F479705

General Info

Members Datasets Scaffolds Average Seq Length
763 412 1526 282

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0087911|Ga0496104_0087911_1416_2264
Length 282
Sequence MPTVAEKRASYRRLHESGCFIIPNPWDIGTARYLQGLGFKALASTSAGFAFTLGLTDGAVTRDQMLAHFRELAAATDVPINADFEGGYADAPEDVAESVRLCIDTGVAGLSIEDCGDPTVPIYDFDLALARVRAARAAIDKAGGDVVFTARSEGFIRGRPDLAETIRRLKAFADAGADCLYAPGIKTREEIAAVVEAVAPKPVNFLMASTTDYTVNDLAGLGVRRISLGGTLARAAWTALNRSAREMIEDGKFTRLAGNMTNAELNAFFRSDMIKRAPTTAK

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
10 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
15 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
16 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
17 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
18 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
19 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
20 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
65 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
70 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
71 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
72 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
89 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
90 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
91 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
95 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
96 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
99 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
102 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
103 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
104 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
105 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
106 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
146 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
214 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
222 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
223 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
224 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
225 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
226 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
227 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
228 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
229 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
230 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
231 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
232 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
233 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
234 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
235 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
236 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
237 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
238 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
239 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
240 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
241 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
242 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
243 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
244 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
245 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
246 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
247 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
248 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
249 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
250 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
251 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
252 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
253 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
254 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
255 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
256 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
257 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
258 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
259 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
260 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
261 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
262 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
263 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
264 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
265 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
266 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
267 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
268 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
270 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
271 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
272 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
273 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
274 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
275 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
276 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
277 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
278 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
279 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
280 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
281 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
282 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
283 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
284 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
285 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
286 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
287 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
288 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
289 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
290 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
291 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
292 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
293 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
294 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
295 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
296 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
297 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
298 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
299 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
300 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
301 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
302 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
303 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
304 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
305 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
306 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
307 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
308 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
309 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
310 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
311 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
312 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
313 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
314 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
315 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
316 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
317 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
318 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
319 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
320 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
321 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
322 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
323 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
324 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
325 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
326 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
327 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
328 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
329 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
330 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
331 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
332 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
333 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
334 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
335 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
336 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
337 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
338 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
339 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
340 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
341 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
342 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
343 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
344 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
345 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
346 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
347 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
348 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
349 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
350 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
351 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
366 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
367 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
368 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
369 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
370 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
371 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
372 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
373 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
374 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
375 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
376 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
377 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
378 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
379 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
382 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
383 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
384 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
385 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
386 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
387 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
388 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
389 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
390 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
391 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
392 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
393 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
394 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
395 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
396 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
397 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
398 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
399 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
400 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
401 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
402 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
403 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
404 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
405 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
406 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
407 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
408 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
409 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
410 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
411 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
412 2919513703 Luteimonas sp. 3794 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.13
Isolates 0.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.33
Nodule 0.13
Rhizoplane 6.95
Rhizosphere 88.47
Stem 0
Stem Tuber 0
Unclassified 0.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0087911 3300048907 Bacteria 2968
2 2214856314 2209111006 Bacteria 8020
3 ARcpr5oldR_c000046 3300000041 Bacteria 22854
4 ARSoilYngRDRAFT_c00078 3300000042 Bacteria 16119
5 ARcpr5yngRDRAFT_c000072 3300000043 Bacteria 16816
6 ARSoilOldRDRAFT_c000019 3300000044 Bacteria 37577
7 ARCol0oldRDRAFT_c00019 3300000045 Bacteria 12070
8 ARCol0yngRDRAFT_1000004 3300000652 Bacteria 52222
9 JGI24752J21851_1005278 3300001976 Bacteria 1688
10 JGI24746J21847_1000147 3300001977 Bacteria 8859
11 JGI24740J21852_10029269 3300001979 Bacteria 1810
12 JGI24739J22299_10035498 3300001989 Bacteria 1689
13 JGI24737J22298_10000207 3300001990 Bacteria 19137
14 JGI24737J22298_10001119 3300001990 Bacteria 9430
15 JGI24750J21931_1000430 3300002070 Bacteria 6827
16 JGI24745J21846_1000298 3300002073 Bacteria 4246
17 JGI24744J21845_10003456 3300002077 Bacteria 3249
18 JGI24035J26624_1001932 3300002126 Bacteria 1929
19 JGI24034J26672_10000880 3300002239 Bacteria 3907
20 JGI24742J22300_10000483 3300002244 Bacteria 5928
21 JGI25405J52794_10000722 3300003911 Bacteria 5036
22 Ga0065716_1001709 3300005277 Bacteria 4000
23 Ga0065704_10075977 3300005289 Bacteria 5320
24 Ga0065712_10026946 3300005290 Bacteria 1130
25 Ga0070658_10103773 3300005327 Bacteria 2351
26 Ga0070676_10001460 3300005328 Bacteria 11953
27 Ga0070683_100001872 3300005329 Bacteria 16425
28 Ga0070690_100075162 3300005330 Bacteria 2202
29 Ga0070690_100088287 3300005330 Bacteria 2038
30 Ga0070670_100099847 3300005331 Bacteria 2498
31 Ga0070677_10000429 3300005333 Bacteria 14486
32 Ga0068869_100004944 3300005334 Bacteria 8338
33 Ga0070666_10063868 3300005335 Bacteria 2496
34 Ga0070666_10120678 3300005335 Bacteria 1818
35 Ga0070680_100018787 3300005336 Bacteria 5470
36 Ga0070680_100028819 3300005336 Bacteria 4455
37 Ga0070680_100054443 3300005336 Bacteria 3267
38 Ga0070680_100107387 3300005336 Bacteria 2322
39 Ga0070682_100000695 3300005337 Bacteria 20200
40 Ga0068868_100004036 3300005338 Bacteria 10230
41 Ga0070660_100006096 3300005339 Bacteria 8336
42 Ga0070660_100274442 3300005339 Bacteria 1379
43 Ga0070689_100007446 3300005340 Bacteria 7654
44 Ga0070689_100012268 3300005340 Bacteria 6167
45 Ga0070691_10178457 3300005341 Bacteria 1104
46 Ga0070687_100005997 3300005343 Bacteria 4950
47 Ga0070687_100025536 3300005343 Bacteria 2836
48 Ga0070661_100003765 3300005344 Bacteria 10460
49 Ga0070661_100011491 3300005344 Bacteria 6167
50 Ga0070692_10037528 3300005345 Bacteria 2463
51 Ga0070669_100015276 3300005353 Bacteria 5470
52 Ga0070675_100000240 3300005354 Bacteria 35499
53 Ga0070675_100480099 3300005354 Bacteria 1118
54 Ga0070671_100027986 3300005355 Bacteria 4641
55 Ga0070671_100043817 3300005355 Bacteria 3719
56 Ga0070671_100079018 3300005355 Bacteria 2749
57 Ga0070671_100374449 3300005355 Bacteria 1216
58 Ga0070674_100037934 3300005356 Bacteria 3244
59 Ga0070673_100019462 3300005364 Bacteria 4872
60 Ga0070673_100298793 3300005364 Bacteria 1417
61 Ga0070688_100001905 3300005365 Bacteria 10468
62 Ga0070688_100012599 3300005365 Bacteria 4740
63 Ga0070659_100009275 3300005366 Bacteria 7224
64 Ga0070659_100391940 3300005366 Bacteria 1171
65 Ga0070667_100020849 3300005367 Bacteria 5443
66 Ga0070667_100139401 3300005367 Bacteria 2123
67 Ga0070703_10005021 3300005406 Bacteria 3693
68 Ga0070709_10261556 3300005434 Bacteria 1250
69 Ga0070714_100136832 3300005435 Bacteria 2195
70 Ga0070714_100484767 3300005435 Bacteria 1178
71 Ga0070713_100064600 3300005436 Bacteria 3072
72 Ga0070713_100196757 3300005436 Bacteria 1818
73 Ga0070713_100324212 3300005436 Bacteria 1423
74 Ga0070713_100718215 3300005436 Bacteria 955
75 Ga0070710_10050972 3300005437 Bacteria 2322
76 Ga0070701_10006689 3300005438 Bacteria 4867
77 Ga0070711_100051872 3300005439 Bacteria 2820
78 Ga0070705_100000768 3300005440 Bacteria 18121
79 Ga0070705_100135048 3300005440 Bacteria 1615
80 Ga0070700_100017267 3300005441 Bacteria 4122
81 Ga0070700_100134339 3300005441 Bacteria 1673
82 Ga0070708_100011083 3300005445 Bacteria 7325
83 Ga0070678_100000998 3300005456 Bacteria 14672
84 Ga0070678_100011827 3300005456 Bacteria 5399
85 Ga0070678_100165405 3300005456 Bacteria 1796
86 Ga0070662_100053268 3300005457 Bacteria 2928
87 Ga0070662_100080454 3300005457 Bacteria 2425
88 Ga0070662_100091293 3300005457 Bacteria 2287
89 Ga0070681_10003430 3300005458 Bacteria 14849
90 Ga0070681_10019515 3300005458 Bacteria 6787
91 Ga0070681_10023877 3300005458 Bacteria 6155
92 Ga0070681_10153481 3300005458 Bacteria 2228
93 Ga0070681_10287479 3300005458 Bacteria 1554
94 Ga0068867_100046736 3300005459 Bacteria 3180
95 Ga0068867_100234231 3300005459 Bacteria 1486
96 Ga0070685_10032994 3300005466 Bacteria 2904
97 Ga0070707_100159426 3300005468 Bacteria 2198
98 Ga0070707_100638270 3300005468 Bacteria 1027
99 Ga0070699_100021616 3300005518 Bacteria 5549
100 Ga0070699_100509179 3300005518 Bacteria 1094
101 Ga0070679_100016730 3300005530 Bacteria 7086
102 Ga0070679_100027185 3300005530 Bacteria 5628
103 Ga0070679_100041157 3300005530 Bacteria 4599
104 Ga0070679_100062932 3300005530 Bacteria 3698
105 Ga0070679_100076059 3300005530 Bacteria 3347
106 Ga0068853_100009924 3300005539 Bacteria 7687
107 Ga0070672_100001847 3300005543 Bacteria 13222
108 Ga0070686_100010163 3300005544 Bacteria 5296
109 Ga0070695_100057834 3300005545 Bacteria 2506
110 Ga0070696_100032893 3300005546 Bacteria 3559
111 Ga0070693_100009660 3300005547 Bacteria 4802
112 Ga0070693_100018497 3300005547 Bacteria 3641
113 Ga0070704_100025492 3300005549 Bacteria 3894
114 Ga0068855_100014855 3300005563 Bacteria 9377
115 Ga0068855_100017390 3300005563 Bacteria 8651
116 Ga0068855_100053133 3300005563 Bacteria 4767
117 Ga0068855_100419910 3300005563 Bacteria 1463
118 Ga0070664_100001002 3300005564 Bacteria 22163
119 Ga0070664_100169038 3300005564 Bacteria 1939
120 Ga0068857_100026858 3300005577 Bacteria 5076
121 Ga0068854_100257832 3300005578 Bacteria 1395
122 Ga0068856_100093029 3300005614 Bacteria 3000
123 Ga0068856_100154215 3300005614 Bacteria 2307
124 Ga0068859_100010808 3300005617 Bacteria 9190
125 Ga0068859_100049776 3300005617 Bacteria 4209
126 Ga0068864_100003922 3300005618 Bacteria 12254
127 Ga0068864_100119693 3300005618 Bacteria 2353
128 Ga0068866_10007131 3300005718 Bacteria 4673
129 Ga0068861_100003710 3300005719 Bacteria 10192
130 Ga0068870_10000157 3300005840 Bacteria 23872
131 Ga0068863_100000674 3300005841 Bacteria 34508
132 Ga0068858_100357365 3300005842 Bacteria 1400
133 Ga0068858_100477792 3300005842 Bacteria 1203
134 Ga0068860_100012435 3300005843 Bacteria 8381
135 Ga0068860_100446805 3300005843 Bacteria 1285
136 Ga0068860_100553145 3300005843 Bacteria 1153
137 Ga0068862_100024284 3300005844 Bacteria 5085
138 Ga0081455_10000059 3300005937 Bacteria 119148
139 Ga0081455_10002427 3300005937 Bacteria 22238
140 Ga0081455_10003542 3300005937 Bacteria 17909
141 Ga0081455_10077103 3300005937 Bacteria 2743
142 Ga0081455_10083520 3300005937 Bacteria 2610
143 Ga0081455_10094624 3300005937 Bacteria 2413
144 Ga0081538_10024573 3300005981 Bacteria 4288
145 Ga0081540_1002311 3300005983 Bacteria 15633
146 Ga0081540_1008452 3300005983 Bacteria 7190
147 Ga0075365_10125079 3300006038 Bacteria 1776
148 Ga0075363_100063262 3300006048 Bacteria 1997
149 Ga0075364_10305847 3300006051 Bacteria 1082
150 Ga0075432_10006219 3300006058 Bacteria 4059
151 Ga0070716_100049144 3300006173 Bacteria 2388
152 Ga0075362_10182437 3300006177 Bacteria 1017
153 Ga0075367_10077830 3300006178 Bacteria 2002
154 Ga0075367_10134447 3300006178 Bacteria 1529
155 Ga0075427_10000100 3300006194 Bacteria 7234
156 Ga0075366_10015817 3300006195 Bacteria 4332
157 Ga0075366_10120861 3300006195 Bacteria 1578
158 Ga0097621_100001613 3300006237 Bacteria 15457
159 Ga0097621_100064907 3300006237 Bacteria 3003
160 Ga0075370_10003389 3300006353 Bacteria 7574
161 Ga0068871_100001066 3300006358 Bacteria 18401
162 Ga0068871_100039344 3300006358 Bacteria 3783
163 Ga0075428_100038761 3300006844 Bacteria 5244
164 Ga0075430_100000070 3300006846 Bacteria 55805
165 Ga0075431_100001221 3300006847 Bacteria 23276
166 Ga0075433_10010476 3300006852 Bacteria 7442
167 Ga0075433_10084490 3300006852 Bacteria 2802
168 Ga0075433_10219988 3300006852 Bacteria 1687
169 Ga0075434_100000212 3300006871 Bacteria 39628
170 Ga0075434_100027125 3300006871 Bacteria 5621
171 Ga0075434_100037805 3300006871 Bacteria 4778
172 Ga0075434_100228079 3300006871 Bacteria 1882
173 Ga0075434_100267256 3300006871 Bacteria 1729
174 Ga0075434_100404868 3300006871 Bacteria 1385
175 Ga0075429_100003999 3300006880 Bacteria 12622
176 Ga0068865_100000131 3300006881 Bacteria 38862
177 Ga0068865_100521410 3300006881 Bacteria 994
178 Ga0075436_100174916 3300006914 Bacteria 1516
179 Ga0097620_100010810 3300006931 Bacteria 9190
180 Ga0097620_100049776 3300006931 Bacteria 4209
181 Ga0075435_100029738 3300007076 Bacteria 4289
182 Ga0075435_100034976 3300007076 Bacteria 3985
183 Ga0075435_100102816 3300007076 Bacteria 2369
184 Ga0105240_10006508 3300009093 Bacteria 17159
185 Ga0105240_10071446 3300009093 Bacteria 4292
186 Ga0105240_10099393 3300009093 Bacteria 3541
187 Ga0111539_10000138 3300009094 Bacteria 82968
188 Ga0111539_10004385 3300009094 Bacteria 18464
189 Ga0111539_10079599 3300009094 Bacteria 3855
190 Ga0111539_10091965 3300009094 Bacteria 3565
191 Ga0111539_10196316 3300009094 Bacteria 2354
192 Ga0105245_10003161 3300009098 Bacteria 14721
193 Ga0105247_10005112 3300009101 Bacteria 8310
194 Ga0114129_10002312 3300009147 Bacteria 26434
195 Ga0114129_10003950 3300009147 Bacteria 20934
196 Ga0114129_10327161 3300009147 Bacteria 2036
197 Ga0105243_10006299 3300009148 Bacteria 9170
198 Ga0105243_10249021 3300009148 Bacteria 1585
199 Ga0105243_10399372 3300009148 Bacteria 1276
200 Ga0105241_10112491 3300009174 Bacteria 2181
201 Ga0105241_10118149 3300009174 Bacteria 2132
202 Ga0105242_10021762 3300009176 Bacteria 5038
203 Ga0105242_10079779 3300009176 Bacteria 2734
204 Ga0105242_10119834 3300009176 Bacteria 2256
205 Ga0105242_10288138 3300009176 Bacteria 1494
206 Ga0105248_10012777 3300009177 Bacteria 9265
207 Ga0105248_10013552 3300009177 Bacteria 8976
208 Ga0105248_10137748 3300009177 Bacteria 2753
209 Ga0105248_10267044 3300009177 Bacteria 1926
210 Ga0105237_10042427 3300009545 Bacteria 4587
211 Ga0105238_10099595 3300009551 Bacteria 2889
212 Ga0105249_10001029 3300009553 Bacteria 24663
213 Ga0105249_10515811 3300009553 Bacteria 1242
214 Ga0105239_10026090 3300010375 Bacteria 6433
215 Ga0105239_10161641 3300010375 Bacteria 2502
216 Ga0105239_10365407 3300010375 Bacteria 1630
217 Ga0105246_10021818 3300011119 Bacteria 4125
218 Ga0157338_1001989 3300012515 Bacteria 1552
219 Ga0157373_10133539 3300013100 Bacteria 1745
220 Ga0157371_10028313 3300013102 Bacteria 4058
221 Ga0157371_10177826 3300013102 Bacteria 1521
222 Ga0157370_10023866 3300013104 Bacteria 6065
223 Ga0157370_10030329 3300013104 Bacteria 5299
224 Ga0157369_10228420 3300013105 Bacteria 1946
225 Ga0157369_10706209 3300013105 Bacteria 1038
226 Ga0157374_10000671 3300013296 Bacteria 30150
227 Ga0157374_10032272 3300013296 Bacteria 4766
228 Ga0157378_10011261 3300013297 Bacteria 7825
229 Ga0157378_10108997 3300013297 Bacteria 2536
230 Ga0157378_10127274 3300013297 Bacteria 2354
231 Ga0163162_10118369 3300013306 Bacteria 2751
232 Ga0163162_10277868 3300013306 Bacteria 1807
233 Ga0163162_10568887 3300013306 Bacteria 1261
234 Ga0157372_10018229 3300013307 Bacteria 7546
235 Ga0157372_10104676 3300013307 Bacteria 3236
236 Ga0157375_10002908 3300013308 Bacteria 14847
237 Ga0157375_10308323 3300013308 Bacteria 1747
238 Ga0157375_10311584 3300013308 Bacteria 1738
239 Ga0163163_10004312 3300014325 Bacteria 12118
240 Ga0163163_10029813 3300014325 Bacteria 5250
241 Ga0163163_10128579 3300014325 Bacteria 2572
242 Ga0157380_10000678 3300014326 Bacteria 21096
243 Ga0157380_10206765 3300014326 Bacteria 1746
244 Ga0157377_10000570 3300014745 Bacteria 15436
245 Ga0157379_10000345 3300014968 Bacteria 37352
246 Ga0157379_10219812 3300014968 Bacteria 1721
247 Ga0157376_10265642 3300014969 Bacteria 1610
248 Ga0157376_10280387 3300014969 Bacteria 1569
249 Ga0163161_10004669 3300017792 Bacteria 9525
250 Ga0163161_10224060 3300017792 Bacteria 1457
251 Ga0206353_10147817 3300020082 Bacteria 1919
252 Ga0207666_1000069 3300025271 Bacteria 17953
253 Ga0207666_1001466 3300025271 Bacteria 2784
254 Ga0207673_1000549 3300025290 Bacteria 3978
255 Ga0209675_1004054 3300025291 Bacteria 6669
256 Ga0209256_1000045 3300025299 Bacteria 325506
257 Ga0207697_10000390 3300025315 Bacteria 24639
258 Ga0207653_10002299 3300025885 Bacteria 6103
259 Ga0207682_10000048 3300025893 Bacteria 50998
260 Ga0207692_10029365 3300025898 Bacteria 2612
261 Ga0207642_10002027 3300025899 Bacteria 6251
262 Ga0207688_10001496 3300025901 Bacteria 12264
263 Ga0207680_10208314 3300025903 Bacteria 1335
264 Ga0207647_10032839 3300025904 Bacteria 3330
265 Ga0207647_10056078 3300025904 Bacteria 2418
266 Ga0207685_10015948 3300025905 Bacteria 2393
267 Ga0207699_10271867 3300025906 Bacteria 1175
268 Ga0207645_10003506 3300025907 Bacteria 11875
269 Ga0207643_10000581 3300025908 Bacteria 23180
270 Ga0207705_10124581 3300025909 Bacteria 1914
271 Ga0207684_10384841 3300025910 Bacteria 1206
272 Ga0207654_10031795 3300025911 Bacteria 2910
273 Ga0207707_10020384 3300025912 Bacteria 5789
274 Ga0207707_10036943 3300025912 Bacteria 4269
275 Ga0207707_10132172 3300025912 Bacteria 2182
276 Ga0207707_10147968 3300025912 Bacteria 2053
277 Ga0207707_10191324 3300025912 Bacteria 1785
278 Ga0207707_10381513 3300025912 Bacteria 1211
279 Ga0207695_10015353 3300025913 Bacteria 9018
280 Ga0207695_10265289 3300025913 Bacteria 1614
281 Ga0207671_10011618 3300025914 Bacteria 7146
282 Ga0207671_10243523 3300025914 Bacteria 1413
283 Ga0207693_10011653 3300025915 Bacteria 7112
284 Ga0207693_10501736 3300025915 Bacteria 947
285 Ga0207663_10034354 3300025916 Bacteria 3031
286 Ga0207663_10040903 3300025916 Bacteria 2821
287 Ga0207660_10000192 3300025917 Bacteria 38947
288 Ga0207660_10024327 3300025917 Bacteria 4100
289 Ga0207660_10040340 3300025917 Bacteria 3268
290 Ga0207660_10073202 3300025917 Bacteria 2497
291 Ga0207660_10075156 3300025917 Bacteria 2467
292 Ga0207662_10000647 3300025918 Bacteria 15732
293 Ga0207662_10025033 3300025918 Bacteria 3436
294 Ga0207657_10011619 3300025919 Bacteria 8731
295 Ga0207657_10028107 3300025919 Bacteria 5138
296 Ga0207657_10030467 3300025919 Bacteria 4897
297 Ga0207657_10038177 3300025919 Bacteria 4279
298 Ga0207657_10280269 3300025919 Bacteria 1323
299 Ga0207649_10000141 3300025920 Bacteria 60047
300 Ga0207649_10003097 3300025920 Bacteria 9127
301 Ga0207652_10001526 3300025921 Bacteria 20428
302 Ga0207652_10100407 3300025921 Bacteria 2554
303 Ga0207652_10242138 3300025921 Bacteria 1626
304 Ga0207681_10000359 3300025923 Bacteria 32485
305 Ga0207681_10010524 3300025923 Bacteria 5666
306 Ga0207694_10252881 3300025924 Bacteria 1442
307 Ga0207650_10030348 3300025925 Bacteria 3893
308 Ga0207659_10000052 3300025926 Bacteria 79692
309 Ga0207659_10396364 3300025926 Bacteria 1154
310 Ga0207687_10000097 3300025927 Bacteria 64441
311 Ga0207687_10088253 3300025927 Bacteria 2256
312 Ga0207700_10044558 3300025928 Bacteria 3267
313 Ga0207700_10277715 3300025928 Bacteria 1440
314 Ga0207664_10021449 3300025929 Bacteria 4804
315 Ga0207664_10098664 3300025929 Bacteria 2409
316 Ga0207644_10002956 3300025931 Bacteria 10949
317 Ga0207644_10041797 3300025931 Bacteria 3245
318 Ga0207644_10053055 3300025931 Bacteria 2917
319 Ga0207644_10272389 3300025931 Bacteria 1357
320 Ga0207690_10000278 3300025932 Bacteria 36244
321 Ga0207690_10048562 3300025932 Bacteria 2823
322 Ga0207706_10032964 3300025933 Bacteria 4610
323 Ga0207706_10036851 3300025933 Bacteria 4344
324 Ga0207706_10054827 3300025933 Bacteria 3517
325 Ga0207686_10000850 3300025934 Bacteria 18532
326 Ga0207686_10023021 3300025934 Bacteria 3594
327 Ga0207709_10000349 3300025935 Bacteria 47453
328 Ga0207709_10032016 3300025935 Bacteria 3077
329 Ga0207709_10121451 3300025935 Bacteria 1764
330 Ga0207709_10271793 3300025935 Bacteria 1248
331 Ga0207670_10000781 3300025936 Bacteria 16732
332 Ga0207670_10010975 3300025936 Bacteria 5236
333 Ga0207670_10128099 3300025936 Bacteria 1855
334 Ga0207669_10000168 3300025937 Bacteria 30867
335 Ga0207669_10127559 3300025937 Bacteria 1741
336 Ga0207704_10000704 3300025938 Bacteria 14739
337 Ga0207704_10332161 3300025938 Bacteria 1177
338 Ga0207665_10050654 3300025939 Bacteria 2793
339 Ga0207665_10302955 3300025939 Bacteria 1195
340 Ga0207691_10003348 3300025940 Bacteria 15596
341 Ga0207711_10006180 3300025941 Bacteria 10120
342 Ga0207689_10025744 3300025942 Bacteria 4929
343 Ga0207661_10000143 3300025944 Bacteria 45329
344 Ga0207679_10000035 3300025945 Bacteria 144173
345 Ga0207667_10023138 3300025949 Bacteria 6844
346 Ga0207667_10025196 3300025949 Bacteria 6516
347 Ga0207651_10000080 3300025960 Bacteria 42826
348 Ga0207651_10207083 3300025960 Bacteria 1576
349 Ga0207712_10003380 3300025961 Bacteria 10087
350 Ga0207668_10005342 3300025972 Bacteria 7557
351 Ga0207640_10001402 3300025981 Bacteria 13012
352 Ga0207640_10520390 3300025981 Bacteria 994
353 Ga0207658_10162981 3300025986 Bacteria 1829
354 Ga0207677_10000614 3300026023 Bacteria 21876
355 Ga0207703_10021848 3300026035 Bacteria 5010
356 Ga0207703_10153578 3300026035 Bacteria 2010
357 Ga0207639_10021338 3300026041 Bacteria 4651
358 Ga0207678_10005116 3300026067 Bacteria 11764
359 Ga0207708_10008117 3300026075 Bacteria 7775
360 Ga0207708_10020985 3300026075 Bacteria 4929
361 Ga0207702_10001956 3300026078 Bacteria 20052
362 Ga0207702_10148331 3300026078 Bacteria 2131
363 Ga0207702_10801476 3300026078 Bacteria 931
364 Ga0207641_10109878 3300026088 Bacteria 2442
365 Ga0207641_10478868 3300026088 Bacteria 1206
366 Ga0207648_10013365 3300026089 Bacteria 7641
367 Ga0207676_10001840 3300026095 Bacteria 15541
368 Ga0207676_10062045 3300026095 Bacteria 2963
369 Ga0207676_10097383 3300026095 Bacteria 2430
370 Ga0207674_10002206 3300026116 Bacteria 24670
371 Ga0207674_10086585 3300026116 Bacteria 3128
372 Ga0207675_100003721 3300026118 Bacteria 14854
373 Ga0207675_100031350 3300026118 Bacteria 4953
374 Ga0207675_100223165 3300026118 Unclassified 1816
375 Ga0207683_10002096 3300026121 Bacteria 17563
376 Ga0207683_10013315 3300026121 Bacteria 7013
377 Ga0207683_10062356 3300026121 Bacteria 3283
378 Ga0207698_10003387 3300026142 Bacteria 9597
379 Ga0207698_10008006 3300026142 Bacteria 6661
380 Ga0207698_10011789 3300026142 Bacteria 5685
381 Ga0207698_10364972 3300026142 Bacteria 1369
382 Ga0209281_1000457 3300027111 Bacteria 57515
383 Ga0209967_1008061 3300027364 Bacteria 1445
384 Ga0210002_1000400 3300027617 Bacteria 5929
385 Ga0209966_1002217 3300027695 Bacteria 3246
386 Ga0209998_10000497 3300027717 Bacteria 10801
387 Ga0209998_10001108 3300027717 Bacteria 6727
388 Ga0207428_10000075 3300027907 Bacteria 137887
389 Ga0207428_10000428 3300027907 Bacteria 51964
390 Ga0207428_10001396 3300027907 Bacteria 25497
391 Ga0268265_10003048 3300028380 Bacteria 12223
392 Ga0268265_10021865 3300028380 Bacteria 4487
393 Ga0268264_10001145 3300028381 Bacteria 25934
394 Ga0268264_10072194 3300028381 Bacteria 2927
395 Ga0268264_10173498 3300028381 Bacteria 1952
396 Ga0265337_1000182 3300028556 Bacteria 33103
397 Ga0265338_10025143 3300028800 Bacteria 6056
398 Ga0265338_10035549 3300028800 Bacteria 4786
399 Ga0265332_10002169 3300031238 Bacteria 10111
400 Ga0265332_10139269 3300031238 Bacteria 1017
401 Ga0265325_10004418 3300031241 Bacteria 8892
402 Ga0265325_10014336 3300031241 Bacteria 4483
403 Ga0265325_10015145 3300031241 Bacteria 4344
404 Ga0265325_10023680 3300031241 Bacteria 3348
405 Ga0265329_10027036 3300031242 Bacteria 1887
406 Ga0265340_10013775 3300031247 Bacteria 4240
407 Ga0265340_10177499 3300031247 Bacteria 963
408 Ga0265339_10001994 3300031249 Bacteria 14995
409 Ga0265339_10041735 3300031249 Bacteria 2544
410 Ga0265331_10054909 3300031250 Bacteria 1896
411 Ga0265316_10004461 3300031344 Bacteria 13928
412 Ga0265316_10103766 3300031344 Bacteria 2158
413 Ga0265313_10006492 3300031595 Bacteria 8266
414 Ga0265313_10019949 3300031595 Bacteria 3713
415 Ga0265313_10113465 3300031595 Bacteria 1189
416 Ga0265314_10026422 3300031711 Bacteria 4361
417 Ga0265314_10036467 3300031711 Bacteria 3573
418 Ga0265314_10153200 3300031711 Bacteria 1411
419 Ga0265342_10000175 3300031712 Bacteria 71083
420 Ga0265342_10000203 3300031712 Bacteria 66540
421 Ga0265342_10141495 3300031712 Bacteria 1342
422 Ga0307416_100205896 3300032002 Bacteria 1872
423 Ga0316583_10011684 3300032133 Bacteria 3167
424 Ga0373948_0010578 3300034817 Bacteria 1615
425 Ga0373958_0017798 3300034819 Bacteria 1282
426 Ga0373959_0001074 3300034820 Bacteria 4483
427 Ga0373938_0000413 3300034957 Bacteria 6890
428 Ga0373938_0014643 3300034957 Bacteria 1508
429 Ga0373926_0002008 3300035083 Bacteria 6390
430 Ga0373928_0000172 3300035084 Bacteria 12512
431 Ga0373928_0003366 3300035084 Bacteria 3051
432 Ga0373934_0063208 3300035086 Bacteria 1476
433 Ga0373944_0000062 3300035089 Bacteria 17879
434 Ga0373949_0001909 3300035090 Bacteria 5630
435 Ga0373951_0002775 3300035091 Bacteria 4375
436 Ga0373951_0003748 3300035091 Bacteria 3664
437 Ga0373952_0000884 3300035092 Bacteria 5461
438 Ga0373952_0001609 3300035092 Bacteria 4108
439 Ga0373932_0000029 3300035112 Bacteria 39605
440 Ga0373936_0000484 3300035113 Bacteria 13457
441 Ga0373939_0007099 3300035114 Bacteria 2713
442 Ga0373941_0000106 3300035115 Bacteria 14078
443 Ga0373945_0000835 3300035116 Bacteria 9062
444 Ga0373953_0001395 3300035117 Bacteria 6962
445 Ga0373953_0017271 3300035117 Bacteria 2650
446 Ga0373954_0009945 3300035118 Bacteria 4189
447 Ga0373956_0013576 3300035119 Bacteria 3390
448 Ga0373957_0022935 3300035120 Bacteria 2228
449 Ga0373957_0044772 3300035120 Bacteria 1675
450 Ga0373960_0001059 3300035121 Bacteria 5930
451 Ga0373943_0016696 3300035170 Bacteria 3350
452 Ga0373943_0245121 3300035170 Bacteria 1005
453 Ga0373946_0002687 3300035171 Bacteria 6285
454 Ga0373955_0000366 3300035172 Bacteria 19051
455 Ga0373955_0005170 3300035172 Bacteria 5838
456 Ga0373955_0008419 3300035172 Bacteria 4790
457 Ga0373955_0138126 3300035172 Bacteria 1427
458 Ga0373942_0000542 3300035207 Bacteria 10621
459 Ga0373961_0057138 3300035241 Bacteria 1173
460 Ga0373962_0008452 3300035242 Bacteria 2533
461 Ga0373924_0015281 3300035410 Bacteria 2916
462 Ga0373931_0002810 3300035691 Bacteria 7754
463 Ga0373931_0015912 3300035691 Bacteria 3694
464 Ga0373935_0010618 3300035692 Bacteria 5527
465 Ga0373935_0038011 3300035692 Bacteria 3013
466 Ga0373935_0043558 3300035692 Bacteria 2825
467 Ga0373935_0122952 3300035692 Bacteria 1736
468 Ga0373927_0000956 3300035695 Bacteria 22017
469 Ga0373927_0031325 3300035695 Bacteria 3467
470 Ga0373927_0214845 3300035695 Bacteria 1263
471 Ga0373933_0005704 3300035724 Bacteria 6775
472 Ga0373933_0166811 3300035724 Bacteria 1400
473 Ga0373947_0000731 3300035725 Bacteria 19641
474 Ga0373947_0088882 3300035725 Bacteria 1924
475 Ga0373937_0002001 3300036401 Bacteria 17037
476 Ga0373937_0007098 3300036401 Bacteria 9677
477 Ga0373937_0062131 3300036401 Bacteria 3434
478 Ga0373937_0089746 3300036401 Bacteria 2846
479 Ga0373937_0112784 3300036401 Bacteria 2529
480 Ga0373925_0003685 3300037068 Bacteria 11776
481 Ga0373925_0096960 3300037068 Bacteria 2261
482 Ga0395899_0000003 3300037312 Bacteria 1232684
483 Ga0395900_0390450 3300037418 Bacteria 1358
484 Ga0439463_067641 3300042016 Bacteria 914
485 Ga0450923_009080 3300042125 Bacteria 1730
486 Ga0439460_0034528 3300042461 Bacteria 1458
487 Ga0451577_0382397 3300042876 Bacteria 1277
488 Ga0453684_0183551 3300044712 Bacteria 2454
489 Ga0466959_0264287 3300045049 Bacteria 1184
490 Ga0451576_0016775 3300045051 Bacteria 8074
491 Ga0466958_0107986 3300045836 Bacteria 1736
492 Ga0495592_0110130 3300046454 Bacteria 1949
493 Ga0495629_0016178 3300046459 Bacteria 5354
494 Ga0495629_0049014 3300046459 Bacteria 2961
495 Ga0495638_0082180 3300046460 Bacteria 1954
496 Ga0495638_0290931 3300046460 Bacteria 884
497 Ga0495641_0017019 3300046461 Bacteria 3804
498 Ga0495651_0001150 3300046462 Bacteria 20444
499 Ga0495651_0003637 3300046462 Bacteria 11807
500 Ga0495653_0001957 3300046463 Bacteria 16221
501 Ga0495653_0028636 3300046463 Bacteria 4453
502 Ga0495653_0184442 3300046463 Bacteria 1429
503 Ga0495580_0001416 3300046472 Bacteria 21075
504 Ga0495582_0030108 3300046473 Bacteria 2978
505 Ga0495639_0006262 3300046475 Bacteria 5111
506 Ga0495662_0002039 3300046476 Bacteria 10119
507 Ga0495664_0000178 3300046477 Bacteria 31382
508 Ga0495664_0026904 3300046477 Bacteria 3352
509 Ga0495585_0136831 3300046492 Bacteria 1285
510 Ga0495607_0010007 3300046501 Bacteria 6390
511 Ga0495608_0001671 3300046511 Bacteria 15955
512 Ga0495608_0012960 3300046511 Bacteria 5784
513 Ga0495618_0003686 3300046514 Bacteria 9495
514 Ga0495618_0037485 3300046514 Bacteria 3044
515 Ga0495628_0001448 3300046516 Bacteria 21780
516 Ga0495630_0096388 3300046517 Bacteria 2236
517 Ga0495630_0248263 3300046517 Bacteria 1359
518 Ga0495631_0032049 3300046518 Bacteria 2371
519 Ga0495644_0044220 3300046523 Bacteria 1675
520 Ga0495666_0000187 3300046526 Bacteria 26576
521 Ga0495652_0077344 3300046529 Bacteria 2759
522 Ga0495652_0088283 3300046529 Bacteria 2541
523 Ga0495665_0008864 3300046531 Bacteria 5456
524 Ga0495640_0056132 3300046533 Bacteria 2691
525 Ga0495640_0069162 3300046533 Bacteria 2375
526 Ga0495640_0081308 3300046533 Bacteria 2153
527 Ga0495586_0004369 3300046535 Bacteria 7558
528 Ga0495586_0057904 3300046535 Bacteria 2103
529 Ga0495587_0030207 3300046536 Bacteria 3287
530 Ga0495587_0045901 3300046536 Bacteria 2595
531 Ga0495587_0066130 3300046536 Bacteria 2109
532 Ga0495645_0101474 3300046543 Bacteria 2045
533 Ga0495645_0119023 3300046543 Bacteria 1861
534 Ga0495645_0272340 3300046543 Bacteria 1117
535 Ga0495622_0013770 3300046557 Bacteria 3750
536 Ga0495667_0002931 3300046559 Bacteria 11450
537 Ga0495667_0019175 3300046559 Bacteria 4616
538 Ga0495667_0109664 3300046559 Bacteria 1783
539 Ga0495656_0000534 3300046615 Bacteria 12388
540 Ga0495634_0067695 3300046642 Bacteria 2361
541 Ga0495634_0130637 3300046642 Bacteria 1601
542 Ga0495611_0006806 3300046648 Bacteria 4857
543 Ga0495635_0001359 3300046663 Bacteria 16270
544 Ga0495635_0010978 3300046663 Bacteria 6347
545 Ga0495588_0001695 3300046674 Bacteria 9374
546 Ga0495657_0003184 3300046675 Bacteria 13516
547 Ga0495657_0036972 3300046675 Bacteria 3369
548 Ga0495657_0125300 3300046675 Bacteria 1614
549 Ga0495599_0000806 3300046678 Bacteria 17617
550 Ga0495623_0008437 3300046679 Bacteria 6694
551 Ga0495623_0031978 3300046679 Bacteria 3383
552 Ga0495646_0035723 3300046680 Bacteria 3081
553 Ga0495646_0051794 3300046680 Bacteria 2482
554 Ga0495646_0190506 3300046680 Bacteria 1121
555 Ga0495647_0000638 3300046681 Bacteria 10362
556 Ga0495658_0069340 3300046683 Bacteria 2043
557 Ga0495658_0272785 3300046683 Bacteria 1066
558 Ga0495669_0147279 3300046684 Bacteria 1113
559 Ga0495613_0374503 3300046689 Bacteria 974
560 Ga0495624_0001411 3300046690 Bacteria 18734
561 Ga0495670_0004377 3300046691 Bacteria 6924
562 Ga0495600_0000208 3300046809 Bacteria 33755
563 Ga0495600_0006357 3300046809 Bacteria 7187
564 Ga0495600_0036434 3300046809 Bacteria 3197
565 Ga0495600_0248683 3300046809 Bacteria 1131
566 Ga0495581_0041286 3300047315 Bacteria 2669
567 Ga0495604_0001423 3300047317 Bacteria 19641
568 Ga0495604_0075924 3300047317 Bacteria 2529
569 Ga0495604_0088454 3300047317 Bacteria 2304
570 Ga0495604_0196145 3300047317 Bacteria 1404
571 Ga0495674_0016553 3300047319 Bacteria 6882
572 Ga0495674_0059310 3300047319 Bacteria 3342
573 Ga0495674_0184820 3300047319 Bacteria 1734
574 Ga0495676_0011575 3300047321 Bacteria 7958
575 Ga0495680_0001491 3300047322 Bacteria 25179
576 Ga0495680_0002844 3300047322 Bacteria 17397
577 Ga0495680_0013705 3300047322 Bacteria 7058
578 Ga0495680_0029839 3300047322 Bacteria 4461
579 Ga0495675_0231951 3300047444 Bacteria 1113
580 Ga0495677_0099911 3300047445 Bacteria 1098
581 Ga0495679_038824 3300047446 Bacteria 1489
582 Ga0495684_0030431 3300047471 Bacteria 4145
583 Ga0495684_0043587 3300047471 Bacteria 3435
584 Ga0495593_0000372 3300047673 Bacteria 24728
585 Ga0495602_0035376 3300048088 Bacteria 4657
586 Ga0495602_0050094 3300048088 Bacteria 3735
587 Ga0495602_0085752 3300048088 Bacteria 2631
588 Ga0495602_0091319 3300048088 Bacteria 2526
589 Ga0495614_0007981 3300048089 Bacteria 4705
590 Ga0496100_0000203 3300048903 Bacteria 32744
591 Ga0496100_0032855 3300048903 Bacteria 3241
592 Ga0496100_0079686 3300048903 Bacteria 2207
593 Ga0496100_0143875 3300048903 Bacteria 1693
594 Ga0496101_0002812 3300048904 Bacteria 10691
595 Ga0496101_0035029 3300048904 Bacteria 3549
596 Ga0496101_0449816 3300048904 Bacteria 1016
597 Ga0496102_0032260 3300048905 Bacteria 4705
598 Ga0496102_0065124 3300048905 Bacteria 3339
599 Ga0496102_0122413 3300048905 Bacteria 2430
600 Ga0496103_0001529 3300048906 Bacteria 15450
601 Ga0496104_0000445 3300048907 Bacteria 35921
602 Ga0496104_0016648 3300048907 Bacteria 6682
603 Ga0496104_0358852 3300048907 Bacteria 1370
604 Ga0496105_0006690 3300048908 Bacteria 8873
605 Ga0496105_0077638 3300048908 Bacteria 2742
606 Ga0496105_0084031 3300048908 Bacteria 2629
607 Ga0496105_0352969 3300048908 Bacteria 1174
608 Ga0496106_0002909 3300048909 Bacteria 12739
609 Ga0496106_0025562 3300048909 Bacteria 4395
610 Ga0496106_0096723 3300048909 Bacteria 2285
611 Ga0496106_0176027 3300048909 Bacteria 1697
612 Ga0496107_0000268 3300048910 Bacteria 27611
613 Ga0496107_0098496 3300048910 Bacteria 2141
614 Ga0496108_0008793 3300048911 Bacteria 8187
615 Ga0496108_0010827 3300048911 Bacteria 7404
616 Ga0496108_0148689 3300048911 Bacteria 2021
617 Ga0496108_0412612 3300048911 Bacteria 1179
618 Ga0496109_0006654 3300048912 Bacteria 9730
619 Ga0496109_0008201 3300048912 Bacteria 8863
620 Ga0496109_0052763 3300048912 Bacteria 3707
621 Ga0496109_0127580 3300048912 Bacteria 2372
622 Ga0496109_0678854 3300048912 Bacteria 967
623 Ga0496110_0016005 3300048913 Bacteria 6254
624 Ga0496110_0037863 3300048913 Bacteria 4194
625 Ga0496110_0130042 3300048913 Bacteria 2273
626 Ga0496111_0029644 3300048914 Bacteria 3887
627 Ga0496111_0049553 3300048914 Bacteria 3029
628 Ga0496111_0080905 3300048914 Bacteria 2371
629 Ga0496112_0099967 3300048915 Bacteria 2870
630 Ga0496112_0108126 3300048915 Bacteria 2751
631 Ga0496113_0002762 3300048916 Bacteria 10321
632 Ga0496113_0004401 3300048916 Bacteria 8645
633 Ga0496113_0034796 3300048916 Bacteria 3679
634 Ga0496113_0370017 3300048916 Bacteria 1150
635 Ga0496114_0083844 3300048917 Bacteria 2697
636 Ga0496114_0092986 3300048917 Bacteria 2563
637 Ga0496114_0402887 3300048917 Bacteria 1211
638 Ga0496115_0023949 3300048918 Bacteria 4741
639 Ga0496115_0095664 3300048918 Bacteria 2431
640 Ga0496115_0202312 3300048918 Bacteria 1640
641 Ga0496115_0230709 3300048918 Bacteria 1526
642 Ga0501031_0012352 3300049568 Bacteria 5570
643 Ga0501031_0021502 3300049568 Bacteria 4205
644 Ga0501032_0007475 3300049569 Bacteria 7982
645 Ga0501033_0043076 3300049570 Bacteria 3362
646 Ga0501034_0013858 3300049571 Bacteria 8299
647 Ga0501034_0056835 3300049571 Bacteria 3935
648 Ga0501034_0153821 3300049571 Bacteria 2275
649 Ga0501034_0175883 3300049571 Bacteria 2106
650 Ga0501034_0239177 3300049571 Bacteria 1762
651 Ga0501036_0015748 3300049572 Bacteria 6316
652 Ga0501036_0305909 3300049572 Bacteria 1329
653 Ga0501037_0061261 3300049573 Bacteria 2743
654 Ga0501038_0063258 3300049574 Bacteria 3159
655 Ga0501038_0126354 3300049574 Bacteria 2104
656 Ga0501038_0151870 3300049574 Bacteria 1888
657 Ga0501039_0007921 3300049575 Bacteria 8095
658 Ga0501039_0082126 3300049575 Bacteria 2509
659 Ga0501039_0691172 3300049575 Bacteria 798
660 Ga0501040_0140777 3300049576 Bacteria 1699
661 Ga0501042_0285973 3300049578 Bacteria 1191
662 Ga0501043_0045517 3300049579 Bacteria 3451
663 Ga0501046_0084655 3300049580 Bacteria 2445
664 Ga0501047_0022682 3300049581 Bacteria 6026
665 Ga0501047_0111246 3300049581 Bacteria 2621
666 Ga0501047_0114085 3300049581 Bacteria 2584
667 Ga0501048_0045947 3300049582 Bacteria 3117
668 Ga0501067_0032733 3300049583 Bacteria 2885
669 Ga0501067_0054450 3300049583 Bacteria 2217
670 Ga0501067_0173850 3300049583 Bacteria 1200
671 Ga0501068_0017433 3300049584 Bacteria 4153
672 Ga0501069_0003796 3300049585 Bacteria 7772
673 Ga0501070_0007016 3300049586 Bacteria 9584
674 Ga0501070_0059836 3300049586 Bacteria 3157
675 Ga0501070_0108921 3300049586 Bacteria 2289
676 Ga0501071_0015563 3300049587 Bacteria 5222
677 Ga0501072_0006805 3300049588 Bacteria 8679
678 Ga0501072_0195127 3300049588 Bacteria 1615
679 Ga0501072_0250652 3300049588 Bacteria 1410
680 Ga0501073_0005057 3300049589 Bacteria 9889
681 Ga0501073_0040741 3300049589 Bacteria 3285
682 Ga0501073_0123075 3300049589 Bacteria 1798
683 Ga0501074_0054912 3300049590 Bacteria 2871
684 Ga0501074_0137877 3300049590 Bacteria 1745
685 Ga0501074_0273002 3300049590 Bacteria 1202
686 Ga0501075_0241808 3300049591 Bacteria 1376
687 Ga0501076_0139898 3300049592 Bacteria 1966
688 Ga0501076_0219075 3300049592 Bacteria 1556
689 Ga0501077_0041424 3300049593 Bacteria 2932
690 Ga0501077_0045984 3300049593 Bacteria 2773
691 Ga0501079_0020072 3300049741 Bacteria 5105
692 Ga0501079_0089385 3300049741 Bacteria 2385
693 Ga0501080_0003540 3300049742 Bacteria 13755
694 Ga0501080_0093530 3300049742 Bacteria 2791
695 Ga0501080_0111467 3300049742 Bacteria 2536
696 Ga0501083_0000817 3300049744 Bacteria 20380
697 Ga0501035_0012399 3300049822 Bacteria 7880
698 Ga0501035_0121136 3300049822 Bacteria 2287
699 Ga0501035_0123772 3300049822 Bacteria 2258
700 Ga0501044_0082340 3300049823 Bacteria 3256
701 Ga0501044_0098239 3300049823 Bacteria 2948
702 Ga0501044_0121504 3300049823 Bacteria 2612
703 Ga0501044_0592680 3300049823 Bacteria 1002
704 Ga0501045_0152980 3300049824 Bacteria 1716
705 Ga0501045_0257309 3300049824 Bacteria 1299
706 nmdc:mga03683_85991_c1 3300050489 Bacteria 1365
707 nmdc:mga00v17_216144_c1 3300050491 Bacteria 1241
708 nmdc:mga0yw44_152974_c1 3300050492 Bacteria 1506
709 nmdc:mga0k408_1224_c1 3300050493 Bacteria 14077
710 nmdc:mga0k408_189307_c1 3300050493 Bacteria 1228
711 nmdc:mga06z11_136536_c1 3300050494 Bacteria 1382
712 nmdc:mga06z11_49011_c1 3300050494 Bacteria 2153
713 nmdc:mga07m45_3537_c1 3300050496 Bacteria 7546
714 nmdc:mga05p37_30291_c1 3300050507 Bacteria 6602
715 nmdc:mga05p37_32_c1 3300050507 Bacteria 112982
716 nmdc:mga05p37_359469_c1 3300050507 Bacteria 1712
717 nmdc:mga09592_6535_c1 3300050508 Bacteria 9497
718 nmdc:mga0qj67_355_c1 3300050509 Bacteria 31660
719 nmdc:mga06r32_5297_c1 3300050510 Bacteria 11609
720 nmdc:mga08y16_108687_c1 3300050511 Bacteria 2888
721 nmdc:mga08y16_163912_c1 3300050511 Bacteria 2309
722 nmdc:mga08y16_2238_c1 3300050511 Bacteria 19836
723 nmdc:mga08y16_6098_c1 3300050511 Bacteria 12643
724 nmdc:mga08y16_70445_c1 3300050511 Bacteria 3645
725 nmdc:mga0n895_15498_c1 3300050512 Bacteria 6953
726 nmdc:mga0n895_217395_c1 3300050512 Bacteria 1940
727 nmdc:mga0n895_286712_c1 3300050512 Bacteria 1669
728 nmdc:mga0n895_547_c1 3300050512 Bacteria 25755
729 nmdc:mga0n895_747709_c1 3300050512 Bacteria 971
730 nmdc:mga0n895_8451_c1 3300050512 Bacteria 8914
731 nmdc:mga0rr50_2161_c1 3300050513 Bacteria 10994
732 nmdc:mga0a205_6205_c1 3300050515 Bacteria 10788
733 nmdc:mga0a205_629_c1 3300050515 Bacteria 28029
734 Ga0495601_0004297 3300053077 Bacteria 8228
735 Ga0495601_0014254 3300053077 Bacteria 4789
736 Ga0495601_0032136 3300053077 Bacteria 3265
737 Ga0495601_0058164 3300053077 Bacteria 2449
738 Ga0495595_0002555 3300053084 Bacteria 7144
739 Ga0495595_0002810 3300053084 Bacteria 6850
740 Ga0495619_0000016 3300053085 Bacteria 231442
741 Ga0495619_0002830 3300053085 Bacteria 11300
742 Ga0495619_0043465 3300053085 Bacteria 2945
743 Ga0495619_0043843 3300053085 Bacteria 2934
744 Ga0500643_008074 3300053087 Bacteria 4171
745 Ga0500644_0001056 3300053088 Bacteria 8189
746 Ga0500651_0098202 3300053093 Bacteria 1798
747 Ga0500566_0011324 3300053094 Bacteria 5254
748 Ga0500566_0167437 3300053094 Bacteria 1139
749 Ga0500650_0110818 3300053098 Bacteria 1281
750 Ga0500595_000010 3300053119 Bacteria 275806
751 Ga0500595_021986 3300053119 Bacteria 2268
752 Ga0500655_024046 3300053133 Bacteria 1153
753 Ga0500573_0077827 3300053140 Bacteria 1887
754 Ga0500616_0000001 3300053153 Bacteria 1986011
755 Ga0500616_0012330 3300053153 Bacteria 5004
756 Ga0500616_0046862 3300053153 Bacteria 2297
757 Ga0500645_000051 3300053730 Bacteria 98521
758 Ga0501084_0052024 3300054114 Bacteria 3427
759 Ga0501082_0011368 3300060353 Bacteria 7656
760 Ga0501082_0015911 3300060353 Bacteria 6470
761 Ga0501082_0152556 3300060353 Bacteria 2007
762 Ga0530510_0228711 3300061734 Bacteria 1383
763 2919514090 2919513703 Bacteria 3844312
764 Ga0496104_0087911
765 2214856314
766 ARcpr5oldR_c000046
767 ARSoilYngRDRAFT_c00078
768 ARcpr5yngRDRAFT_c000072
769 ARSoilOldRDRAFT_c000019
770 ARCol0oldRDRAFT_c00019
771 ARCol0yngRDRAFT_1000004
772 JGI24752J21851_1005278
773 JGI24746J21847_1000147
774 JGI24740J21852_10029269
775 JGI24739J22299_10035498
776 JGI24737J22298_10000207
777 JGI24737J22298_10001119
778 JGI24750J21931_1000430
779 JGI24745J21846_1000298
780 JGI24744J21845_10003456
781 JGI24035J26624_1001932
782 JGI24034J26672_10000880
783 JGI24742J22300_10000483
784 JGI25405J52794_10000722
785 Ga0065716_1001709
786 Ga0065704_10075977
787 Ga0065712_10026946
788 Ga0070658_10103773
789 Ga0070676_10001460
790 Ga0070683_100001872
791 Ga0070690_100075162
792 Ga0070690_100088287
793 Ga0070670_100099847
794 Ga0070677_10000429
795 Ga0068869_100004944
796 Ga0070666_10063868
797 Ga0070666_10120678
798 Ga0070680_100018787
799 Ga0070680_100028819
800 Ga0070680_100054443
801 Ga0070680_100107387
802 Ga0070682_100000695
803 Ga0068868_100004036
804 Ga0070660_100006096
805 Ga0070660_100274442
806 Ga0070689_100007446
807 Ga0070689_100012268
808 Ga0070691_10178457
809 Ga0070687_100005997
810 Ga0070687_100025536
811 Ga0070661_100003765
812 Ga0070661_100011491
813 Ga0070692_10037528
814 Ga0070669_100015276
815 Ga0070675_100000240
816 Ga0070675_100480099
817 Ga0070671_100027986
818 Ga0070671_100043817
819 Ga0070671_100079018
820 Ga0070671_100374449
821 Ga0070674_100037934
822 Ga0070673_100019462
823 Ga0070673_100298793
824 Ga0070688_100001905
825 Ga0070688_100012599
826 Ga0070659_100009275
827 Ga0070659_100391940
828 Ga0070667_100020849
829 Ga0070667_100139401
830 Ga0070703_10005021
831 Ga0070709_10261556
832 Ga0070714_100136832
833 Ga0070714_100484767
834 Ga0070713_100064600
835 Ga0070713_100196757
836 Ga0070713_100324212
837 Ga0070713_100718215
838 Ga0070710_10050972
839 Ga0070701_10006689
840 Ga0070711_100051872
841 Ga0070705_100000768
842 Ga0070705_100135048
843 Ga0070700_100017267
844 Ga0070700_100134339
845 Ga0070708_100011083
846 Ga0070678_100000998
847 Ga0070678_100011827
848 Ga0070678_100165405
849 Ga0070662_100053268
850 Ga0070662_100080454
851 Ga0070662_100091293
852 Ga0070681_10003430
853 Ga0070681_10019515
854 Ga0070681_10023877
855 Ga0070681_10153481
856 Ga0070681_10287479
857 Ga0068867_100046736
858 Ga0068867_100234231
859 Ga0070685_10032994
860 Ga0070707_100159426
861 Ga0070707_100638270
862 Ga0070699_100021616
863 Ga0070699_100509179
864 Ga0070679_100016730
865 Ga0070679_100027185
866 Ga0070679_100041157
867 Ga0070679_100062932
868 Ga0070679_100076059
869 Ga0068853_100009924
870 Ga0070672_100001847
871 Ga0070686_100010163
872 Ga0070695_100057834
873 Ga0070696_100032893
874 Ga0070693_100009660
875 Ga0070693_100018497
876 Ga0070704_100025492
877 Ga0068855_100014855
878 Ga0068855_100017390
879 Ga0068855_100053133
880 Ga0068855_100419910
881 Ga0070664_100001002
882 Ga0070664_100169038
883 Ga0068857_100026858
884 Ga0068854_100257832
885 Ga0068856_100093029
886 Ga0068856_100154215
887 Ga0068859_100010808
888 Ga0068859_100049776
889 Ga0068864_100003922
890 Ga0068864_100119693
891 Ga0068866_10007131
892 Ga0068861_100003710
893 Ga0068870_10000157
894 Ga0068863_100000674
895 Ga0068858_100357365
896 Ga0068858_100477792
897 Ga0068860_100012435
898 Ga0068860_100446805
899 Ga0068860_100553145
900 Ga0068862_100024284
901 Ga0081455_10000059
902 Ga0081455_10002427
903 Ga0081455_10003542
904 Ga0081455_10077103
905 Ga0081455_10083520
906 Ga0081455_10094624
907 Ga0081538_10024573
908 Ga0081540_1002311
909 Ga0081540_1008452
910 Ga0075365_10125079
911 Ga0075363_100063262
912 Ga0075364_10305847
913 Ga0075432_10006219
914 Ga0070716_100049144
915 Ga0075362_10182437
916 Ga0075367_10077830
917 Ga0075367_10134447
918 Ga0075427_10000100
919 Ga0075366_10015817
920 Ga0075366_10120861
921 Ga0097621_100001613
922 Ga0097621_100064907
923 Ga0075370_10003389
924 Ga0068871_100001066
925 Ga0068871_100039344
926 Ga0075428_100038761
927 Ga0075430_100000070
928 Ga0075431_100001221
929 Ga0075433_10010476
930 Ga0075433_10084490
931 Ga0075433_10219988
932 Ga0075434_100000212
933 Ga0075434_100027125
934 Ga0075434_100037805
935 Ga0075434_100228079
936 Ga0075434_100267256
937 Ga0075434_100404868
938 Ga0075429_100003999
939 Ga0068865_100000131
940 Ga0068865_100521410
941 Ga0075436_100174916
942 Ga0097620_100010810
943 Ga0097620_100049776
944 Ga0075435_100029738
945 Ga0075435_100034976
946 Ga0075435_100102816
947 Ga0105240_10006508
948 Ga0105240_10071446
949 Ga0105240_10099393
950 Ga0111539_10000138
951 Ga0111539_10004385
952 Ga0111539_10079599
953 Ga0111539_10091965
954 Ga0111539_10196316
955 Ga0105245_10003161
956 Ga0105247_10005112
957 Ga0114129_10002312
958 Ga0114129_10003950
959 Ga0114129_10327161
960 Ga0105243_10006299
961 Ga0105243_10249021
962 Ga0105243_10399372
963 Ga0105241_10112491
964 Ga0105241_10118149
965 Ga0105242_10021762
966 Ga0105242_10079779
967 Ga0105242_10119834
968 Ga0105242_10288138
969 Ga0105248_10012777
970 Ga0105248_10013552
971 Ga0105248_10137748
972 Ga0105248_10267044
973 Ga0105237_10042427
974 Ga0105238_10099595
975 Ga0105249_10001029
976 Ga0105249_10515811
977 Ga0105239_10026090
978 Ga0105239_10161641
979 Ga0105239_10365407
980 Ga0105246_10021818
981 Ga0157338_1001989
982 Ga0157373_10133539
983 Ga0157371_10028313
984 Ga0157371_10177826
985 Ga0157370_10023866
986 Ga0157370_10030329
987 Ga0157369_10228420
988 Ga0157369_10706209
989 Ga0157374_10000671
990 Ga0157374_10032272
991 Ga0157378_10011261
992 Ga0157378_10108997
993 Ga0157378_10127274
994 Ga0163162_10118369
995 Ga0163162_10277868
996 Ga0163162_10568887
997 Ga0157372_10018229
998 Ga0157372_10104676
999 Ga0157375_10002908
1000 Ga0157375_10308323
1001 Ga0157375_10311584
1002 Ga0163163_10004312
1003 Ga0163163_10029813
1004 Ga0163163_10128579
1005 Ga0157380_10000678
1006 Ga0157380_10206765
1007 Ga0157377_10000570
1008 Ga0157379_10000345
1009 Ga0157379_10219812
1010 Ga0157376_10265642
1011 Ga0157376_10280387
1012 Ga0163161_10004669
1013 Ga0163161_10224060
1014 Ga0206353_10147817
1015 Ga0207666_1000069
1016 Ga0207666_1001466
1017 Ga0207673_1000549
1018 Ga0209675_1004054
1019 Ga0209256_1000045
1020 Ga0207697_10000390
1021 Ga0207653_10002299
1022 Ga0207682_10000048
1023 Ga0207692_10029365
1024 Ga0207642_10002027
1025 Ga0207688_10001496
1026 Ga0207680_10208314
1027 Ga0207647_10032839
1028 Ga0207647_10056078
1029 Ga0207685_10015948
1030 Ga0207699_10271867
1031 Ga0207645_10003506
1032 Ga0207643_10000581
1033 Ga0207705_10124581
1034 Ga0207684_10384841
1035 Ga0207654_10031795
1036 Ga0207707_10020384
1037 Ga0207707_10036943
1038 Ga0207707_10132172
1039 Ga0207707_10147968
1040 Ga0207707_10191324
1041 Ga0207707_10381513
1042 Ga0207695_10015353
1043 Ga0207695_10265289
1044 Ga0207671_10011618
1045 Ga0207671_10243523
1046 Ga0207693_10011653
1047 Ga0207693_10501736
1048 Ga0207663_10034354
1049 Ga0207663_10040903
1050 Ga0207660_10000192
1051 Ga0207660_10024327
1052 Ga0207660_10040340
1053 Ga0207660_10073202
1054 Ga0207660_10075156
1055 Ga0207662_10000647
1056 Ga0207662_10025033
1057 Ga0207657_10011619
1058 Ga0207657_10028107
1059 Ga0207657_10030467
1060 Ga0207657_10038177
1061 Ga0207657_10280269
1062 Ga0207649_10000141
1063 Ga0207649_10003097
1064 Ga0207652_10001526
1065 Ga0207652_10100407
1066 Ga0207652_10242138
1067 Ga0207681_10000359
1068 Ga0207681_10010524
1069 Ga0207694_10252881
1070 Ga0207650_10030348
1071 Ga0207659_10000052
1072 Ga0207659_10396364
1073 Ga0207687_10000097
1074 Ga0207687_10088253
1075 Ga0207700_10044558
1076 Ga0207700_10277715
1077 Ga0207664_10021449
1078 Ga0207664_10098664
1079 Ga0207644_10002956
1080 Ga0207644_10041797
1081 Ga0207644_10053055
1082 Ga0207644_10272389
1083 Ga0207690_10000278
1084 Ga0207690_10048562
1085 Ga0207706_10032964
1086 Ga0207706_10036851
1087 Ga0207706_10054827
1088 Ga0207686_10000850
1089 Ga0207686_10023021
1090 Ga0207709_10000349
1091 Ga0207709_10032016
1092 Ga0207709_10121451
1093 Ga0207709_10271793
1094 Ga0207670_10000781
1095 Ga0207670_10010975
1096 Ga0207670_10128099
1097 Ga0207669_10000168
1098 Ga0207669_10127559
1099 Ga0207704_10000704
1100 Ga0207704_10332161
1101 Ga0207665_10050654
1102 Ga0207665_10302955
1103 Ga0207691_10003348
1104 Ga0207711_10006180
1105 Ga0207689_10025744
1106 Ga0207661_10000143
1107 Ga0207679_10000035
1108 Ga0207667_10023138
1109 Ga0207667_10025196
1110 Ga0207651_10000080
1111 Ga0207651_10207083
1112 Ga0207712_10003380
1113 Ga0207668_10005342
1114 Ga0207640_10001402
1115 Ga0207640_10520390
1116 Ga0207658_10162981
1117 Ga0207677_10000614
1118 Ga0207703_10021848
1119 Ga0207703_10153578
1120 Ga0207639_10021338
1121 Ga0207678_10005116
1122 Ga0207708_10008117
1123 Ga0207708_10020985
1124 Ga0207702_10001956
1125 Ga0207702_10148331
1126 Ga0207702_10801476
1127 Ga0207641_10109878
1128 Ga0207641_10478868
1129 Ga0207648_10013365
1130 Ga0207676_10001840
1131 Ga0207676_10062045
1132 Ga0207676_10097383
1133 Ga0207674_10002206
1134 Ga0207674_10086585
1135 Ga0207675_100003721
1136 Ga0207675_100031350
1137 Ga0207675_100223165
1138 Ga0207683_10002096
1139 Ga0207683_10013315
1140 Ga0207683_10062356
1141 Ga0207698_10003387
1142 Ga0207698_10008006
1143 Ga0207698_10011789
1144 Ga0207698_10364972
1145 Ga0209281_1000457
1146 Ga0209967_1008061
1147 Ga0210002_1000400
1148 Ga0209966_1002217
1149 Ga0209998_10000497
1150 Ga0209998_10001108
1151 Ga0207428_10000075
1152 Ga0207428_10000428
1153 Ga0207428_10001396
1154 Ga0268265_10003048
1155 Ga0268265_10021865
1156 Ga0268264_10001145
1157 Ga0268264_10072194
1158 Ga0268264_10173498
1159 Ga0265337_1000182
1160 Ga0265338_10025143
1161 Ga0265338_10035549
1162 Ga0265332_10002169
1163 Ga0265332_10139269
1164 Ga0265325_10004418
1165 Ga0265325_10014336
1166 Ga0265325_10015145
1167 Ga0265325_10023680
1168 Ga0265329_10027036
1169 Ga0265340_10013775
1170 Ga0265340_10177499
1171 Ga0265339_10001994
1172 Ga0265339_10041735
1173 Ga0265331_10054909
1174 Ga0265316_10004461
1175 Ga0265316_10103766
1176 Ga0265313_10006492
1177 Ga0265313_10019949
1178 Ga0265313_10113465
1179 Ga0265314_10026422
1180 Ga0265314_10036467
1181 Ga0265314_10153200
1182 Ga0265342_10000175
1183 Ga0265342_10000203
1184 Ga0265342_10141495
1185 Ga0307416_100205896
1186 Ga0316583_10011684
1187 Ga0373948_0010578
1188 Ga0373958_0017798
1189 Ga0373959_0001074
1190 Ga0373938_0000413
1191 Ga0373938_0014643
1192 Ga0373926_0002008
1193 Ga0373928_0000172
1194 Ga0373928_0003366
1195 Ga0373934_0063208
1196 Ga0373944_0000062
1197 Ga0373949_0001909
1198 Ga0373951_0002775
1199 Ga0373951_0003748
1200 Ga0373952_0000884
1201 Ga0373952_0001609
1202 Ga0373932_0000029
1203 Ga0373936_0000484
1204 Ga0373939_0007099
1205 Ga0373941_0000106
1206 Ga0373945_0000835
1207 Ga0373953_0001395
1208 Ga0373953_0017271
1209 Ga0373954_0009945
1210 Ga0373956_0013576
1211 Ga0373957_0022935
1212 Ga0373957_0044772
1213 Ga0373960_0001059
1214 Ga0373943_0016696
1215 Ga0373943_0245121
1216 Ga0373946_0002687
1217 Ga0373955_0000366
1218 Ga0373955_0005170
1219 Ga0373955_0008419
1220 Ga0373955_0138126
1221 Ga0373942_0000542
1222 Ga0373961_0057138
1223 Ga0373962_0008452
1224 Ga0373924_0015281
1225 Ga0373931_0002810
1226 Ga0373931_0015912
1227 Ga0373935_0010618
1228 Ga0373935_0038011
1229 Ga0373935_0043558
1230 Ga0373935_0122952
1231 Ga0373927_0000956
1232 Ga0373927_0031325
1233 Ga0373927_0214845
1234 Ga0373933_0005704
1235 Ga0373933_0166811
1236 Ga0373947_0000731
1237 Ga0373947_0088882
1238 Ga0373937_0002001
1239 Ga0373937_0007098
1240 Ga0373937_0062131
1241 Ga0373937_0089746
1242 Ga0373937_0112784
1243 Ga0373925_0003685
1244 Ga0373925_0096960
1245 Ga0395899_0000003
1246 Ga0395900_0390450
1247 Ga0439463_067641
1248 Ga0450923_009080
1249 Ga0439460_0034528
1250 Ga0451577_0382397
1251 Ga0453684_0183551
1252 Ga0466959_0264287
1253 Ga0451576_0016775
1254 Ga0466958_0107986
1255 Ga0495592_0110130
1256 Ga0495629_0016178
1257 Ga0495629_0049014
1258 Ga0495638_0082180
1259 Ga0495638_0290931
1260 Ga0495641_0017019
1261 Ga0495651_0001150
1262 Ga0495651_0003637
1263 Ga0495653_0001957
1264 Ga0495653_0028636
1265 Ga0495653_0184442
1266 Ga0495580_0001416
1267 Ga0495582_0030108
1268 Ga0495639_0006262
1269 Ga0495662_0002039
1270 Ga0495664_0000178
1271 Ga0495664_0026904
1272 Ga0495585_0136831
1273 Ga0495607_0010007
1274 Ga0495608_0001671
1275 Ga0495608_0012960
1276 Ga0495618_0003686
1277 Ga0495618_0037485
1278 Ga0495628_0001448
1279 Ga0495630_0096388
1280 Ga0495630_0248263
1281 Ga0495631_0032049
1282 Ga0495644_0044220
1283 Ga0495666_0000187
1284 Ga0495652_0077344
1285 Ga0495652_0088283
1286 Ga0495665_0008864
1287 Ga0495640_0056132
1288 Ga0495640_0069162
1289 Ga0495640_0081308
1290 Ga0495586_0004369
1291 Ga0495586_0057904
1292 Ga0495587_0030207
1293 Ga0495587_0045901
1294 Ga0495587_0066130
1295 Ga0495645_0101474
1296 Ga0495645_0119023
1297 Ga0495645_0272340
1298 Ga0495622_0013770
1299 Ga0495667_0002931
1300 Ga0495667_0019175
1301 Ga0495667_0109664
1302 Ga0495656_0000534
1303 Ga0495634_0067695
1304 Ga0495634_0130637
1305 Ga0495611_0006806
1306 Ga0495635_0001359
1307 Ga0495635_0010978
1308 Ga0495588_0001695
1309 Ga0495657_0003184
1310 Ga0495657_0036972
1311 Ga0495657_0125300
1312 Ga0495599_0000806
1313 Ga0495623_0008437
1314 Ga0495623_0031978
1315 Ga0495646_0035723
1316 Ga0495646_0051794
1317 Ga0495646_0190506
1318 Ga0495647_0000638
1319 Ga0495658_0069340
1320 Ga0495658_0272785
1321 Ga0495669_0147279
1322 Ga0495613_0374503
1323 Ga0495624_0001411
1324 Ga0495670_0004377
1325 Ga0495600_0000208
1326 Ga0495600_0006357
1327 Ga0495600_0036434
1328 Ga0495600_0248683
1329 Ga0495581_0041286
1330 Ga0495604_0001423
1331 Ga0495604_0075924
1332 Ga0495604_0088454
1333 Ga0495604_0196145
1334 Ga0495674_0016553
1335 Ga0495674_0059310
1336 Ga0495674_0184820
1337 Ga0495676_0011575
1338 Ga0495680_0001491
1339 Ga0495680_0002844
1340 Ga0495680_0013705
1341 Ga0495680_0029839
1342 Ga0495675_0231951
1343 Ga0495677_0099911
1344 Ga0495679_038824
1345 Ga0495684_0030431
1346 Ga0495684_0043587
1347 Ga0495593_0000372
1348 Ga0495602_0035376
1349 Ga0495602_0050094
1350 Ga0495602_0085752
1351 Ga0495602_0091319
1352 Ga0495614_0007981
1353 Ga0496100_0000203
1354 Ga0496100_0032855
1355 Ga0496100_0079686
1356 Ga0496100_0143875
1357 Ga0496101_0002812
1358 Ga0496101_0035029
1359 Ga0496101_0449816
1360 Ga0496102_0032260
1361 Ga0496102_0065124
1362 Ga0496102_0122413
1363 Ga0496103_0001529
1364 Ga0496104_0000445
1365 Ga0496104_0016648
1366 Ga0496104_0358852
1367 Ga0496105_0006690
1368 Ga0496105_0077638
1369 Ga0496105_0084031
1370 Ga0496105_0352969
1371 Ga0496106_0002909
1372 Ga0496106_0025562
1373 Ga0496106_0096723
1374 Ga0496106_0176027
1375 Ga0496107_0000268
1376 Ga0496107_0098496
1377 Ga0496108_0008793
1378 Ga0496108_0010827
1379 Ga0496108_0148689
1380 Ga0496108_0412612
1381 Ga0496109_0006654
1382 Ga0496109_0008201
1383 Ga0496109_0052763
1384 Ga0496109_0127580
1385 Ga0496109_0678854
1386 Ga0496110_0016005
1387 Ga0496110_0037863
1388 Ga0496110_0130042
1389 Ga0496111_0029644
1390 Ga0496111_0049553
1391 Ga0496111_0080905
1392 Ga0496112_0099967
1393 Ga0496112_0108126
1394 Ga0496113_0002762
1395 Ga0496113_0004401
1396 Ga0496113_0034796
1397 Ga0496113_0370017
1398 Ga0496114_0083844
1399 Ga0496114_0092986
1400 Ga0496114_0402887
1401 Ga0496115_0023949
1402 Ga0496115_0095664
1403 Ga0496115_0202312
1404 Ga0496115_0230709
1405 Ga0501031_0012352
1406 Ga0501031_0021502
1407 Ga0501032_0007475
1408 Ga0501033_0043076
1409 Ga0501034_0013858
1410 Ga0501034_0056835
1411 Ga0501034_0153821
1412 Ga0501034_0175883
1413 Ga0501034_0239177
1414 Ga0501036_0015748
1415 Ga0501036_0305909
1416 Ga0501037_0061261
1417 Ga0501038_0063258
1418 Ga0501038_0126354
1419 Ga0501038_0151870
1420 Ga0501039_0007921
1421 Ga0501039_0082126
1422 Ga0501039_0691172
1423 Ga0501040_0140777
1424 Ga0501042_0285973
1425 Ga0501043_0045517
1426 Ga0501046_0084655
1427 Ga0501047_0022682
1428 Ga0501047_0111246
1429 Ga0501047_0114085
1430 Ga0501048_0045947
1431 Ga0501067_0032733
1432 Ga0501067_0054450
1433 Ga0501067_0173850
1434 Ga0501068_0017433
1435 Ga0501069_0003796
1436 Ga0501070_0007016
1437 Ga0501070_0059836
1438 Ga0501070_0108921
1439 Ga0501071_0015563
1440 Ga0501072_0006805
1441 Ga0501072_0195127
1442 Ga0501072_0250652
1443 Ga0501073_0005057
1444 Ga0501073_0040741
1445 Ga0501073_0123075
1446 Ga0501074_0054912
1447 Ga0501074_0137877
1448 Ga0501074_0273002
1449 Ga0501075_0241808
1450 Ga0501076_0139898
1451 Ga0501076_0219075
1452 Ga0501077_0041424
1453 Ga0501077_0045984
1454 Ga0501079_0020072
1455 Ga0501079_0089385
1456 Ga0501080_0003540
1457 Ga0501080_0093530
1458 Ga0501080_0111467
1459 Ga0501083_0000817
1460 Ga0501035_0012399
1461 Ga0501035_0121136
1462 Ga0501035_0123772
1463 Ga0501044_0082340
1464 Ga0501044_0098239
1465 Ga0501044_0121504
1466 Ga0501044_0592680
1467 Ga0501045_0152980
1468 Ga0501045_0257309
1469 nmdc:mga03683_85991_c1
1470 nmdc:mga00v17_216144_c1
1471 nmdc:mga0yw44_152974_c1
1472 nmdc:mga0k408_1224_c1
1473 nmdc:mga0k408_189307_c1
1474 nmdc:mga06z11_136536_c1
1475 nmdc:mga06z11_49011_c1
1476 nmdc:mga07m45_3537_c1
1477 nmdc:mga05p37_30291_c1
1478 nmdc:mga05p37_32_c1
1479 nmdc:mga05p37_359469_c1
1480 nmdc:mga09592_6535_c1
1481 nmdc:mga0qj67_355_c1
1482 nmdc:mga06r32_5297_c1
1483 nmdc:mga08y16_108687_c1
1484 nmdc:mga08y16_163912_c1
1485 nmdc:mga08y16_2238_c1
1486 nmdc:mga08y16_6098_c1
1487 nmdc:mga08y16_70445_c1
1488 nmdc:mga0n895_15498_c1
1489 nmdc:mga0n895_217395_c1
1490 nmdc:mga0n895_286712_c1
1491 nmdc:mga0n895_547_c1
1492 nmdc:mga0n895_747709_c1
1493 nmdc:mga0n895_8451_c1
1494 nmdc:mga0rr50_2161_c1
1495 nmdc:mga0a205_6205_c1
1496 nmdc:mga0a205_629_c1
1497 Ga0495601_0004297
1498 Ga0495601_0014254
1499 Ga0495601_0032136
1500 Ga0495601_0058164
1501 Ga0495595_0002555
1502 Ga0495595_0002810
1503 Ga0495619_0000016
1504 Ga0495619_0002830
1505 Ga0495619_0043465
1506 Ga0495619_0043843
1507 Ga0500643_008074
1508 Ga0500644_0001056
1509 Ga0500651_0098202
1510 Ga0500566_0011324
1511 Ga0500566_0167437
1512 Ga0500650_0110818
1513 Ga0500595_000010
1514 Ga0500595_021986
1515 Ga0500655_024046
1516 Ga0500573_0077827
1517 Ga0500616_0000001
1518 Ga0500616_0012330
1519 Ga0500616_0046862
1520 Ga0500645_000051
1521 Ga0501084_0052024
1522 Ga0501082_0011368
1523 Ga0501082_0015911
1524 Ga0501082_0152556
1525 Ga0530510_0228711
1526 2919514090

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13714

PEP_mutase

Phosphoenolpyruvate phosphomutase

11

248

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lsb-assembly1.cif.gz_A crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9604 3 270
4lsb-assembly1.cif.gz_B crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9582 3 269
4lsb-assembly1.cif.gz_A crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9266 3 270
4lsb-assembly1.cif.gz_B crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.918 3 269
4mg4-assembly1.cif.gz_A crystal structure of a putative phosphonomutase from burkholderia cenocepacia j2315 0.9136 2 246
ID Description Score Start End Superfamily
4lsbB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9653 3 229 3.20.20.60
4lsbB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9489 3 229 3.20.20.60
2ze3A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9356 1 229 3.20.20.60
2ze3A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9201 1 229 3.20.20.60
4mg4B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9137 1 246 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A2W5MVI2-F1-model_v4 deleted 0.9902 1 185
AF-A0A7C9REC3-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9898 1 192 GO:0016829
AF-A0A537U189-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9894 2 229 GO:0016829
AF-A0A6N6T1N9-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9889 1 269 GO:0016829
AF-A0A2S5DK39-F1-model_v4 2-methylisocitrate lyase 0.9887 1 269 GO:0016829

Map