649 | 3300026121 | Ga0207683_10047469 | Ga0207683_100474694 | 259 |
| 650 | 3300026142 | Ga0207698_10002079 | Ga0207698_100020797 | 259 |
| 651 | 3300026142 | Ga0207698_10022319 | Ga0207698_100223193 | 259 |
| 652 | 3300027876 | Ga0209974_10060878 | Ga0209974_100608782 | 259 |
| 653 | 3300028379 | Ga0268266_10004639 | Ga0268266_100046393 | 259 |
| 654 | 3300028379 | Ga0268266_10231159 | Ga0268266_102311592 | 259 |
| 655 | 3300028379 | Ga0268266_10322794 | Ga0268266_103227942 | 259 |
| 656 | 3300028380 | Ga0268265_10002519 | Ga0268265_1000251915 | 259 |
| 657 | 3300028380 | Ga0268265_10272546 | Ga0268265_102725462 | 259 |
| 658 | 3300028381 | Ga0268264_10005957 | Ga0268264_100059579 | 259 |
| 659 | 3300028381 | Ga0268264_10006156 | Ga0268264_1000615611 | 259 |
| 660 | 3300028381 | Ga0268264_10055890 | Ga0268264_100558904 | 259 |
| 661 | 3300031548 | Ga0307408_100052221 | Ga0307408_1000522213 | 259 |
| 662 | 3300031548 | Ga0307408_100209848 | Ga0307408_1002098482 | 259 |
| 663 | 3300031824 | Ga0307413_10089997 | Ga0307413_100899972 | 259 |
| 664 | 3300031824 | Ga0307413_10091877 | Ga0307413_100918772 | 259 |
| 665 | 3300031824 | Ga0307413_10183230 | Ga0307413_101832302 | 259 |
| 666 | 3300031852 | Ga0307410_10272182 | Ga0307410_102721822 | 259 |
| 667 | 3300031901 | Ga0307406_10016926 | Ga0307406_100169262 | 259 |
| 668 | 3300031901 | Ga0307406_10147673 | Ga0307406_101476732 | 259 |
| 669 | 3300031901 | Ga0307406_10252598 | Ga0307406_102525982 | 259 |
| 670 | 3300031901 | Ga0307406_10271765 | Ga0307406_102717651 | 259 |
| 671 | 3300031903 | Ga0307407_10011287 | Ga0307407_100112874 | 259 |
| 672 | 3300031903 | Ga0307407_10127184 | Ga0307407_101271842 | 259 |
| 673 | 3300031995 | Ga0307409_100004257 | Ga0307409_1000042572 | 259 |
| 674 | 3300031995 | Ga0307409_100035158 | Ga0307409_1000351585 | 259 |
| 675 | 3300031995 | Ga0307409_100049101 | Ga0307409_1000491011 | 259 |
| 676 | 3300032002 | Ga0307416_100052594 | Ga0307416_1000525944 | 259 |
| 677 | 3300032002 | Ga0307416_100080627 | Ga0307416_1000806272 | 259 |
| 678 | 3300032002 | Ga0307416_100160258 | Ga0307416_1001602583 | 259 |
| 679 | 3300032002 | Ga0307416_100303181 | Ga0307416_1003031812 | 259 |
| 680 | 3300032002 | Ga0307416_100916982 | Ga0307416_1009169821 | 259 |
| 681 | 3300032002 | Ga0307416_101190407 | Ga0307416_1011904072 | 259 |
| 682 | 3300032004 | Ga0307414_10014825 | Ga0307414_100148253 | 259 |
| 683 | 3300032004 | Ga0307414_10117984 | Ga0307414_101179842 | 259 |
| 684 | 3300032005 | Ga0307411_10000215 | Ga0307411_100002159 | 259 |
| 685 | 3300032005 | Ga0307411_10003374 | Ga0307411_100033745 | 259 |
| 686 | 3300032005 | Ga0307411_10014763 | Ga0307411_100147632 | 259 |
| 687 | 3300032005 | Ga0307411_10039650 | Ga0307411_100396502 | 259 |
| 688 | 3300032005 | Ga0307411_10101491 | Ga0307411_101014912 | 259 |
| 689 | 3300032005 | Ga0307411_10219675 | Ga0307411_102196752 | 259 |
| 690 | 3300032126 | Ga0307415_100041719 | Ga0307415_1000417192 | 259 |
| 691 | 3300032126 | Ga0307415_100057128 | Ga0307415_1000571282 | 259 |
| 692 | 3300032126 | Ga0307415_100628739 | Ga0307415_1006287391 | 259 |
| 693 | 3300034816 | Ga0373930_0014989 | Ga0373930_0014989_516_1304 | 259 |
| 694 | 3300035114 | Ga0373939_0079559 | Ga0373939_0079559_245_1033 | 259 |
| 695 | 3300035692 | Ga0373935_0066871 | Ga0373935_0066871_971_1759 | 259 |
| 696 | 3300037312 | Ga0395899_0001361 | Ga0395899_0001361_3853_4638 | 259 |
| 697 | 3300037312 | Ga0395899_0150922 | Ga0395899_0150922_679_1467 | 259 |
| 698 | 3300037418 | Ga0395900_0002081 | Ga0395900_0002081_18477_19256 | 259 |
| 699 | 3300037418 | Ga0395900_0012091 | Ga0395900_0012091_7577_8365 | 259 |
| 700 | 3300037418 | Ga0395900_0045409 | Ga0395900_0045409_899_1681 | 259 |
| 701 | 3300037418 | Ga0395900_0050400 | Ga0395900_0050400_1743_2525 | 259 |
| 702 | 3300037418 | Ga0395900_0067426 | Ga0395900_0067426_2115_2903 | 259 |
| 703 | 3300037418 | Ga0395900_0181684 | Ga0395900_0181684_187_966 | 259 |
| 704 | 3300037418 | Ga0395900_0243676 | Ga0395900_0243676_755_1534 | 259 |
| 705 | 3300037418 | Ga0395900_0260079 | Ga0395900_0260079_855_1643 | 259 |
| 706 | 3300037418 | Ga0395900_0302675 | Ga0395900_0302675_527_1306 | 259 |
| 707 | 3300037418 | Ga0395900_0515593 | Ga0395900_0515593_123_902 | 259 |
| 708 | 3300037418 | Ga0395900_0552900 | Ga0395900_0552900_163_951 | 259 |
| 709 | 3300037466 | Ga0395898_0008573 | Ga0395898_0008573_8556_9341 | 259 |
| 710 | 3300037466 | Ga0395898_0031578 | Ga0395898_0031578_1225_2013 | 259 |
| 711 | 3300037466 | Ga0395898_0608003 | Ga0395898_0608003_48_830 | 259 |
| 712 | 3300037471 | Ga0395905_0000207 | Ga0395905_0000207_64008_64796 | 259 |
| 713 | 3300037471 | Ga0395905_0002185 | Ga0395905_0002185_3975_4763 | 259 |
| 714 | 3300037471 | Ga0395905_0004985 | Ga0395905_0004985_9468_10253 | 259 |
| 715 | 3300037471 | Ga0395905_0008954 | Ga0395905_0008954_1181_1960 | 259 |
| 716 | 3300037471 | Ga0395905_0010784 | Ga0395905_0010784_453_1241 | 259 |
| 717 | 3300037471 | Ga0395905_0052871 | Ga0395905_0052871_1904_2683 | 259 |
| 718 | 3300037471 | Ga0395905_0057995 | Ga0395905_0057995_1279_2067 | 259 |
| 719 | 3300037471 | Ga0395905_0099231 | Ga0395905_0099231_229_1017 | 259 |
| 720 | 3300037471 | Ga0395905_0216005 | Ga0395905_0216005_571_1350 | 259 |
| 721 | 3300037471 | Ga0395905_0224832 | Ga0395905_0224832_332_1111 | 259 |
| 722 | 3300037471 | Ga0395905_0453500 | Ga0395905_0453500_26_808 | 259 |
| 723 | 3300037471 | Ga0395905_0542921 | Ga0395905_0542921_55_843 | 259 |
| 724 | 3300037853 | Ga0436364_0280944 | Ga0436364_0280944_13149_13940 | 259 |
| 725 | 3300038443 | Ga0395901_0000348 | Ga0395901_0000348_25322_26101 | 259 |
| 726 | 3300038443 | Ga0395901_0004971 | Ga0395901_0004971_939_1727 | 259 |
| 727 | 3300038443 | Ga0395901_0143345 | Ga0395901_0143345_49_828 | 259 |
| 728 | 3300038443 | Ga0395901_0256906 | Ga0395901_0256906_809_1591 | 259 |
| 729 | 3300038443 | Ga0395901_0542849 | Ga0395901_0542849_288_1076 | 259 |
| 730 | 3300042006 | Ga0439432_043747 | Ga0439432_043747_373_1155 | 259 |
| 731 | 3300042439 | Ga0439464_0000478 | Ga0439464_0000478_3316_4104 | 259 |
| 732 | 3300044693 | Ga0466961_0125587 | Ga0466961_0125587_406_1194 | 259 |
| 733 | 3300044706 | Ga0466964_0038669 | Ga0466964_0038669_1117_1905 | 259 |
| 734 | 3300044706 | Ga0466964_0218763 | Ga0466964_0218763_55_837 | 259 |
| 735 | 3300044719 | Ga0466971_0148185 | Ga0466971_0148185_135_917 | 259 |
| 736 | 3300044735 | Ga0466968_0017723 | Ga0466968_0017723_667_1455 | 259 |
| 737 | 3300044842 | Ga0466957_0241449 | Ga0466957_0241449_324_1106 | 259 |
| 738 | 3300045049 | Ga0466959_0156395 | Ga0466959_0156395_23_808 | 259 |
| 739 | 3300045049 | Ga0466959_0282209 | Ga0466959_0282209_140_922 | 259 |
| 740 | 3300045836 | Ga0466958_0253408 | Ga0466958_0253408_35_823 | 259 |
| 741 | 3300045976 | Ga0466967_0000114 | Ga0466967_0000114_8748_9536 | 259 |
| 742 | 3300045976 | Ga0466967_0020865 | Ga0466967_0020865_3095_3883 | 259 |
| 743 | 3300045976 | Ga0466967_0457145 | Ga0466967_0457145_260_1048 | 259 |
| 744 | 3300046491 | Ga0495584_0104666 | Ga0495584_0104666_56_835 | 259 |
| 745 | 3300046616 | Ga0495668_0013522 | Ga0495668_0013522_37_819 | 259 |
| 746 | 3300048903 | Ga0496100_0199089 | Ga0496100_0199089_465_1262 | 259 |
| 747 | 3300048909 | Ga0496106_0372670 | Ga0496106_0372670_165_953 | 259 |
| 748 | 3300048910 | Ga0496107_0030547 | Ga0496107_0030547_1325_2113 | 259 |
| 749 | 3300048910 | Ga0496107_0078019 | Ga0496107_0078019_632_1429 | 259 |
| 750 | 3300048911 | Ga0496108_0037109 | Ga0496108_0037109_914_1693 | 259 |
| 751 | 3300048911 | Ga0496108_0079103 | Ga0496108_0079103_1363_2160 | 259 |
| 752 | 3300048912 | Ga0496109_0127820 | Ga0496109_0127820_907_1692 | 259 |
| 753 | 3300048912 | Ga0496109_0337752 | Ga0496109_0337752_74_871 | 259 |
| 754 | 3300048913 | Ga0496110_0126684 | Ga0496110_0126684_783_1580 | 259 |
| 755 | 3300048914 | Ga0496111_0025524 | Ga0496111_0025524_1494_2291 | 259 |
| 756 | 3300048915 | Ga0496112_0075975 | Ga0496112_0075975_1311_2108 | 259 |
| 757 | 3300048916 | Ga0496113_0192380 | Ga0496113_0192380_324_1121 | 259 |
| 758 | 3300048917 | Ga0496114_0071165 | Ga0496114_0071165_1988_2776 | 259 |
| 759 | 3300048918 | Ga0496115_0098562 | Ga0496115_0098562_1487_2275 | 259 |
| 760 | 3300049586 | Ga0501070_0020255 | Ga0501070_0020255_2933_3712 | 259 |
| 761 | 3300050513 | nmdc:mga0rr50_234760_c1 | nmdc:mga0rr50_234760_c1_124_906 | 259 |
| 762 | 3300061719 | Ga0466962_0050222 | Ga0466962_0050222_78_860 | 259 |
| 763 | 3300061719 | Ga0466962_0054073 | Ga0466962_0054073_1021_1803 | 259 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gzx-assembly2.cif.gz_B | crystal structure of the tatd deoxyribonuclease mw0446 from staphylococcus aureus. northeast structural genomics consortium target zr237. | 0.9486 | 3 | 254 |
| 2gzx-assembly2.cif.gz_B | crystal structure of the tatd deoxyribonuclease mw0446 from staphylococcus aureus. northeast structural genomics consortium target zr237. | 0.9413 | 3 | 254 |
| 1j6o-assembly1.cif.gz_A | crystal structure of tatd-related deoxyribonuclease (tm0667) from thermotoga maritima at 1.8 a resolution | 0.9339 | 2 | 254 |
| 1xwy-assembly1.cif.gz_A | crystal structure of tatd deoxyribonuclease from escherichia coli k12 at 2.0 a resolution | 0.9333 | 3 | 255 |
| 3rcm-assembly1.cif.gz_A | crystal structure of efi target 500140:tatd family hydrolase from pseudomonas putida | 0.9332 | 1 | 255 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2gzxB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9459 | 3 | 254 | 3.20.20.140 |
| 2gzxB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9385 | 3 | 254 | 3.20.20.140 |
| 1xwyA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9333 | 3 | 255 | 3.20.20.140 |
| 1j6oA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.933 | 3 | 254 | 3.20.20.140 |
| af_Q55DK1_60_348_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9329 | 1 | 255 | 3.20.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2D8T9V7-F1-model_v4 | LuxR family transcriptional regulator | 0.9808 | 159 | 256 |
GO:0005829
GO:0016788 |
| AF-A0A7Y1XFM7-F1-model_v4 | deleted | 0.9702 | 1 | 259 |
|
| AF-A0A382VYJ5-F1-model_v4 | Uncharacterized protein | 0.9702 | 130 | 254 |
GO:0005829
GO:0016788 |
| AF-A0A2M7ZXE0-F1-model_v4 | Uncharacterized protein | 0.9696 | 77 | 255 |
GO:0004536
GO:0005829 |
| AF-A0A258SIX7-F1-model_v4 | LuxR family transcriptional regulator | 0.9685 | 1 | 259 |
GO:0004536
GO:0005829 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar