F479697

General Info

Members Datasets Scaffolds Average Seq Length
763 345 1526 260

Family's Representative Sequence

Representative Sequence 3300042121|Ga0450919_008077|Ga0450919_008077_172_1065
Length 297
Sequence MRNVSIDLLDDTPRSVVALGTDYPDGHQLPRHTHRRAQLLYGATGVMQVSTHDGNWVVPPQRAVWSPPGVAHEVLMLGVSTRSLYIEPGAVDLGNRCQVISVSPLMRHLLMEAVEVALEYDEAGRDGALIDLLLHELARSAHLPLHIPLPMDSRLLGLCQMFLQQPNTHQSPQQWADQLHISLRTFNRLFRQQTGLSFSQWRQRACVVLALARLAVGTPVTRIALDFGYDSPAAFSTMFRRVLGQAPSVWLEGRNSEAKKSTCQVQNLWRGSLLPLGCEAVANPMHAVYLTEQGCRF

Samples

Sample ID Description Type Environment
1 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
17 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
18 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
19 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
20 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
21 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
22 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
28 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
35 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
36 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
37 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
40 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
42 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
43 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
44 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
58 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
61 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
62 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
70 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
71 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
72 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
73 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
74 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
75 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
76 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
77 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
78 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
79 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
80 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
81 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
82 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
83 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
84 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
85 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
86 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
87 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
88 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
89 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
90 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
91 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
92 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
93 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
94 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
95 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
96 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
97 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
98 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
99 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
100 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
101 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
102 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
103 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
104 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
105 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
106 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
107 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
110 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
111 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
112 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
113 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
114 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
115 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
116 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
117 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
120 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
121 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
124 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
125 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
126 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
127 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
128 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
129 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
130 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
134 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
135 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
136 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
144 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
147 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
153 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
154 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
155 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
156 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
164 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
167 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
168 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
169 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
170 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
174 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
175 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
185 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
193 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
194 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
195 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
196 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
197 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
198 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
199 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
200 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
201 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
202 2506520008 Serratia plymuthica AS12 Isolate Unclassified
203 2511231004 Pseudomonas sp. GM102 Isolate Nodule
204 2511231007 Pseudomonas sp. GM18 Isolate Nodule
205 2511231010 Pseudomonas sp. GM25 Isolate Nodule
206 2511231011 Pseudomonas sp. GM30 Isolate Nodule
207 2511231016 Pseudomonas sp. GM50 Isolate Nodule
208 2511231018 Pseudomonas sp. GM60 Isolate Nodule
209 2511231019 Pseudomonas sp. GM67 Isolate Nodule
210 2511231022 Pseudomonas sp. GM79 Isolate Nodule
211 2511231023 Pseudomonas sp. GM80 Isolate Nodule
212 2511231031 Pseudomonas sp. GM16 Isolate Nodule
213 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
214 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
215 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
216 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
217 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
218 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
219 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
220 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
221 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
222 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
223 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
224 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
225 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
226 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
227 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
228 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
229 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
230 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
231 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
232 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
233 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
234 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
235 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
236 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
237 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
238 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
239 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
240 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
241 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
242 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
243 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
244 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
245 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
246 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
247 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
248 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
249 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
250 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
251 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
252 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
253 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
254 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
255 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
256 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
257 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
258 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
259 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
260 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
261 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
262 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
263 2643221594 Achromobacter sp. Root170 Isolate Unclassified
264 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
265 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
266 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
267 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
268 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
269 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
270 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
271 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
272 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
273 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
274 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
275 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
276 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
277 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
278 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
279 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
280 2773857670 Pseudomonas sp. 478 Isolate Unclassified
281 2773857673 Pseudomonas sp. 443 Isolate Unclassified
282 2784132063 Pseudomonas sp. 424 Isolate Unclassified
283 2784132072 Pseudomonas sp. 460 Isolate Unclassified
284 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
285 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
286 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
287 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
288 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
289 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
290 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
291 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
292 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
293 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
294 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
295 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
296 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
297 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
298 2858950400 Achromobacter sp. K91 Isolate Unclassified
299 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
300 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
301 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
302 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
303 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
304 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
305 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
306 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
307 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
308 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
309 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
310 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
311 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
312 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
313 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
314 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
315 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
316 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
317 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
318 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
319 2937967321 Serratia sp. YC16 Isolate Unclassified
320 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
321 2941479691
322 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
323 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
324 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
325 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
326 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
327 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
328 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
329 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
330 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
331 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
332 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
333 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
334 8004592986 Serratia sp. S119 Isolate Unclassified
335 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
336 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
337 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
338 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
339 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
340 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
341 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
342 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
343 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
344 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
345 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81
Metatranscriptomes 0
Isolates 19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.85
Nodule 1.7
Rhizoplane 7.21
Rhizosphere 72.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0450919_008077 3300042121 Bacteria 1223
2 MRS2a_Contig_142 2124908027 Bacteria 25286
3 MRS2a_Contig_5167 2124908027 Bacteria 2234
4 SwRhRL2b_contig_1866004 2162886007 Bacteria 9886
5 JGI25162J39368_1000073 3300002737 Bacteria 121835
6 JGI25162J39368_1000231 3300002737 Bacteria 56968
7 JGI25162J39368_1000962 3300002737 Bacteria 18374
8 JGI25163J39215_1000231 3300002771 Bacteria 20731
9 JGI25163J39215_1000241 3300002771 Bacteria 20064
10 JGI25164J39214_1000052 3300002772 Bacteria 121835
11 JGI25164J39214_1000179 3300002772 Bacteria 56968
12 JGI25165J46597_1000137 3300003214 Bacteria 121835
13 JGI25165J46597_1000327 3300003214 Bacteria 56968
14 Ga0055536_1000048 3300003781 Bacteria 115094
15 Ga0055536_1000435 3300003781 Bacteria 29521
16 Ga0055530_10002671 3300003791 Bacteria 11129
17 Ga0055530_10003214 3300003791 Bacteria 9564
18 Ga0055540_1000188 3300003792 Bacteria 59841
19 Ga0055540_1002370 3300003792 Bacteria 10071
20 Ga0055531_10000157 3300003794 Bacteria 78209
21 Ga0065714_10003013 3300005288 Bacteria 9311
22 Ga0065714_10003151 3300005288 Bacteria 16574
23 Ga0065714_10006703 3300005288 Bacteria 4004
24 Ga0065714_10208226 3300005288 Bacteria 873
25 Ga0065704_10000835 3300005289 Bacteria 12066
26 Ga0065704_10086081 3300005289 Bacteria 3156
27 Ga0070669_100009132 3300005353 Bacteria 7068
28 Ga0070665_100072762 3300005548 Bacteria 3444
29 Ga0075364_10161810 3300006051 Bacteria 1511
30 Ga0075432_10008485 3300006058 Bacteria 3505
31 Ga0079104_1050257 3300006946 Bacteria 931
32 Ga0105251_10001019 3300009011 Bacteria 24570
33 Ga0105251_10001758 3300009011 Bacteria 18065
34 Ga0105251_10002161 3300009011 Bacteria 15767
35 Ga0105251_10004811 3300009011 Bacteria 9033
36 Ga0105251_10004923 3300009011 Bacteria 8899
37 Ga0105251_10005556 3300009011 Bacteria 8203
38 Ga0105251_10018071 3300009011 Bacteria 3760
39 Ga0105251_10156959 3300009011 Bacteria 1026
40 Ga0105244_10001975 3300009036 Bacteria 15864
41 Ga0105244_10002055 3300009036 Bacteria 15509
42 Ga0105244_10004574 3300009036 Bacteria 9476
43 Ga0105244_10006384 3300009036 Bacteria 7652
44 Ga0105244_10018321 3300009036 Bacteria 3930
45 Ga0105244_10126749 3300009036 Bacteria 1234
46 Ga0105250_10001200 3300009092 Bacteria 14453
47 Ga0105250_10001966 3300009092 Bacteria 10636
48 Ga0105250_10178652 3300009092 Bacteria 890
49 Ga0105247_10000027 3300009101 Bacteria 201966
50 Ga0105243_10000255 3300009148 Bacteria 61305
51 Ga0105243_10000341 3300009148 Bacteria 50977
52 Ga0105241_10000006 3300009174 Bacteria 373608
53 Ga0105249_10004670 3300009553 Bacteria 11826
54 Ga0105249_10139641 3300009553 Bacteria 2322
55 Ga0105246_10004752 3300011119 Bacteria 8272
56 Ga0105246_10012940 3300011119 Bacteria 5220
57 Ga0157345_1000030 3300012498 Bacteria 35357
58 Ga0157373_10003601 3300013100 Bacteria 11700
59 Ga0157373_10013342 3300013100 Bacteria 6028
60 Ga0157373_10025576 3300013100 Bacteria 4268
61 Ga0157373_10037366 3300013100 Bacteria 3481
62 Ga0157373_10046619 3300013100 Bacteria 3093
63 Ga0157373_10067213 3300013100 Bacteria 2535
64 Ga0157373_10525080 3300013100 Bacteria 857
65 Ga0157371_10003523 3300013102 Bacteria 14128
66 Ga0157371_10004083 3300013102 Bacteria 12901
67 Ga0157371_10007503 3300013102 Bacteria 8822
68 Ga0157370_10085389 3300013104 Bacteria 2965
69 Ga0157370_10128442 3300013104 Bacteria 2365
70 Ga0157370_10213331 3300013104 Bacteria 1789
71 Ga0157370_10219279 3300013104 Bacteria 1762
72 Ga0157369_10061988 3300013105 Bacteria 4030
73 Ga0157369_10086879 3300013105 Bacteria 3339
74 Ga0163162_10000570 3300013306 Bacteria 34084
75 Ga0157375_10071773 3300013308 Bacteria 3477
76 Ga0182008_10000181 3300014497 Bacteria 49572
77 Ga0182008_10000781 3300014497 Bacteria 22273
78 Ga0182008_10000901 3300014497 Bacteria 20653
79 Ga0182006_1000569 3300015261 Bacteria 27454
80 Ga0182006_1001938 3300015261 Bacteria 11757
81 Ga0182006_1002434 3300015261 Bacteria 10171
82 Ga0182006_1037715 3300015261 Bacteria 1914
83 Ga0182006_1044051 3300015261 Bacteria 1742
84 Ga0182007_10005107 3300015262 Bacteria 5825
85 Ga0182007_10005289 3300015262 Bacteria 5694
86 Ga0182005_1000363 3300015265 Bacteria 25254
87 Ga0163161_10000036 3300017792 Bacteria 153121
88 Ga0163161_10012458 3300017792 Bacteria 5904
89 Ga0209760_100028 3300025207 Bacteria 153020
90 Ga0209760_100068 3300025207 Bacteria 85849
91 Ga0209563_100275 3300025230 Bacteria 21699
92 Ga0207427_100007 3300025231 Bacteria 746220
93 Ga0207427_100008 3300025231 Bacteria 740731
94 Ga0209437_100006 3300025233 Bacteria 1042724
95 Ga0209437_100014 3300025233 Bacteria 740714
96 Ga0209233_1000008 3300025261 Bacteria 1356712
97 Ga0209233_1000086 3300025261 Bacteria 331687
98 Ga0209675_1007237 3300025291 Bacteria 4295
99 Ga0209676_1000010 3300025292 Bacteria 954025
100 Ga0209676_1000109 3300025292 Bacteria 217531
101 Ga0209676_1007241 3300025292 Bacteria 5270
102 Ga0209050_1000019 3300025298 Bacteria 608757
103 Ga0209050_1000422 3300025298 Bacteria 78251
104 Ga0209051_1000106 3300025303 Bacteria 159222
105 Ga0209051_1000146 3300025303 Bacteria 134294
106 Ga0209257_1000040 3300025304 Bacteria 538759
107 Ga0209257_1013892 3300025304 Bacteria 3522
108 Ga0207696_1000014 3300025711 Bacteria 517939
109 Ga0207696_1000073 3300025711 Bacteria 215388
110 Ga0207696_1002272 3300025711 Bacteria 9550
111 Ga0207696_1047299 3300025711 Bacteria 1240
112 Ga0207655_1000019 3300025728 Bacteria 536324
113 Ga0207655_1000028 3300025728 Bacteria 437324
114 Ga0207655_1000351 3300025728 Bacteria 66672
115 Ga0207655_1001107 3300025728 Bacteria 26315
116 Ga0207655_1001138 3300025728 Bacteria 25932
117 Ga0207655_1002429 3300025728 Bacteria 15146
118 Ga0207655_1013141 3300025728 Bacteria 4773
119 Ga0207655_1067470 3300025728 Bacteria 1347
120 Ga0207655_1075705 3300025728 Bacteria 1233
121 Ga0207655_1078754 3300025728 Bacteria 1196
122 Ga0207713_1000181 3300025735 Bacteria 90733
123 Ga0207713_1000272 3300025735 Bacteria 63323
124 Ga0207713_1000625 3300025735 Bacteria 34713
125 Ga0207713_1000672 3300025735 Bacteria 32332
126 Ga0207713_1007034 3300025735 Bacteria 6740
127 Ga0207713_1010479 3300025735 Bacteria 5125
128 Ga0207713_1014292 3300025735 Bacteria 4135
129 Ga0207713_1037838 3300025735 Bacteria 2053
130 Ga0207713_1047557 3300025735 Bacteria 1735
131 Ga0207710_10000007 3300025900 Bacteria 488292
132 Ga0207654_10000008 3300025911 Bacteria 375871
133 Ga0207681_10027547 3300025923 Bacteria 3675
134 Ga0207706_10075264 3300025933 Bacteria 2969
135 Ga0207709_10000013 3300025935 Bacteria 531977
136 Ga0207709_10001214 3300025935 Bacteria 18535
137 Ga0209281_1000096 3300027111 Bacteria 236276
138 Ga0209281_1025140 3300027111 Bacteria 1113
139 Ga0207428_10141846 3300027907 Bacteria 1833
140 Ga0268266_10022500 3300028379 Bacteria 5371
141 Ga0316179_1033179 3300030734 Bacteria 5072
142 Ga0316178_1100242 3300030735 Bacteria 26958
143 Ga0316183_1063865 3300030742 Bacteria 5891
144 Ga0307408_100003088 3300031548 Bacteria 11469
145 Ga0307408_100006480 3300031548 Bacteria 7763
146 Ga0307408_100035061 3300031548 Bacteria 3518
147 Ga0307408_100068841 3300031548 Bacteria 2608
148 Ga0307405_10000856 3300031731 Bacteria 12005
149 Ga0307413_10139703 3300031824 Bacteria 1672
150 Ga0307413_10206330 3300031824 Bacteria 1423
151 Ga0307406_10002358 3300031901 Bacteria 10270
152 Ga0307407_10117024 3300031903 Bacteria 1683
153 Ga0307412_10000445 3300031911 Bacteria 25038
154 Ga0307412_10001049 3300031911 Bacteria 15774
155 Ga0307412_10001077 3300031911 Bacteria 15617
156 Ga0307412_10014124 3300031911 Bacteria 4702
157 Ga0307412_10438052 3300031911 Bacteria 1073
158 Ga0307412_10629337 3300031911 Bacteria 912
159 Ga0307414_10225050 3300032004 Bacteria 1542
160 Ga0307411_10159201 3300032005 Bacteria 1688
161 Ga0307510_10019620 3300033180 Bacteria 7923
162 Ga0237819_01153 3300038705 Bacteria 7558
163 Ga0439438_001879 3300041405 Bacteria 9193
164 Ga0439438_011032 3300041405 Bacteria 2832
165 Ga0439447_000095 3300041407 Bacteria 30928
166 Ga0439447_006495 3300041407 Bacteria 3790
167 Ga0439447_010576 3300041407 Bacteria 2732
168 Ga0439447_013555 3300041407 Bacteria 2309
169 Ga0439447_014789 3300041407 Bacteria 2178
170 Ga0439447_037979 3300041407 Bacteria 1184
171 Ga0439466_0001344 3300041411 Bacteria 9588
172 Ga0439466_0005288 3300041411 Bacteria 4938
173 Ga0439466_0039608 3300041411 Bacteria 1578
174 Ga0439466_0053181 3300041411 Bacteria 1321
175 Ga0439466_0094545 3300041411 Bacteria 935
176 Ga0439431_0001151 3300041997 Bacteria 5770
177 Ga0439442_025011 3300042002 Bacteria 1242
178 Ga0439445_0004284 3300042004 Bacteria 3229
179 Ga0439445_0030663 3300042004 Bacteria 1394
180 Ga0439432_000694 3300042006 Bacteria 12583
181 Ga0439432_003680 3300042006 Bacteria 5672
182 Ga0439432_007063 3300042006 Bacteria 3994
183 Ga0439432_014643 3300042006 Bacteria 2653
184 Ga0439451_001444 3300042009 Bacteria 4700
185 Ga0439451_015488 3300042009 Bacteria 1537
186 Ga0439451_029153 3300042009 Bacteria 1111
187 Ga0439452_000323 3300042010 Bacteria 29936
188 Ga0439452_000495 3300042010 Bacteria 21617
189 Ga0439452_001919 3300042010 Bacteria 7974
190 Ga0439452_009564 3300042010 Bacteria 2849
191 Ga0439452_015179 3300042010 Bacteria 2119
192 Ga0439456_003119 3300042013 Bacteria 3353
193 Ga0439456_005898 3300042013 Bacteria 2492
194 Ga0439456_006531 3300042013 Bacteria 2384
195 Ga0439456_006585 3300042013 Bacteria 2376
196 Ga0439456_015892 3300042013 Bacteria 1573
197 Ga0439456_016036 3300042013 Bacteria 1566
198 Ga0439456_045519 3300042013 Bacteria 955
199 Ga0439463_002624 3300042016 Bacteria 4560
200 Ga0439463_022234 3300042016 Bacteria 1586
201 Ga0450911_000122 3300042115 Bacteria 30706
202 Ga0450911_010632 3300042115 Bacteria 1267
203 Ga0450922_007181 3300042124 Bacteria 1042
204 Ga0450890_000095 3300042127 Bacteria 14643
205 Ga0450900_007697 3300042136 Bacteria 1333
206 Ga0450902_003626 3300042137 Bacteria 2264
207 Ga0450902_009062 3300042137 Bacteria 1564
208 Ga0450903_003579 3300042138 Bacteria 2683
209 Ga0450903_015995 3300042138 Bacteria 1179
210 Ga0450903_016489 3300042138 Bacteria 1158
211 Ga0450905_000543 3300042142 Bacteria 4657
212 Ga0450906_000115 3300042145 Bacteria 13821
213 Ga0450906_016474 3300042145 Bacteria 1337
214 Ga0450907_000037 3300042146 Bacteria 57489
215 Ga0450907_001009 3300042146 Bacteria 6606
216 Ga0450910_002545 3300042147 Bacteria 2398
217 Ga0439446_0001890 3300042156 Bacteria 4921
218 Ga0439446_0027398 3300042156 Bacteria 1635
219 Ga0450908_018899 3300042184 Bacteria 1215
220 Ga0450909_000080 3300042185 Bacteria 8820
221 Ga0450909_000448 3300042185 Bacteria 5327
222 Ga0439434_0003785 3300042435 Bacteria 4422
223 Ga0439460_0066153 3300042461 Bacteria 1111
224 Ga0439440_0000608 3300042993 Bacteria 6078
225 Ga0495617_000252 3300046452 Bacteria 31516
226 Ga0495617_013886 3300046452 Bacteria 2739
227 Ga0495627_000017 3300046453 Bacteria 317280
228 Ga0495627_000098 3300046453 Bacteria 107446
229 Ga0495627_001052 3300046453 Bacteria 18347
230 Ga0495627_001626 3300046453 Bacteria 12555
231 Ga0495627_005327 3300046453 Bacteria 5207
232 Ga0495627_010790 3300046453 Bacteria 3303
233 Ga0495592_0413836 3300046454 Bacteria 851
234 Ga0495603_0001346 3300046455 Bacteria 14270
235 Ga0495603_0033393 3300046455 Bacteria 3096
236 Ga0495590_0000673 3300046457 Bacteria 15754
237 Ga0495590_0001254 3300046457 Bacteria 11060
238 Ga0495591_000205 3300046458 Bacteria 60191
239 Ga0495591_000297 3300046458 Bacteria 45383
240 Ga0495591_000390 3300046458 Bacteria 36973
241 Ga0495591_000656 3300046458 Bacteria 25571
242 Ga0495591_000657 3300046458 Bacteria 25568
243 Ga0495591_000931 3300046458 Bacteria 20063
244 Ga0495591_003982 3300046458 Bacteria 7403
245 Ga0495591_029996 3300046458 Bacteria 1646
246 Ga0495629_0122349 3300046459 Bacteria 1813
247 Ga0495638_0010935 3300046460 Bacteria 6275
248 Ga0495638_0017897 3300046460 Bacteria 4716
249 Ga0495638_0024832 3300046460 Bacteria 3901
250 Ga0495638_0067975 3300046460 Bacteria 2186
251 Ga0495653_0003162 3300046463 Bacteria 13191
252 Ga0495653_0061391 3300046463 Bacteria 2844
253 Ga0495650_0000392 3300046471 Bacteria 74545
254 Ga0495650_0001870 3300046471 Bacteria 18796
255 Ga0495650_0006807 3300046471 Bacteria 7051
256 Ga0495650_0019978 3300046471 Bacteria 3278
257 Ga0495605_0000506 3300046474 Bacteria 33459
258 Ga0495605_0000816 3300046474 Bacteria 22234
259 Ga0495605_0001814 3300046474 Bacteria 13675
260 Ga0495605_0002082 3300046474 Bacteria 12579
261 Ga0495605_0010331 3300046474 Bacteria 5226
262 Ga0495605_0031303 3300046474 Bacteria 2718
263 Ga0495605_0073514 3300046474 Bacteria 1610
264 Ga0495639_0000174 3300046475 Bacteria 33747
265 Ga0495639_0083633 3300046475 Bacteria 1489
266 Ga0495584_0000355 3300046491 Bacteria 31770
267 Ga0495584_0001099 3300046491 Bacteria 16795
268 Ga0495584_0002010 3300046491 Bacteria 11688
269 Ga0495584_0004781 3300046491 Bacteria 7240
270 Ga0495584_0023387 3300046491 Bacteria 3133
271 Ga0495585_0001351 3300046492 Bacteria 19438
272 Ga0495585_0002857 3300046492 Bacteria 12020
273 Ga0495585_0010270 3300046492 Bacteria 5582
274 Ga0495585_0093463 3300046492 Bacteria 1617
275 Ga0495594_0044104 3300046499 Bacteria 2445
276 Ga0495596_0011480 3300046500 Bacteria 3819
277 Ga0495607_0000288 3300046501 Bacteria 53438
278 Ga0495607_0000570 3300046501 Bacteria 35986
279 Ga0495607_0000655 3300046501 Bacteria 33607
280 Ga0495607_0001835 3300046501 Bacteria 18102
281 Ga0495607_0005380 3300046501 Bacteria 9185
282 Ga0495607_0005477 3300046501 Bacteria 9077
283 Ga0495607_0009375 3300046501 Bacteria 6627
284 Ga0495607_0010404 3300046501 Bacteria 6255
285 Ga0495607_0019440 3300046501 Bacteria 4315
286 Ga0495607_0027208 3300046501 Bacteria 3539
287 Ga0495607_0152529 3300046501 Bacteria 1181
288 Ga0495583_0000978 3300046506 Bacteria 32813
289 Ga0495583_0002209 3300046506 Bacteria 17232
290 Ga0495583_0004160 3300046506 Bacteria 10554
291 Ga0495583_0004562 3300046506 Bacteria 9848
292 Ga0495583_0013805 3300046506 Bacteria 4482
293 Ga0495583_0063214 3300046506 Bacteria 1646
294 Ga0495606_0000086 3300046507 Bacteria 156764
295 Ga0495606_0000151 3300046507 Bacteria 119548
296 Ga0495606_0001371 3300046507 Bacteria 32970
297 Ga0495606_0001659 3300046507 Bacteria 28923
298 Ga0495606_0002967 3300046507 Bacteria 18678
299 Ga0495606_0004756 3300046507 Bacteria 13361
300 Ga0495606_0133287 3300046507 Bacteria 1474
301 Ga0495610_0001166 3300046512 Bacteria 23910
302 Ga0495610_0008813 3300046512 Bacteria 6469
303 Ga0495610_0041657 3300046512 Bacteria 2303
304 Ga0495616_0000522 3300046513 Bacteria 29126
305 Ga0495616_0001715 3300046513 Bacteria 14953
306 Ga0495616_0004132 3300046513 Bacteria 9202
307 Ga0495616_0005893 3300046513 Bacteria 7475
308 Ga0495616_0011113 3300046513 Bacteria 5170
309 Ga0495616_0024489 3300046513 Bacteria 3237
310 Ga0495620_0000452 3300046515 Bacteria 27253
311 Ga0495620_0000981 3300046515 Bacteria 17591
312 Ga0495620_0000992 3300046515 Bacteria 17535
313 Ga0495620_0001545 3300046515 Bacteria 13673
314 Ga0495620_0008742 3300046515 Bacteria 5420
315 Ga0495630_0267330 3300046517 Bacteria 1306
316 Ga0495630_0504701 3300046517 Bacteria 927
317 Ga0495631_0000141 3300046518 Bacteria 49113
318 Ga0495631_0001289 3300046518 Bacteria 15395
319 Ga0495631_0001499 3300046518 Bacteria 14077
320 Ga0495631_0012305 3300046518 Bacteria 4185
321 Ga0495631_0015525 3300046518 Bacteria 3646
322 Ga0495631_0017102 3300046518 Bacteria 3437
323 Ga0495632_0000836 3300046519 Bacteria 27127
324 Ga0495632_0000880 3300046519 Bacteria 26404
325 Ga0495632_0001034 3300046519 Bacteria 24024
326 Ga0495632_0001217 3300046519 Bacteria 21823
327 Ga0495632_0006768 3300046519 Bacteria 7322
328 Ga0495632_0006890 3300046519 Bacteria 7229
329 Ga0495632_0040292 3300046519 Bacteria 2353
330 Ga0495632_0040730 3300046519 Bacteria 2337
331 Ga0495632_0206149 3300046519 Bacteria 893
332 Ga0495637_0000032 3300046520 Bacteria 128687
333 Ga0495637_0000090 3300046520 Bacteria 70678
334 Ga0495637_0000187 3300046520 Bacteria 48520
335 Ga0495637_0000419 3300046520 Bacteria 31122
336 Ga0495637_0001091 3300046520 Bacteria 16762
337 Ga0495637_0005841 3300046520 Bacteria 6227
338 Ga0495643_0003097 3300046522 Bacteria 12450
339 Ga0495643_0005265 3300046522 Bacteria 8792
340 Ga0495643_0007754 3300046522 Bacteria 6872
341 Ga0495643_0008147 3300046522 Bacteria 6669
342 Ga0495643_0012979 3300046522 Bacteria 5005
343 Ga0495643_0223136 3300046522 Bacteria 892
344 Ga0495648_0000956 3300046524 Bacteria 29826
345 Ga0495648_0001327 3300046524 Bacteria 24541
346 Ga0495648_0034569 3300046524 Bacteria 3287
347 Ga0495648_0041169 3300046524 Bacteria 2920
348 Ga0495648_0041194 3300046524 Bacteria 2919
349 Ga0495648_0061311 3300046524 Bacteria 2234
350 Ga0495648_0080626 3300046524 Bacteria 1853
351 Ga0495648_0202448 3300046524 Bacteria 992
352 Ga0495666_0000676 3300046526 Bacteria 15445
353 Ga0495666_0001886 3300046526 Bacteria 10350
354 Ga0495666_0003370 3300046526 Bacteria 8057
355 Ga0495666_0198192 3300046526 Bacteria 923
356 Ga0495642_0000268 3300046528 Bacteria 29408
357 Ga0495654_0000568 3300046530 Bacteria 29692
358 Ga0495654_0000980 3300046530 Bacteria 20998
359 Ga0495654_0002908 3300046530 Bacteria 10733
360 Ga0495654_0004675 3300046530 Bacteria 8073
361 Ga0495654_0011975 3300046530 Bacteria 4676
362 Ga0495654_0017331 3300046530 Bacteria 3789
363 Ga0495654_0023868 3300046530 Bacteria 3165
364 Ga0495654_0024533 3300046530 Bacteria 3113
365 Ga0495586_0006948 3300046535 Bacteria 6029
366 Ga0495586_0197706 3300046535 Bacteria 1139
367 Ga0495587_0001070 3300046536 Bacteria 17998
368 Ga0495587_0001117 3300046536 Bacteria 17580
369 Ga0495609_0000040 3300046538 Bacteria 177058
370 Ga0495609_0001802 3300046538 Bacteria 13761
371 Ga0495609_0010733 3300046538 Bacteria 4381
372 Ga0495609_0022313 3300046538 Bacteria 2915
373 Ga0495609_0043081 3300046538 Bacteria 2026
374 Ga0495597_0001263 3300046542 Bacteria 18678
375 Ga0495597_0001594 3300046542 Bacteria 15928
376 Ga0495597_0082262 3300046542 Bacteria 1376
377 Ga0495597_0101659 3300046542 Bacteria 1212
378 Ga0495622_0000862 3300046557 Bacteria 16644
379 Ga0495622_0100727 3300046557 Bacteria 1324
380 Ga0495633_0002836 3300046558 Bacteria 11935
381 Ga0495633_0003536 3300046558 Bacteria 10346
382 Ga0495633_0006942 3300046558 Bacteria 6620
383 Ga0495633_0129992 3300046558 Bacteria 1165
384 Ga0495656_0002970 3300046615 Bacteria 5694
385 Ga0495668_0001921 3300046616 Bacteria 18473
386 Ga0495634_0000547 3300046642 Bacteria 36842
387 Ga0495611_0000238 3300046648 Bacteria 38101
388 Ga0495611_0000379 3300046648 Bacteria 28404
389 Ga0495611_0008014 3300046648 Bacteria 4486
390 Ga0495611_0015877 3300046648 Bacteria 3218
391 Ga0495625_0000247 3300046660 Bacteria 85241
392 Ga0495625_0001482 3300046660 Bacteria 28333
393 Ga0495625_0001656 3300046660 Bacteria 26124
394 Ga0495625_0003173 3300046660 Bacteria 16729
395 Ga0495625_0008376 3300046660 Bacteria 8828
396 Ga0495625_0079762 3300046660 Bacteria 2281
397 Ga0495625_0349744 3300046660 Bacteria 934
398 Ga0495625_0491070 3300046660 Bacteria 752
399 Ga0495635_0000507 3300046663 Bacteria 24607
400 Ga0495635_0001340 3300046663 Bacteria 16393
401 Ga0495659_0000177 3300046664 Bacteria 28092
402 Ga0495659_0155728 3300046664 Bacteria 920
403 Ga0495661_0000019 3300046665 Bacteria 200606
404 Ga0495661_0000469 3300046665 Bacteria 42710
405 Ga0495661_0001896 3300046665 Bacteria 16690
406 Ga0495661_0005495 3300046665 Bacteria 8992
407 Ga0495661_0005892 3300046665 Bacteria 8663
408 Ga0495661_0032580 3300046665 Bacteria 3293
409 Ga0495588_0001628 3300046674 Bacteria 9600
410 Ga0495588_0030482 3300046674 Bacteria 2711
411 Ga0495623_0001025 3300046679 Bacteria 18914
412 Ga0495623_0004894 3300046679 Bacteria 8780
413 Ga0495646_0001334 3300046680 Bacteria 14574
414 Ga0495646_0079543 3300046680 Bacteria 1913
415 Ga0495646_0081128 3300046680 Bacteria 1890
416 Ga0495669_0001709 3300046684 Bacteria 8991
417 Ga0495669_0046937 3300046684 Bacteria 1928
418 Ga0495613_0015187 3300046689 Bacteria 5721
419 Ga0495613_0212431 3300046689 Bacteria 1360
420 Ga0495624_0000407 3300046690 Bacteria 34221
421 Ga0495670_0000161 3300046691 Bacteria 29207
422 Ga0495670_0000555 3300046691 Bacteria 17788
423 Ga0495670_0032108 3300046691 Bacteria 2610
424 Ga0495670_0141195 3300046691 Bacteria 1259
425 Ga0495671_0000307 3300046692 Bacteria 41409
426 Ga0495671_0000515 3300046692 Bacteria 29577
427 Ga0495671_0001888 3300046692 Bacteria 13457
428 Ga0495671_0030362 3300046692 Bacteria 2768
429 Ga0495671_0036922 3300046692 Bacteria 2473
430 Ga0495671_0232367 3300046692 Bacteria 891
431 Ga0495649_0001032 3300046694 Bacteria 21852
432 Ga0495649_0005387 3300046694 Bacteria 8144
433 Ga0495649_0007115 3300046694 Bacteria 6876
434 Ga0495649_0013890 3300046694 Bacteria 4631
435 Ga0495649_0042541 3300046694 Bacteria 2482
436 Ga0495649_0102477 3300046694 Bacteria 1520
437 Ga0495649_0137160 3300046694 Bacteria 1289
438 Ga0495589_0000068 3300046794 Bacteria 98844
439 Ga0495589_0000401 3300046794 Bacteria 32575
440 Ga0495589_0001127 3300046794 Bacteria 15903
441 Ga0495589_0002944 3300046794 Bacteria 9390
442 Ga0495589_0020420 3300046794 Bacteria 3387
443 Ga0495589_0087444 3300046794 Bacteria 1513
444 Ga0495600_0005465 3300046809 Bacteria 7661
445 Ga0495600_0058511 3300046809 Bacteria 2517
446 Ga0495660_0001781 3300046810 Bacteria 14238
447 Ga0495660_0003302 3300046810 Bacteria 10011
448 Ga0495660_0004628 3300046810 Bacteria 8298
449 Ga0495660_0005074 3300046810 Bacteria 7911
450 Ga0495660_0018117 3300046810 Bacteria 4049
451 Ga0495660_0028887 3300046810 Bacteria 3131
452 Ga0495660_0053510 3300046810 Bacteria 2190
453 Ga0495604_0001252 3300047317 Bacteria 20802
454 Ga0495604_0058652 3300047317 Bacteria 2955
455 Ga0495636_0007195 3300047318 Bacteria 4381
456 Ga0495674_0006958 3300047319 Bacteria 10821
457 Ga0495672_0001048 3300047320 Bacteria 28233
458 Ga0495672_0001711 3300047320 Bacteria 21255
459 Ga0495672_0001906 3300047320 Bacteria 19827
460 Ga0495672_0004627 3300047320 Bacteria 11168
461 Ga0495672_0008895 3300047320 Bacteria 7341
462 Ga0495672_0015064 3300047320 Bacteria 5262
463 Ga0495672_0030504 3300047320 Bacteria 3380
464 Ga0495672_0163563 3300047320 Bacteria 1141
465 Ga0495676_0000010 3300047321 Bacteria 242637
466 Ga0495676_0026968 3300047321 Bacteria 4934
467 Ga0495676_0359175 3300047321 Bacteria 973
468 Ga0495680_0008447 3300047322 Bacteria 9359
469 Ga0495680_0015130 3300047322 Bacteria 6662
470 Ga0495680_0031542 3300047322 Bacteria 4310
471 Ga0495680_0073538 3300047322 Bacteria 2597
472 Ga0495683_0001298 3300047323 Bacteria 16884
473 Ga0495683_0005115 3300047323 Bacteria 7318
474 Ga0495683_0012278 3300047323 Bacteria 4500
475 Ga0495683_0012451 3300047323 Bacteria 4462
476 Ga0495683_0014402 3300047323 Bacteria 4119
477 Ga0495683_0022033 3300047323 Bacteria 3278
478 Ga0495683_0098473 3300047323 Bacteria 1408
479 Ga0495687_002837 3300047443 Bacteria 13339
480 Ga0495687_024999 3300047443 Bacteria 2830
481 Ga0495675_0228495 3300047444 Bacteria 1123
482 Ga0495677_0000538 3300047445 Bacteria 15739
483 Ga0495679_004334 3300047446 Bacteria 6572
484 Ga0495679_008569 3300047446 Bacteria 4145
485 Ga0495679_012742 3300047446 Bacteria 3185
486 Ga0495679_022021 3300047446 Bacteria 2188
487 Ga0495685_078086 3300047447 Bacteria 1104
488 Ga0495673_0000712 3300047469 Bacteria 32267
489 Ga0495673_0000877 3300047469 Bacteria 27787
490 Ga0495673_0002729 3300047469 Bacteria 12111
491 Ga0495673_0003067 3300047469 Bacteria 11233
492 Ga0495673_0003275 3300047469 Bacteria 10782
493 Ga0495673_0004099 3300047469 Bacteria 9250
494 Ga0495673_0005228 3300047469 Bacteria 7888
495 Ga0495673_0012423 3300047469 Bacteria 4517
496 Ga0495673_0021699 3300047469 Bacteria 3164
497 Ga0495673_0025915 3300047469 Bacteria 2811
498 Ga0495673_0031725 3300047469 Bacteria 2471
499 Ga0495673_0036440 3300047469 Bacteria 2256
500 Ga0495673_0066356 3300047469 Bacteria 1530
501 Ga0495673_0071632 3300047469 Bacteria 1456
502 Ga0495681_0002707 3300047470 Bacteria 12543
503 Ga0495681_0003703 3300047470 Bacteria 10601
504 Ga0495681_0005396 3300047470 Bacteria 8569
505 Ga0495681_0005615 3300047470 Bacteria 8365
506 Ga0495681_0009154 3300047470 Bacteria 6127
507 Ga0495681_0017168 3300047470 Bacteria 4030
508 Ga0495684_0018935 3300047471 Bacteria 5301
509 Ga0495686_0001583 3300047472 Bacteria 24052
510 Ga0495593_0000399 3300047673 Bacteria 24177
511 Ga0495593_0001659 3300047673 Bacteria 13161
512 Ga0495593_0002660 3300047673 Bacteria 10744
513 Ga0495593_0147958 3300047673 Bacteria 1188
514 Ga0495602_0001276 3300048088 Bacteria 24783
515 Ga0495626_0000013 3300048091 Bacteria 248164
516 Ga0495626_0000790 3300048091 Bacteria 28764
517 Ga0495626_0000964 3300048091 Bacteria 24933
518 Ga0495626_0002584 3300048091 Bacteria 12374
519 Ga0495626_0003031 3300048091 Bacteria 11064
520 Ga0495626_0008201 3300048091 Bacteria 5752
521 Ga0495626_0012661 3300048091 Bacteria 4412
522 Ga0495626_0051767 3300048091 Bacteria 1893
523 Ga0496102_0000428 3300048905 Bacteria 48609
524 Ga0496102_0551375 3300048905 Bacteria 1075
525 Ga0496103_0001915 3300048906 Bacteria 13516
526 Ga0496103_0037361 3300048906 Bacteria 2976
527 Ga0496107_0207218 3300048910 Bacteria 1457
528 Ga0496112_0096650 3300048915 Bacteria 2924
529 Ga0496115_0075545 3300048918 Bacteria 2737
530 Ga0496116_0000009 3300048919 Bacteria 716119
531 Ga0496116_0000560 3300048919 Bacteria 49704
532 Ga0496116_0004175 3300048919 Bacteria 13907
533 Ga0496116_0005517 3300048919 Bacteria 11692
534 Ga0496116_0009945 3300048919 Bacteria 8038
535 Ga0496116_0024984 3300048919 Bacteria 4402
536 Ga0496116_0115918 3300048919 Bacteria 1562
537 Ga0496116_0225734 3300048919 Bacteria 955
538 Ga0496116_0264027 3300048919 Bacteria 846
539 Ga0496117_0000100 3300048920 Bacteria 194307
540 Ga0496117_0000792 3300048920 Bacteria 49586
541 Ga0496117_0003774 3300048920 Bacteria 17326
542 Ga0496117_0013952 3300048920 Bacteria 6961
543 Ga0496117_0018977 3300048920 Bacteria 5668
544 Ga0496117_0031000 3300048920 Bacteria 4091
545 Ga0496117_0113864 3300048920 Bacteria 1678
546 Ga0496117_0155009 3300048920 Bacteria 1350
547 Ga0496118_0006448 3300048921 Bacteria 12891
548 Ga0496118_0014953 3300048921 Bacteria 7220
549 Ga0496118_0039390 3300048921 Bacteria 3772
550 Ga0496118_0061552 3300048921 Bacteria 2778
551 Ga0496118_0134350 3300048921 Bacteria 1581
552 Ga0496119_0000741 3300048922 Bacteria 43950
553 Ga0496119_0001453 3300048922 Bacteria 28441
554 Ga0496119_0005386 3300048922 Bacteria 12297
555 Ga0496119_0018195 3300048922 Bacteria 5246
556 Ga0496119_0033206 3300048922 Bacteria 3426
557 Ga0496120_0000389 3300048923 Bacteria 70922
558 Ga0496120_0000572 3300048923 Bacteria 56188
559 Ga0496120_0006022 3300048923 Bacteria 9437
560 Ga0496120_0134776 3300048923 Bacteria 1260
561 Ga0496121_0000145 3300048924 Bacteria 156655
562 Ga0496121_0001037 3300048924 Bacteria 49625
563 Ga0496121_0002877 3300048924 Bacteria 25360
564 Ga0496121_0049476 3300048924 Bacteria 3563
565 Ga0496121_0095183 3300048924 Bacteria 2315
566 Ga0496121_0284285 3300048924 Bacteria 1130
567 Ga0496122_0000029 3300048925 Bacteria 336396
568 Ga0496122_0002535 3300048925 Bacteria 25716
569 Ga0496122_0003856 3300048925 Bacteria 19248
570 Ga0496122_0011476 3300048925 Bacteria 8965
571 Ga0496122_0024277 3300048925 Bacteria 5309
572 Ga0496123_0000216 3300048926 Bacteria 117098
573 Ga0496123_0005776 3300048926 Bacteria 12293
574 Ga0496123_0009492 3300048926 Bacteria 8757
575 Ga0496123_0038556 3300048926 Bacteria 3355
576 Ga0496123_0083192 3300048926 Bacteria 1936
577 Ga0496124_0000053 3300048927 Bacteria 252285
578 Ga0496124_0001263 3300048927 Bacteria 38490
579 Ga0496124_0039621 3300048927 Bacteria 4082
580 Ga0496124_0061300 3300048927 Bacteria 3153
581 Ga0496124_0154355 3300048927 Bacteria 1797
582 Ga0496124_0217998 3300048927 Bacteria 1437
583 Ga0496125_0001051 3300048928 Bacteria 42648
584 Ga0496125_0001102 3300048928 Bacteria 41526
585 Ga0496125_0013998 3300048928 Bacteria 7844
586 Ga0496125_0059461 3300048928 Bacteria 3079
587 Ga0496125_0194399 3300048928 Bacteria 1336
588 Ga0496126_0078086 3300048929 Bacteria 2934
589 Ga0496126_0095622 3300048929 Bacteria 2605
590 Ga0495678_000897 3300049459 Bacteria 26315
591 Ga0495678_001684 3300049459 Bacteria 16762
592 Ga0495678_001821 3300049459 Bacteria 15676
593 Ga0495678_001928 3300049459 Bacteria 15030
594 Ga0495678_003252 3300049459 Bacteria 10159
595 Ga0495678_004218 3300049459 Bacteria 8445
596 Ga0495678_006650 3300049459 Bacteria 6116
597 Ga0495678_009813 3300049459 Bacteria 4701
598 Ga0495678_010574 3300049459 Bacteria 4475
599 Ga0495678_011115 3300049459 Bacteria 4326
600 Ga0495678_048802 3300049459 Bacteria 1649
601 Ga0495678_091980 3300049459 Bacteria 1066
602 Ga0495682_0001166 3300049460 Bacteria 15091
603 Ga0495682_0005391 3300049460 Bacteria 5320
604 Ga0495682_0006879 3300049460 Bacteria 4571
605 Ga0495682_0011368 3300049460 Bacteria 3425
606 Ga0495682_0012104 3300049460 Bacteria 3315
607 Ga0495682_0016860 3300049460 Bacteria 2762
608 Ga0495682_0019612 3300049460 Bacteria 2542
609 Ga0495682_0102497 3300049460 Bacteria 1026
610 Ga0495682_0104378 3300049460 Bacteria 1016
611 Ga0495682_0109358 3300049460 Bacteria 990
612 Ga0501222_005236 3300049662 Bacteria 1753
613 Ga0501227_027787 3300049665 Bacteria 1340
614 Ga0501240_000135 3300049673 Bacteria 4917
615 Ga0501241_000180 3300049758 Bacteria 14263
616 Ga0501269_000845 3300049766 Bacteria 4637
617 Ga0501226_004873 3300049853 Bacteria 1540
618 nmdc:mga00v17_145139_c1 3300050491 Bacteria 1523
619 2506580591 2506520007 Bacteria 5442880
620 2506585730 2506520008 Bacteria 5443009
621 2511254528 2511231004 Bacteria 6669789
622 2511270092 2511231007 Bacteria 6306603
623 2511287862 2511231010 Bacteria 6373152
624 2511294877 2511231011 Bacteria 6149768
625 2511326486 2511231016 Bacteria 6704427
626 2511341219 2511231018 Bacteria 6436256
627 2511343460 2511231019 Bacteria 6520662
628 2511363060 2511231022 Bacteria 6719296
629 2511370759 2511231023 Bacteria 6808468
630 2511412850 2511231031 Bacteria 6558529
631 2511826498 2511231156 Bacteria 6845832
632 2512329487 2512047018 Bacteria 6663241
633 2555671544 2554235341 Bacteria 6867980
634 2583794030 2582580891 Bacteria 6800976
635 2599354298 2599185160 Bacteria 6844013
636 2599359988 2599185161 Bacteria 6960462
637 2599366310 2599185162 Bacteria 6957254
638 2599373100 2599185163 Bacteria 6995158
639 2599379406 2599185164 Bacteria 6841688
640 2599385616 2599185165 Bacteria 6843250
641 2599391959 2599185166 Bacteria 6959206
642 2599403725 2599185168 Bacteria 6997636
643 2599461132 2599185181 Bacteria 6844519
644 2599469674 2599185182 Bacteria 6883168
645 2599490152 2599185186 Bacteria 6831633
646 2599503454 2599185188 Bacteria 6164180
647 2599613402 2599185212 Bacteria 6765997
648 2599771074 2599185248 Bacteria 6696816
649 2599886222 2599185289 Bacteria 6778765
650 2599897937 2599185291 Bacteria 6775623
651 2599905708 2599185292 Bacteria 6290804
652 2599929790 2599185300 Bacteria 6062622
653 2599945928 2599185302 Bacteria 5954930
654 2599956910 2599185304 Bacteria 5951361
655 2599960251 2599185305 Bacteria 6748700
656 2599969140 2599185306 Bacteria 6637356
657 2599980446 2599185308 Bacteria 6621546
658 2599983538 2599185309 Bacteria 5969593
659 2599989945 2599185310 Bacteria 6014457
660 2599995778 2599185311 Bacteria 6354990
661 2600000423 2599185312 Bacteria 5912071
662 2600005099 2599185313 Bacteria 6658188
663 2600014299 2599185314 Bacteria 6621749
664 2600017751 2599185315 Bacteria 6771107
665 2600026654 2599185316 Bacteria 6320029
666 2600028608 2599185317 Bacteria 6435722
667 2600033730 2599185318 Bacteria 6961590
668 2600047745 2599185320 Bacteria 5963263
669 2600056490 2599185321 Bacteria 6764560
670 2600058944 2599185322 Bacteria 6763055
671 2600070177 2599185324 Bacteria 6590677
672 2600078062 2599185325 Bacteria 6324919
673 2600213747 2599185356 Bacteria 6843884
674 2600357776 2600254930 Bacteria 6431253
675 2601773915 2600255313 Bacteria 6842543
676 2601796572 2600255318 Bacteria 6383414
677 2606073722 2603880185 Bacteria 6379190
678 2606126634 2603880199 Bacteria 6377649
679 2624482271 2623620443 Bacteria 6427864
680 2624490679 2623620446 Bacteria 6500345
681 2643981544 2643221594 Bacteria 5811388
682 2644186405 2643221633 Bacteria 6733554
683 2644281993 2643221650 Bacteria 7029547
684 2644365085 2643221665 Bacteria 4699229
685 2656276336 2654587920 Bacteria 5475511
686 2671090030 2667528170 Bacteria 6786960
687 2671096879 2667528171 Bacteria 6900659
688 2671125334 2667528176 Bacteria 6724917
689 2678264838 2675903515 Bacteria 6580491
690 2689447145 2687453601 Bacteria 5546041
691 2715750274 2713897148 Bacteria 5883533
692 2715760183 2713897149 Bacteria 6506249
693 2718635464 2718217725 Bacteria 5758958
694 2739316620 2738543025 Bacteria 6600348
695 2743739160 2740892503 Bacteria 6855563
696 2745005292 2744054620 Bacteria 6551379
697 2772440947 2772190666 Bacteria 5117644
698 2774122373 2773857670 Bacteria 6407454
699 2774133156 2773857673 Bacteria 6513460
700 2784262988 2784132063 Bacteria 6262788
701 2784316211 2784132072 Bacteria 6596533
702 2794595848 2791355520 Bacteria 5948615
703 2808931449 2808606377 Bacteria 6646337
704 2808953571 2808606381 Bacteria 6646461
705 2808961716 2808606382 Bacteria 6841132
706 2809035451 2808606395 Bacteria 6020352
707 2819655949 2818991456 Bacteria 6123676
708 2819701972 2818991464 Bacteria 6907494
709 2825656265 2825651385 Bacteria 6715909
710 2842837144 2842832357 Bacteria 5959113
711 2842844934 2842843487 Bacteria 6004777
712 2842856665 2842854478 Bacteria 6143501
713 2844672071 2844665904 Bacteria 6817974
714 2852661224 2852657418 Bacteria 6472974
715 2857541164 2857537821 Bacteria 5248181
716 2858953337 2858950400 Bacteria 6783797
717 2860341126 2860339153 Bacteria 6846989
718 2878034198 2878029506 Bacteria 6418441
719 2880234817 2880230671 Bacteria 6140320
720 2888371054 2888366609 Bacteria 5155009
721 2888376246 2888373701 Bacteria 5098052
722 2904521047 2904518522 Bacteria 6068986
723 2913041439 2913036834 Bacteria 6704877
724 2917075414 2917070673 Bacteria 6868303
725 2919066740 2919063839 Bacteria 6302690
726 2919388290 2919385768 Bacteria 5897293
727 2919459226 2919456309 Bacteria 6586567
728 2919484374 2919481497 Bacteria 6907839
729 2919489517 2919487758 Bacteria 5929766
730 2919701876 2919697872 Bacteria 6553725
731 2923158242 2923153595 Bacteria 6870622
732 2923591254 2923586266 Bacteria 6565975
733 2928516036 2928515477 Bacteria 4448421
734 2929148779 2929144301 Bacteria 6622272
735 2931373797 2931369376 Bacteria 6847892
736 2935356400 2935353572 Unclassified 6955622
737 2937971212 2937967321 Bacteria 5094075
738 2939655556 2939651529 Bacteria 5895393
739 2941483651
740 2945965430 2945961074 Bacteria 7342064
741 2969308980 2969304461 Bacteria 6601805
742 2974289644 2974289157 Bacteria 6080362
743 2998144276 2998139840 Bacteria 6073514
744 3007397537 3007395558 Bacteria 6755444
745 3007516034 3007511990 Bacteria 6481491
746 3007615260 3007614139 Bacteria 6053559
747 3007621723 3007619802 Bacteria 6411688
748 3007720994 3007718800 Bacteria 5971527
749 3007865717 3007861166 Bacteria 6045338
750 3007867876 3007866637 Bacteria 5899198
751 637321865 637000220 Bacteria 7074893
752 8004593853 8004592986 Bacteria 5122074
753 8015397080 8015394850 Bacteria 5064660
754 8015692339 8015687852 Bacteria 6613826
755 8019774984 8019769354 Bacteria 6924660
756 8019780598 8019775933 Bacteria 6858656
757 8029996602 8029995093 Bacteria 5990776
758 8055775549 8055770955 Bacteria 6827675
759 8056144620 8056143049 Bacteria 6307666
760 8056159275 8056155041 Bacteria 6486948
761 8056166986 8056166840 Bacteria 5820959
762 8056574019 8056569372 Bacteria 5997322
763 8057804409 8057798959 Bacteria 6713499
764 Ga0450919_008077
765 MRS2a_Contig_142
766 MRS2a_Contig_5167
767 SwRhRL2b_contig_1866004
768 JGI25162J39368_1000073
769 JGI25162J39368_1000231
770 JGI25162J39368_1000962
771 JGI25163J39215_1000231
772 JGI25163J39215_1000241
773 JGI25164J39214_1000052
774 JGI25164J39214_1000179
775 JGI25165J46597_1000137
776 JGI25165J46597_1000327
777 Ga0055536_1000048
778 Ga0055536_1000435
779 Ga0055530_10002671
780 Ga0055530_10003214
781 Ga0055540_1000188
782 Ga0055540_1002370
783 Ga0055531_10000157
784 Ga0065714_10003013
785 Ga0065714_10003151
786 Ga0065714_10006703
787 Ga0065714_10208226
788 Ga0065704_10000835
789 Ga0065704_10086081
790 Ga0070669_100009132
791 Ga0070665_100072762
792 Ga0075364_10161810
793 Ga0075432_10008485
794 Ga0079104_1050257
795 Ga0105251_10001019
796 Ga0105251_10001758
797 Ga0105251_10002161
798 Ga0105251_10004811
799 Ga0105251_10004923
800 Ga0105251_10005556
801 Ga0105251_10018071
802 Ga0105251_10156959
803 Ga0105244_10001975
804 Ga0105244_10002055
805 Ga0105244_10004574
806 Ga0105244_10006384
807 Ga0105244_10018321
808 Ga0105244_10126749
809 Ga0105250_10001200
810 Ga0105250_10001966
811 Ga0105250_10178652
812 Ga0105247_10000027
813 Ga0105243_10000255
814 Ga0105243_10000341
815 Ga0105241_10000006
816 Ga0105249_10004670
817 Ga0105249_10139641
818 Ga0105246_10004752
819 Ga0105246_10012940
820 Ga0157345_1000030
821 Ga0157373_10003601
822 Ga0157373_10013342
823 Ga0157373_10025576
824 Ga0157373_10037366
825 Ga0157373_10046619
826 Ga0157373_10067213
827 Ga0157373_10525080
828 Ga0157371_10003523
829 Ga0157371_10004083
830 Ga0157371_10007503
831 Ga0157370_10085389
832 Ga0157370_10128442
833 Ga0157370_10213331
834 Ga0157370_10219279
835 Ga0157369_10061988
836 Ga0157369_10086879
837 Ga0163162_10000570
838 Ga0157375_10071773
839 Ga0182008_10000181
840 Ga0182008_10000781
841 Ga0182008_10000901
842 Ga0182006_1000569
843 Ga0182006_1001938
844 Ga0182006_1002434
845 Ga0182006_1037715
846 Ga0182006_1044051
847 Ga0182007_10005107
848 Ga0182007_10005289
849 Ga0182005_1000363
850 Ga0163161_10000036
851 Ga0163161_10012458
852 Ga0209760_100028
853 Ga0209760_100068
854 Ga0209563_100275
855 Ga0207427_100007
856 Ga0207427_100008
857 Ga0209437_100006
858 Ga0209437_100014
859 Ga0209233_1000008
860 Ga0209233_1000086
861 Ga0209675_1007237
862 Ga0209676_1000010
863 Ga0209676_1000109
864 Ga0209676_1007241
865 Ga0209050_1000019
866 Ga0209050_1000422
867 Ga0209051_1000106
868 Ga0209051_1000146
869 Ga0209257_1000040
870 Ga0209257_1013892
871 Ga0207696_1000014
872 Ga0207696_1000073
873 Ga0207696_1002272
874 Ga0207696_1047299
875 Ga0207655_1000019
876 Ga0207655_1000028
877 Ga0207655_1000351
878 Ga0207655_1001107
879 Ga0207655_1001138
880 Ga0207655_1002429
881 Ga0207655_1013141
882 Ga0207655_1067470
883 Ga0207655_1075705
884 Ga0207655_1078754
885 Ga0207713_1000181
886 Ga0207713_1000272
887 Ga0207713_1000625
888 Ga0207713_1000672
889 Ga0207713_1007034
890 Ga0207713_1010479
891 Ga0207713_1014292
892 Ga0207713_1037838
893 Ga0207713_1047557
894 Ga0207710_10000007
895 Ga0207654_10000008
896 Ga0207681_10027547
897 Ga0207706_10075264
898 Ga0207709_10000013
899 Ga0207709_10001214
900 Ga0209281_1000096
901 Ga0209281_1025140
902 Ga0207428_10141846
903 Ga0268266_10022500
904 Ga0316179_1033179
905 Ga0316178_1100242
906 Ga0316183_1063865
907 Ga0307408_100003088
908 Ga0307408_100006480
909 Ga0307408_100035061
910 Ga0307408_100068841
911 Ga0307405_10000856
912 Ga0307413_10139703
913 Ga0307413_10206330
914 Ga0307406_10002358
915 Ga0307407_10117024
916 Ga0307412_10000445
917 Ga0307412_10001049
918 Ga0307412_10001077
919 Ga0307412_10014124
920 Ga0307412_10438052
921 Ga0307412_10629337
922 Ga0307414_10225050
923 Ga0307411_10159201
924 Ga0307510_10019620
925 Ga0237819_01153
926 Ga0439438_001879
927 Ga0439438_011032
928 Ga0439447_000095
929 Ga0439447_006495
930 Ga0439447_010576
931 Ga0439447_013555
932 Ga0439447_014789
933 Ga0439447_037979
934 Ga0439466_0001344
935 Ga0439466_0005288
936 Ga0439466_0039608
937 Ga0439466_0053181
938 Ga0439466_0094545
939 Ga0439431_0001151
940 Ga0439442_025011
941 Ga0439445_0004284
942 Ga0439445_0030663
943 Ga0439432_000694
944 Ga0439432_003680
945 Ga0439432_007063
946 Ga0439432_014643
947 Ga0439451_001444
948 Ga0439451_015488
949 Ga0439451_029153
950 Ga0439452_000323
951 Ga0439452_000495
952 Ga0439452_001919
953 Ga0439452_009564
954 Ga0439452_015179
955 Ga0439456_003119
956 Ga0439456_005898
957 Ga0439456_006531
958 Ga0439456_006585
959 Ga0439456_015892
960 Ga0439456_016036
961 Ga0439456_045519
962 Ga0439463_002624
963 Ga0439463_022234
964 Ga0450911_000122
965 Ga0450911_010632
966 Ga0450922_007181
967 Ga0450890_000095
968 Ga0450900_007697
969 Ga0450902_003626
970 Ga0450902_009062
971 Ga0450903_003579
972 Ga0450903_015995
973 Ga0450903_016489
974 Ga0450905_000543
975 Ga0450906_000115
976 Ga0450906_016474
977 Ga0450907_000037
978 Ga0450907_001009
979 Ga0450910_002545
980 Ga0439446_0001890
981 Ga0439446_0027398
982 Ga0450908_018899
983 Ga0450909_000080
984 Ga0450909_000448
985 Ga0439434_0003785
986 Ga0439460_0066153
987 Ga0439440_0000608
988 Ga0495617_000252
989 Ga0495617_013886
990 Ga0495627_000017
991 Ga0495627_000098
992 Ga0495627_001052
993 Ga0495627_001626
994 Ga0495627_005327
995 Ga0495627_010790
996 Ga0495592_0413836
997 Ga0495603_0001346
998 Ga0495603_0033393
999 Ga0495590_0000673
1000 Ga0495590_0001254
1001 Ga0495591_000205
1002 Ga0495591_000297
1003 Ga0495591_000390
1004 Ga0495591_000656
1005 Ga0495591_000657
1006 Ga0495591_000931
1007 Ga0495591_003982
1008 Ga0495591_029996
1009 Ga0495629_0122349
1010 Ga0495638_0010935
1011 Ga0495638_0017897
1012 Ga0495638_0024832
1013 Ga0495638_0067975
1014 Ga0495653_0003162
1015 Ga0495653_0061391
1016 Ga0495650_0000392
1017 Ga0495650_0001870
1018 Ga0495650_0006807
1019 Ga0495650_0019978
1020 Ga0495605_0000506
1021 Ga0495605_0000816
1022 Ga0495605_0001814
1023 Ga0495605_0002082
1024 Ga0495605_0010331
1025 Ga0495605_0031303
1026 Ga0495605_0073514
1027 Ga0495639_0000174
1028 Ga0495639_0083633
1029 Ga0495584_0000355
1030 Ga0495584_0001099
1031 Ga0495584_0002010
1032 Ga0495584_0004781
1033 Ga0495584_0023387
1034 Ga0495585_0001351
1035 Ga0495585_0002857
1036 Ga0495585_0010270
1037 Ga0495585_0093463
1038 Ga0495594_0044104
1039 Ga0495596_0011480
1040 Ga0495607_0000288
1041 Ga0495607_0000570
1042 Ga0495607_0000655
1043 Ga0495607_0001835
1044 Ga0495607_0005380
1045 Ga0495607_0005477
1046 Ga0495607_0009375
1047 Ga0495607_0010404
1048 Ga0495607_0019440
1049 Ga0495607_0027208
1050 Ga0495607_0152529
1051 Ga0495583_0000978
1052 Ga0495583_0002209
1053 Ga0495583_0004160
1054 Ga0495583_0004562
1055 Ga0495583_0013805
1056 Ga0495583_0063214
1057 Ga0495606_0000086
1058 Ga0495606_0000151
1059 Ga0495606_0001371
1060 Ga0495606_0001659
1061 Ga0495606_0002967
1062 Ga0495606_0004756
1063 Ga0495606_0133287
1064 Ga0495610_0001166
1065 Ga0495610_0008813
1066 Ga0495610_0041657
1067 Ga0495616_0000522
1068 Ga0495616_0001715
1069 Ga0495616_0004132
1070 Ga0495616_0005893
1071 Ga0495616_0011113
1072 Ga0495616_0024489
1073 Ga0495620_0000452
1074 Ga0495620_0000981
1075 Ga0495620_0000992
1076 Ga0495620_0001545
1077 Ga0495620_0008742
1078 Ga0495630_0267330
1079 Ga0495630_0504701
1080 Ga0495631_0000141
1081 Ga0495631_0001289
1082 Ga0495631_0001499
1083 Ga0495631_0012305
1084 Ga0495631_0015525
1085 Ga0495631_0017102
1086 Ga0495632_0000836
1087 Ga0495632_0000880
1088 Ga0495632_0001034
1089 Ga0495632_0001217
1090 Ga0495632_0006768
1091 Ga0495632_0006890
1092 Ga0495632_0040292
1093 Ga0495632_0040730
1094 Ga0495632_0206149
1095 Ga0495637_0000032
1096 Ga0495637_0000090
1097 Ga0495637_0000187
1098 Ga0495637_0000419
1099 Ga0495637_0001091
1100 Ga0495637_0005841
1101 Ga0495643_0003097
1102 Ga0495643_0005265
1103 Ga0495643_0007754
1104 Ga0495643_0008147
1105 Ga0495643_0012979
1106 Ga0495643_0223136
1107 Ga0495648_0000956
1108 Ga0495648_0001327
1109 Ga0495648_0034569
1110 Ga0495648_0041169
1111 Ga0495648_0041194
1112 Ga0495648_0061311
1113 Ga0495648_0080626
1114 Ga0495648_0202448
1115 Ga0495666_0000676
1116 Ga0495666_0001886
1117 Ga0495666_0003370
1118 Ga0495666_0198192
1119 Ga0495642_0000268
1120 Ga0495654_0000568
1121 Ga0495654_0000980
1122 Ga0495654_0002908
1123 Ga0495654_0004675
1124 Ga0495654_0011975
1125 Ga0495654_0017331
1126 Ga0495654_0023868
1127 Ga0495654_0024533
1128 Ga0495586_0006948
1129 Ga0495586_0197706
1130 Ga0495587_0001070
1131 Ga0495587_0001117
1132 Ga0495609_0000040
1133 Ga0495609_0001802
1134 Ga0495609_0010733
1135 Ga0495609_0022313
1136 Ga0495609_0043081
1137 Ga0495597_0001263
1138 Ga0495597_0001594
1139 Ga0495597_0082262
1140 Ga0495597_0101659
1141 Ga0495622_0000862
1142 Ga0495622_0100727
1143 Ga0495633_0002836
1144 Ga0495633_0003536
1145 Ga0495633_0006942
1146 Ga0495633_0129992
1147 Ga0495656_0002970
1148 Ga0495668_0001921
1149 Ga0495634_0000547
1150 Ga0495611_0000238
1151 Ga0495611_0000379
1152 Ga0495611_0008014
1153 Ga0495611_0015877
1154 Ga0495625_0000247
1155 Ga0495625_0001482
1156 Ga0495625_0001656
1157 Ga0495625_0003173
1158 Ga0495625_0008376
1159 Ga0495625_0079762
1160 Ga0495625_0349744
1161 Ga0495625_0491070
1162 Ga0495635_0000507
1163 Ga0495635_0001340
1164 Ga0495659_0000177
1165 Ga0495659_0155728
1166 Ga0495661_0000019
1167 Ga0495661_0000469
1168 Ga0495661_0001896
1169 Ga0495661_0005495
1170 Ga0495661_0005892
1171 Ga0495661_0032580
1172 Ga0495588_0001628
1173 Ga0495588_0030482
1174 Ga0495623_0001025
1175 Ga0495623_0004894
1176 Ga0495646_0001334
1177 Ga0495646_0079543
1178 Ga0495646_0081128
1179 Ga0495669_0001709
1180 Ga0495669_0046937
1181 Ga0495613_0015187
1182 Ga0495613_0212431
1183 Ga0495624_0000407
1184 Ga0495670_0000161
1185 Ga0495670_0000555
1186 Ga0495670_0032108
1187 Ga0495670_0141195
1188 Ga0495671_0000307
1189 Ga0495671_0000515
1190 Ga0495671_0001888
1191 Ga0495671_0030362
1192 Ga0495671_0036922
1193 Ga0495671_0232367
1194 Ga0495649_0001032
1195 Ga0495649_0005387
1196 Ga0495649_0007115
1197 Ga0495649_0013890
1198 Ga0495649_0042541
1199 Ga0495649_0102477
1200 Ga0495649_0137160
1201 Ga0495589_0000068
1202 Ga0495589_0000401
1203 Ga0495589_0001127
1204 Ga0495589_0002944
1205 Ga0495589_0020420
1206 Ga0495589_0087444
1207 Ga0495600_0005465
1208 Ga0495600_0058511
1209 Ga0495660_0001781
1210 Ga0495660_0003302
1211 Ga0495660_0004628
1212 Ga0495660_0005074
1213 Ga0495660_0018117
1214 Ga0495660_0028887
1215 Ga0495660_0053510
1216 Ga0495604_0001252
1217 Ga0495604_0058652
1218 Ga0495636_0007195
1219 Ga0495674_0006958
1220 Ga0495672_0001048
1221 Ga0495672_0001711
1222 Ga0495672_0001906
1223 Ga0495672_0004627
1224 Ga0495672_0008895
1225 Ga0495672_0015064
1226 Ga0495672_0030504
1227 Ga0495672_0163563
1228 Ga0495676_0000010
1229 Ga0495676_0026968
1230 Ga0495676_0359175
1231 Ga0495680_0008447
1232 Ga0495680_0015130
1233 Ga0495680_0031542
1234 Ga0495680_0073538
1235 Ga0495683_0001298
1236 Ga0495683_0005115
1237 Ga0495683_0012278
1238 Ga0495683_0012451
1239 Ga0495683_0014402
1240 Ga0495683_0022033
1241 Ga0495683_0098473
1242 Ga0495687_002837
1243 Ga0495687_024999
1244 Ga0495675_0228495
1245 Ga0495677_0000538
1246 Ga0495679_004334
1247 Ga0495679_008569
1248 Ga0495679_012742
1249 Ga0495679_022021
1250 Ga0495685_078086
1251 Ga0495673_0000712
1252 Ga0495673_0000877
1253 Ga0495673_0002729
1254 Ga0495673_0003067
1255 Ga0495673_0003275
1256 Ga0495673_0004099
1257 Ga0495673_0005228
1258 Ga0495673_0012423
1259 Ga0495673_0021699
1260 Ga0495673_0025915
1261 Ga0495673_0031725
1262 Ga0495673_0036440
1263 Ga0495673_0066356
1264 Ga0495673_0071632
1265 Ga0495681_0002707
1266 Ga0495681_0003703
1267 Ga0495681_0005396
1268 Ga0495681_0005615
1269 Ga0495681_0009154
1270 Ga0495681_0017168
1271 Ga0495684_0018935
1272 Ga0495686_0001583
1273 Ga0495593_0000399
1274 Ga0495593_0001659
1275 Ga0495593_0002660
1276 Ga0495593_0147958
1277 Ga0495602_0001276
1278 Ga0495626_0000013
1279 Ga0495626_0000790
1280 Ga0495626_0000964
1281 Ga0495626_0002584
1282 Ga0495626_0003031
1283 Ga0495626_0008201
1284 Ga0495626_0012661
1285 Ga0495626_0051767
1286 Ga0496102_0000428
1287 Ga0496102_0551375
1288 Ga0496103_0001915
1289 Ga0496103_0037361
1290 Ga0496107_0207218
1291 Ga0496112_0096650
1292 Ga0496115_0075545
1293 Ga0496116_0000009
1294 Ga0496116_0000560
1295 Ga0496116_0004175
1296 Ga0496116_0005517
1297 Ga0496116_0009945
1298 Ga0496116_0024984
1299 Ga0496116_0115918
1300 Ga0496116_0225734
1301 Ga0496116_0264027
1302 Ga0496117_0000100
1303 Ga0496117_0000792
1304 Ga0496117_0003774
1305 Ga0496117_0013952
1306 Ga0496117_0018977
1307 Ga0496117_0031000
1308 Ga0496117_0113864
1309 Ga0496117_0155009
1310 Ga0496118_0006448
1311 Ga0496118_0014953
1312 Ga0496118_0039390
1313 Ga0496118_0061552
1314 Ga0496118_0134350
1315 Ga0496119_0000741
1316 Ga0496119_0001453
1317 Ga0496119_0005386
1318 Ga0496119_0018195
1319 Ga0496119_0033206
1320 Ga0496120_0000389
1321 Ga0496120_0000572
1322 Ga0496120_0006022
1323 Ga0496120_0134776
1324 Ga0496121_0000145
1325 Ga0496121_0001037
1326 Ga0496121_0002877
1327 Ga0496121_0049476
1328 Ga0496121_0095183
1329 Ga0496121_0284285
1330 Ga0496122_0000029
1331 Ga0496122_0002535
1332 Ga0496122_0003856
1333 Ga0496122_0011476
1334 Ga0496122_0024277
1335 Ga0496123_0000216
1336 Ga0496123_0005776
1337 Ga0496123_0009492
1338 Ga0496123_0038556
1339 Ga0496123_0083192
1340 Ga0496124_0000053
1341 Ga0496124_0001263
1342 Ga0496124_0039621
1343 Ga0496124_0061300
1344 Ga0496124_0154355
1345 Ga0496124_0217998
1346 Ga0496125_0001051
1347 Ga0496125_0001102
1348 Ga0496125_0013998
1349 Ga0496125_0059461
1350 Ga0496125_0194399
1351 Ga0496126_0078086
1352 Ga0496126_0095622
1353 Ga0495678_000897
1354 Ga0495678_001684
1355 Ga0495678_001821
1356 Ga0495678_001928
1357 Ga0495678_003252
1358 Ga0495678_004218
1359 Ga0495678_006650
1360 Ga0495678_009813
1361 Ga0495678_010574
1362 Ga0495678_011115
1363 Ga0495678_048802
1364 Ga0495678_091980
1365 Ga0495682_0001166
1366 Ga0495682_0005391
1367 Ga0495682_0006879
1368 Ga0495682_0011368
1369 Ga0495682_0012104
1370 Ga0495682_0016860
1371 Ga0495682_0019612
1372 Ga0495682_0102497
1373 Ga0495682_0104378
1374 Ga0495682_0109358
1375 Ga0501222_005236
1376 Ga0501227_027787
1377 Ga0501240_000135
1378 Ga0501241_000180
1379 Ga0501269_000845
1380 Ga0501226_004873
1381 nmdc:mga00v17_145139_c1
1382 2506580591
1383 2506585730
1384 2511254528
1385 2511270092
1386 2511287862
1387 2511294877
1388 2511326486
1389 2511341219
1390 2511343460
1391 2511363060
1392 2511370759
1393 2511412850
1394 2511826498
1395 2512329487
1396 2555671544
1397 2583794030
1398 2599354298
1399 2599359988
1400 2599366310
1401 2599373100
1402 2599379406
1403 2599385616
1404 2599391959
1405 2599403725
1406 2599461132
1407 2599469674
1408 2599490152
1409 2599503454
1410 2599613402
1411 2599771074
1412 2599886222
1413 2599897937
1414 2599905708
1415 2599929790
1416 2599945928
1417 2599956910
1418 2599960251
1419 2599969140
1420 2599980446
1421 2599983538
1422 2599989945
1423 2599995778
1424 2600000423
1425 2600005099
1426 2600014299
1427 2600017751
1428 2600026654
1429 2600028608
1430 2600033730
1431 2600047745
1432 2600056490
1433 2600058944
1434 2600070177
1435 2600078062
1436 2600213747
1437 2600357776
1438 2601773915
1439 2601796572
1440 2606073722
1441 2606126634
1442 2624482271
1443 2624490679
1444 2643981544
1445 2644186405
1446 2644281993
1447 2644365085
1448 2656276336
1449 2671090030
1450 2671096879
1451 2671125334
1452 2678264838
1453 2689447145
1454 2715750274
1455 2715760183
1456 2718635464
1457 2739316620
1458 2743739160
1459 2745005292
1460 2772440947
1461 2774122373
1462 2774133156
1463 2784262988
1464 2784316211
1465 2794595848
1466 2808931449
1467 2808953571
1468 2808961716
1469 2809035451
1470 2819655949
1471 2819701972
1472 2825656265
1473 2842837144
1474 2842844934
1475 2842856665
1476 2844672071
1477 2852661224
1478 2857541164
1479 2858953337
1480 2860341126
1481 2878034198
1482 2880234817
1483 2888371054
1484 2888376246
1485 2904521047
1486 2913041439
1487 2917075414
1488 2919066740
1489 2919388290
1490 2919459226
1491 2919484374
1492 2919489517
1493 2919701876
1494 2923158242
1495 2923591254
1496 2928516036
1497 2929148779
1498 2931373797
1499 2935356400
1500 2937971212
1501 2939655556
1502 2941483651
1503 2945965430
1504 2969308980
1505 2974289644
1506 2998144276
1507 3007397537
1508 3007516034
1509 3007615260
1510 3007621723
1511 3007720994
1512 3007865717
1513 3007867876
1514 637321865
1515 8004593853
1516 8015397080
1517 8015692339
1518 8019774984
1519 8019780598
1520 8029996602
1521 8055775549
1522 8056144620
1523 8056159275
1524 8056166986
1525 8056574019
1526 8057804409

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

173

203

0.97

PF12833

HTH_18

Helix-turn-helix domain

175

253

0.97

PF02311

AraC_binding

AraC-like ligand binding domain

15

138

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yhf-assembly1.cif.gz_A crystal structure of conserved spy1581 protein of unknown function from streptococcus pyogenes 0.9086 14 88
3rns-assembly1.cif.gz_A cupin 2 conserved barrel domain protein from leptotrichia buccalis 0.9056 15 87
6o2d-assembly1.cif.gz_A schizosaccharomyces pombe cnp3 cupin domain 0.9006 13 87
5fpz-assembly1.cif.gz_A-2 the structure of kdgf from yersinia enterocolitica with malonate bound in the active site. 0.9003 15 87
4la3-assembly2.cif.gz_B crystal structure of dimethylsulphoniopropionate (dmsp) lyase dddq y131a in complex with dmsp 0.8984 15 89
ID Description Score Start End Superfamily
af_P76241_154_259_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.927 144 247 1.10.10.60
1bl0A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9261 205 246 1.10.10.60
4cugB01 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9087 20 87 2.60.120.650
af_P76241_154_259_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9025 144 247 1.10.10.60
1xs9A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8988 205 249 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7H4LZ53-F1-model_v4 Transcriptional regulator 0.9528 145 250 GO:0003700
GO:0043565
AF-A0A2E7BK25-F1-model_v4 Cupin 0.9525 15 87
AF-A0A3D3BA68-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9456 144 247 GO:0003700
GO:0043565
AF-X1VV43-F1-model_v4 Cupin type-2 domain-containing protein 0.944 15 86
AF-A0A2X3IHJ4-F1-model_v4 HTH-type transcriptional repressor of iron proteins A 0.9403 143 247 GO:0003700
GO:0043565

Map