F479748
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 764 | 416 | 698 | 400 |
Family's Representative Sequence
| Representative Sequence | 3300048904|Ga0496101_0044216|Ga0496101_0044216_626_2047 |
| Length | 473 |
| Sequence | MAGGHPGSARPDRSPAVRARALSRARQRHKRGGIDAQGASKRRPQIINGLGRQPACRSRRVVTFDAMHAPAPALSIKQVLFCGAMIVTLSMGIRHGFGLWLQPITQAQDWSRQTFSFALAVQNLSWGIFGVFAGMLADRFGAFRVLIGGAVFYALGLFGMAHSPTPLLFTLSAGVLIGAAQAGSTYAVIYGVIGRQIPAERRSWAMGVAAAAGSFGQFLMAPIEGRLIGHLGWQSALAVVAVLVLVIIPLAFGLREPKTAALAGHREQSVLQAVGEAFRYPSFGLLMAGYFVCGFQLAFIGIHMPTYLRDRSLPAEVAGYALALIGLFNVFGTYTVGLLGQKLAKRKILAAIYFARAVSIALFLLAPISPLSVYVFSAAMGFLWLSTVPATNAIVAGIFGVAHLSMFSGFVFLSHQVGSFLGVWLGGYLYDTTGSYDVVWYLSIALGVFAALINLPVKETAIARAPRAVGAAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 3 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 4 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 5 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 6 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 7 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 8 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 9 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 10 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 11 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 12 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 13 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 14 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 15 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 16 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 17 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 18 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 19 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 20 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 21 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 22 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 23 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 24 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 25 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 26 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 27 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 28 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 29 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 30 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 31 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 32 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 33 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 34 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 35 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 36 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 37 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 38 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 39 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 40 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 41 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 42 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 43 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 44 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 45 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 46 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 47 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 48 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 49 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 50 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 51 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 52 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 53 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 54 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 55 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 56 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 57 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 58 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 59 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 60 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 61 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 62 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 63 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 64 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 65 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 66 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 67 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 68 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 69 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 70 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 71 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 72 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 73 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 74 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 75 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 76 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 77 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 78 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 79 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 80 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 81 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 82 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 83 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 84 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 85 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 86 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 87 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 88 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 89 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 92 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 95 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 97 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 111 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 112 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 113 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 114 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 118 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 120 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 121 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 122 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 123 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 124 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 125 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 126 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 127 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 128 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 129 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 130 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 131 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 132 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 133 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 134 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 135 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 136 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 137 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 138 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 139 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 141 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 142 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 143 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 145 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 146 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 147 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 158 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 169 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 173 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 174 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 175 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 177 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 185 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 186 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 189 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 190 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 191 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 193 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 195 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 198 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 201 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 247 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 248 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 250 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 252 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 253 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 256 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 257 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 258 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 259 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 260 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 261 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 262 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 263 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 264 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 265 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 266 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 267 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 268 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 269 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 270 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 271 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 272 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 273 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 274 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 275 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 276 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 277 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 278 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 279 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 280 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 281 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 282 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 283 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 284 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 285 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 286 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 287 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 288 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 289 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 290 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 291 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 292 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 293 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 294 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 295 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 296 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 297 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 298 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 299 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 300 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 301 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 302 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 303 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 304 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 305 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 306 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 307 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 308 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 309 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 310 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 311 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 312 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 313 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 314 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 315 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 316 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 317 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 318 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 319 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 351 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 352 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 353 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 354 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 357 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 358 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 359 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 360 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 361 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 362 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 363 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 364 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 365 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 366 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 367 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 368 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 369 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 370 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 375 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 376 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 377 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 378 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 379 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 381 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 382 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 383 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 384 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 385 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 386 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 388 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 389 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 390 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 391 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 392 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 393 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 394 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 395 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 396 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 397 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 398 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 399 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 400 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 401 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 402 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 403 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 404 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 405 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 406 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 407 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 408 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 409 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 410 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 411 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 412 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 413 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 414 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 415 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 416 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.23 |
| Metatranscriptomes | 0.13 |
| Isolates | 8.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 25.92 |
| Nodule | 1.18 |
| Rhizoplane | 2.75 |
| Rhizosphere | 55.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000079 | 3300002704 | Bacteria | 56287 |
| 2 | JGI25156J39149_1000125 | 3300002705 | Bacteria | 56308 |
| 3 | JGI25154J39366_1000141 | 3300002738 | Bacteria | 56305 |
| 4 | JGI25157J39369_1000159 | 3300002741 | Bacteria | 56308 |
| 5 | JGI25152J39213_1000898 | 3300002773 | Bacteria | 14563 |
| 6 | JGI25151J46595_10001314 | 3300003187 | Bacteria | 17394 |
| 7 | JGI25151J46595_10007994 | 3300003187 | Bacteria | 5128 |
| 8 | rootH1_10001837 | 3300003316 | Bacteria | 9095 |
| 9 | rootH1_10006805 | 3300003316 | Bacteria | 3738 |
| 10 | rootH1_10007839 | 3300003316 | Bacteria | 2707 |
| 11 | rootH2_10007324 | 3300003320 | Bacteria | 5197 |
| 12 | rootH2_10019508 | 3300003320 | Bacteria | 4926 |
| 13 | rootL2_10004836 | 3300003322 | Bacteria | 21607 |
| 14 | rootL2_10014298 | 3300003322 | Bacteria | 14509 |
| 15 | rootH1_10022291 | 3300003323 | Bacteria | 2135 |
| 16 | Ga0006562J51391_1114750 | 3300003578 | Bacteria | 1790 |
| 17 | Ga0055539_1000459 | 3300003752 | Bacteria | 13689 |
| 18 | Ga0055533_1000080 | 3300003756 | Bacteria | 131291 |
| 19 | Ga0055525_1001686 | 3300003759 | Bacteria | 3330 |
| 20 | Ga0055535_1000198 | 3300003761 | Bacteria | 63889 |
| 21 | Ga0055529_1000449 | 3300003763 | Bacteria | 40616 |
| 22 | Ga0055526_1000542 | 3300003771 | Bacteria | 29770 |
| 23 | Ga0055526_1002456 | 3300003771 | Bacteria | 12531 |
| 24 | Ga0055537_1000490 | 3300003773 | Bacteria | 24227 |
| 25 | Ga0055537_1009910 | 3300003773 | Bacteria | 2056 |
| 26 | Ga0055524_1000084 | 3300003775 | Bacteria | 119107 |
| 27 | Ga0055524_1006922 | 3300003775 | Bacteria | 4877 |
| 28 | Ga0055536_1003127 | 3300003781 | Bacteria | 8989 |
| 29 | Ga0055536_1010072 | 3300003781 | Bacteria | 3808 |
| 30 | Ga0055534_1000042 | 3300003784 | Bacteria | 99433 |
| 31 | Ga0055534_1000722 | 3300003784 | Bacteria | 15998 |
| 32 | Ga0055528_1000242 | 3300003790 | Bacteria | 45905 |
| 33 | Ga0055528_1021372 | 3300003790 | Bacteria | 2057 |
| 34 | Ga0055530_10000492 | 3300003791 | Bacteria | 34175 |
| 35 | Ga0055530_10002750 | 3300003791 | Bacteria | 10882 |
| 36 | Ga0055530_10005842 | 3300003791 | Bacteria | 5704 |
| 37 | Ga0055540_1000086 | 3300003792 | Bacteria | 102576 |
| 38 | Ga0055540_1003253 | 3300003792 | Bacteria | 7961 |
| 39 | Ga0055540_1006309 | 3300003792 | Bacteria | 4739 |
| 40 | Ga0055540_1007552 | 3300003792 | Bacteria | 4073 |
| 41 | Ga0055540_1025041 | 3300003792 | Bacteria | 1468 |
| 42 | Ga0055531_10000314 | 3300003794 | Bacteria | 47668 |
| 43 | Ga0055531_10001855 | 3300003794 | Bacteria | 14853 |
| 44 | Ga0055531_10004814 | 3300003794 | Bacteria | 8061 |
| 45 | Ga0055531_10004962 | 3300003794 | Bacteria | 7902 |
| 46 | Ga0055541_1002116 | 3300003841 | Bacteria | 4049 |
| 47 | Ga0065165_1000239 | 3300005262 | Bacteria | 94061 |
| 48 | Ga0065165_1003676 | 3300005262 | Bacteria | 10442 |
| 49 | Ga0065165_1030210 | 3300005262 | Bacteria | 1727 |
| 50 | Ga0070676_10008798 | 3300005328 | Bacteria | 5450 |
| 51 | Ga0070676_10054914 | 3300005328 | Bacteria | 2350 |
| 52 | Ga0070683_100010932 | 3300005329 | Bacteria | 7817 |
| 53 | Ga0070690_100060008 | 3300005330 | Bacteria | 2447 |
| 54 | Ga0070670_100000948 | 3300005331 | Bacteria | 22791 |
| 55 | Ga0070670_100078288 | 3300005331 | Bacteria | 2840 |
| 56 | Ga0070670_100120485 | 3300005331 | Bacteria | 2263 |
| 57 | Ga0070670_100250349 | 3300005331 | Bacteria | 1543 |
| 58 | Ga0070670_100277018 | 3300005331 | Bacteria | 1464 |
| 59 | Ga0070677_10066794 | 3300005333 | Bacteria | 1500 |
| 60 | Ga0068869_100016845 | 3300005334 | Bacteria | 4939 |
| 61 | Ga0068869_100160653 | 3300005334 | Bacteria | 1749 |
| 62 | Ga0070666_10002405 | 3300005335 | Bacteria | 11320 |
| 63 | Ga0070666_10009812 | 3300005335 | Bacteria | 5980 |
| 64 | Ga0070680_100003562 | 3300005336 | Bacteria | 11616 |
| 65 | Ga0070660_100221488 | 3300005339 | Bacteria | 1538 |
| 66 | Ga0070661_100000925 | 3300005344 | Bacteria | 21020 |
| 67 | Ga0070668_100005104 | 3300005347 | Bacteria | 9724 |
| 68 | Ga0070669_100008394 | 3300005353 | Bacteria | 7371 |
| 69 | Ga0070669_100093833 | 3300005353 | Bacteria | 2254 |
| 70 | Ga0070675_100000199 | 3300005354 | Bacteria | 37845 |
| 71 | Ga0070675_100035240 | 3300005354 | Bacteria | 4065 |
| 72 | Ga0070675_100070491 | 3300005354 | Bacteria | 2897 |
| 73 | Ga0070675_100079444 | 3300005354 | Bacteria | 2733 |
| 74 | Ga0070675_100103246 | 3300005354 | Bacteria | 2403 |
| 75 | Ga0070671_100010921 | 3300005355 | Bacteria | 7293 |
| 76 | Ga0070671_100166654 | 3300005355 | Bacteria | 1863 |
| 77 | Ga0070674_100002083 | 3300005356 | Bacteria | 10952 |
| 78 | Ga0070674_100023449 | 3300005356 | Bacteria | 3995 |
| 79 | Ga0070673_100008889 | 3300005364 | Bacteria | 6712 |
| 80 | Ga0070673_100038837 | 3300005364 | Bacteria | 3639 |
| 81 | Ga0070659_100011073 | 3300005366 | Bacteria | 6662 |
| 82 | Ga0070659_100123416 | 3300005366 | Bacteria | 2100 |
| 83 | Ga0070667_100001982 | 3300005367 | Bacteria | 18152 |
| 84 | Ga0070667_100105980 | 3300005367 | Bacteria | 2433 |
| 85 | Ga0070663_100000949 | 3300005455 | Bacteria | 15767 |
| 86 | Ga0070678_100016273 | 3300005456 | Bacteria | 4752 |
| 87 | Ga0070678_100036463 | 3300005456 | Bacteria | 3442 |
| 88 | Ga0070678_100166660 | 3300005456 | Bacteria | 1790 |
| 89 | Ga0070678_100248149 | 3300005456 | Bacteria | 1491 |
| 90 | Ga0070662_100004821 | 3300005457 | Bacteria | 8548 |
| 91 | Ga0070662_100015528 | 3300005457 | Bacteria | 5103 |
| 92 | Ga0070681_10079088 | 3300005458 | Bacteria | 3245 |
| 93 | Ga0068867_100000077 | 3300005459 | Bacteria | 59836 |
| 94 | Ga0068867_100003310 | 3300005459 | Bacteria | 11351 |
| 95 | Ga0068867_100017655 | 3300005459 | Bacteria | 5066 |
| 96 | Ga0068867_100038718 | 3300005459 | Bacteria | 3472 |
| 97 | Ga0070684_100138264 | 3300005535 | Bacteria | 2201 |
| 98 | Ga0068853_100005208 | 3300005539 | Bacteria | 10169 |
| 99 | Ga0068853_100010853 | 3300005539 | Bacteria | 7380 |
| 100 | Ga0068853_100179227 | 3300005539 | Bacteria | 1921 |
| 101 | Ga0068853_100273601 | 3300005539 | Bacteria | 1555 |
| 102 | Ga0068853_100347193 | 3300005539 | Bacteria | 1380 |
| 103 | Ga0070672_100002369 | 3300005543 | Bacteria | 11933 |
| 104 | Ga0070672_100002690 | 3300005543 | Bacteria | 11370 |
| 105 | Ga0070672_100173261 | 3300005543 | Bacteria | 1795 |
| 106 | Ga0070693_100024527 | 3300005547 | Bacteria | 3235 |
| 107 | Ga0070665_100343037 | 3300005548 | Bacteria | 1499 |
| 108 | Ga0068855_100009834 | 3300005563 | Bacteria | 11535 |
| 109 | Ga0068855_100063457 | 3300005563 | Bacteria | 4311 |
| 110 | Ga0068855_100103267 | 3300005563 | Bacteria | 3280 |
| 111 | Ga0070664_100000939 | 3300005564 | Bacteria | 22774 |
| 112 | Ga0070664_100011705 | 3300005564 | Bacteria | 7120 |
| 113 | Ga0070664_100052960 | 3300005564 | Bacteria | 3439 |
| 114 | Ga0070664_100084929 | 3300005564 | Bacteria | 2733 |
| 115 | Ga0070664_100092362 | 3300005564 | Bacteria | 2620 |
| 116 | Ga0068857_100025674 | 3300005577 | Bacteria | 5187 |
| 117 | Ga0068857_100054500 | 3300005577 | Bacteria | 3548 |
| 118 | Ga0068854_100007790 | 3300005578 | Bacteria | 6850 |
| 119 | Ga0068856_100011297 | 3300005614 | Bacteria | 8666 |
| 120 | Ga0068856_100286755 | 3300005614 | Bacteria | 1663 |
| 121 | Ga0068852_100008550 | 3300005616 | Bacteria | 7551 |
| 122 | Ga0068852_100010615 | 3300005616 | Bacteria | 6892 |
| 123 | Ga0068852_100039765 | 3300005616 | Bacteria | 3962 |
| 124 | Ga0068852_100052008 | 3300005616 | Bacteria | 3519 |
| 125 | Ga0068852_100138477 | 3300005616 | Bacteria | 2250 |
| 126 | Ga0068859_100016607 | 3300005617 | Bacteria | 7390 |
| 127 | Ga0068864_100000354 | 3300005618 | Bacteria | 40336 |
| 128 | Ga0068864_100012237 | 3300005618 | Bacteria | 7090 |
| 129 | Ga0068866_10058734 | 3300005718 | Bacteria | 1988 |
| 130 | Ga0068861_100005261 | 3300005719 | Bacteria | 8725 |
| 131 | Ga0068851_10006140 | 3300005834 | Bacteria | 5482 |
| 132 | Ga0068863_100011545 | 3300005841 | Bacteria | 8546 |
| 133 | Ga0068858_100000262 | 3300005842 | Bacteria | 56062 |
| 134 | Ga0068858_100008391 | 3300005842 | Bacteria | 9937 |
| 135 | Ga0068860_100028441 | 3300005843 | Bacteria | 5380 |
| 136 | Ga0068860_100074043 | 3300005843 | Bacteria | 3237 |
| 137 | Ga0068860_100175865 | 3300005843 | Bacteria | 2069 |
| 138 | Ga0068862_100024627 | 3300005844 | Bacteria | 5051 |
| 139 | Ga0068862_100044660 | 3300005844 | Bacteria | 3780 |
| 140 | Ga0068862_100061533 | 3300005844 | Bacteria | 3227 |
| 141 | Ga0075365_10038179 | 3300006038 | Bacteria | 3120 |
| 142 | Ga0075365_10055119 | 3300006038 | Bacteria | 2638 |
| 143 | Ga0075368_10037925 | 3300006042 | Bacteria | 1885 |
| 144 | Ga0075363_100028475 | 3300006048 | Bacteria | 2874 |
| 145 | Ga0075363_100035069 | 3300006048 | Bacteria | 2623 |
| 146 | Ga0075363_100056246 | 3300006048 | Bacteria | 2109 |
| 147 | Ga0075363_100069036 | 3300006048 | Bacteria | 1917 |
| 148 | Ga0075364_10053785 | 3300006051 | Bacteria | 2632 |
| 149 | Ga0075362_10001536 | 3300006177 | Bacteria | 7443 |
| 150 | Ga0075362_10029707 | 3300006177 | Bacteria | 2357 |
| 151 | Ga0075367_10105277 | 3300006178 | Bacteria | 1727 |
| 152 | Ga0075366_10001350 | 3300006195 | Bacteria | 12267 |
| 153 | Ga0075366_10003846 | 3300006195 | Bacteria | 7997 |
| 154 | Ga0075366_10004344 | 3300006195 | Bacteria | 7598 |
| 155 | Ga0075366_10050324 | 3300006195 | Bacteria | 2473 |
| 156 | Ga0097621_100008020 | 3300006237 | Bacteria | 7582 |
| 157 | Ga0075370_10000415 | 3300006353 | Bacteria | 15744 |
| 158 | Ga0075370_10000695 | 3300006353 | Bacteria | 13246 |
| 159 | Ga0075370_10002974 | 3300006353 | Bacteria | 7966 |
| 160 | Ga0075370_10006626 | 3300006353 | Bacteria | 5838 |
| 161 | Ga0075370_10008542 | 3300006353 | Bacteria | 5276 |
| 162 | Ga0075370_10012978 | 3300006353 | Bacteria | 4419 |
| 163 | Ga0075370_10023080 | 3300006353 | Bacteria | 3423 |
| 164 | Ga0075370_10024655 | 3300006353 | Bacteria | 3324 |
| 165 | Ga0075370_10046427 | 3300006353 | Bacteria | 2458 |
| 166 | Ga0068871_100051800 | 3300006358 | Bacteria | 3324 |
| 167 | Ga0068871_100053359 | 3300006358 | Bacteria | 3276 |
| 168 | Ga0068871_100063594 | 3300006358 | Bacteria | 3019 |
| 169 | Ga0068865_100013265 | 3300006881 | Bacteria | 5205 |
| 170 | Ga0097620_100016607 | 3300006931 | Bacteria | 7390 |
| 171 | Ga0099823_1006231 | 3300006944 | Bacteria | 12019 |
| 172 | Ga0079104_1000100 | 3300006946 | Bacteria | 126924 |
| 173 | Ga0079104_1022553 | 3300006946 | Bacteria | 1691 |
| 174 | Ga0099826_10061797 | 3300006948 | Bacteria | 2431 |
| 175 | Ga0105244_10004693 | 3300009036 | Bacteria | 9311 |
| 176 | Ga0105240_10274345 | 3300009093 | Bacteria | 1940 |
| 177 | Ga0114129_10753013 | 3300009147 | Bacteria | 1247 |
| 178 | Ga0105243_10009710 | 3300009148 | Bacteria | 7328 |
| 179 | Ga0105243_10020150 | 3300009148 | Bacteria | 5055 |
| 180 | Ga0105242_10091692 | 3300009176 | Bacteria | 2558 |
| 181 | Ga0105248_10014983 | 3300009177 | Bacteria | 8535 |
| 182 | Ga0105248_10026083 | 3300009177 | Bacteria | 6502 |
| 183 | Ga0105248_10066801 | 3300009177 | Bacteria | 4037 |
| 184 | Ga0105248_10083454 | 3300009177 | Bacteria | 3594 |
| 185 | Ga0105248_10366178 | 3300009177 | Bacteria | 1623 |
| 186 | Ga0105237_10050257 | 3300009545 | Bacteria | 4189 |
| 187 | Ga0105238_10003844 | 3300009551 | Bacteria | 14913 |
| 188 | Ga0105238_10243712 | 3300009551 | Bacteria | 1775 |
| 189 | Ga0105239_10112957 | 3300010375 | Bacteria | 3012 |
| 190 | Ga0105246_10088977 | 3300011119 | Bacteria | 2220 |
| 191 | Ga0157319_1000031 | 3300012497 | Bacteria | 48442 |
| 192 | Ga0157373_10027789 | 3300013100 | Bacteria | 4081 |
| 193 | Ga0157370_10037489 | 3300013104 | Bacteria | 4699 |
| 194 | Ga0157370_10102679 | 3300013104 | Bacteria | 2677 |
| 195 | Ga0157370_10131317 | 3300013104 | Bacteria | 2336 |
| 196 | Ga0157370_10361301 | 3300013104 | Bacteria | 1338 |
| 197 | Ga0157369_10012571 | 3300013105 | Bacteria | 9602 |
| 198 | Ga0157369_10013458 | 3300013105 | Bacteria | 9246 |
| 199 | Ga0157369_10218354 | 3300013105 | Bacteria | 1996 |
| 200 | Ga0157374_10008718 | 3300013296 | Bacteria | 8674 |
| 201 | Ga0157374_10009590 | 3300013296 | Bacteria | 8313 |
| 202 | Ga0157374_10082615 | 3300013296 | Bacteria | 3051 |
| 203 | Ga0157374_10109813 | 3300013296 | Bacteria | 2652 |
| 204 | Ga0157378_10242282 | 3300013297 | Bacteria | 1723 |
| 205 | Ga0163162_10003584 | 3300013306 | Bacteria | 14856 |
| 206 | Ga0163162_10006364 | 3300013306 | Bacteria | 11432 |
| 207 | Ga0163162_10024877 | 3300013306 | Bacteria | 5914 |
| 208 | Ga0163162_10041320 | 3300013306 | Bacteria | 4613 |
| 209 | Ga0157372_10028646 | 3300013307 | Bacteria | 6080 |
| 210 | Ga0157372_10033440 | 3300013307 | Bacteria | 5648 |
| 211 | Ga0157375_10005659 | 3300013308 | Bacteria | 10875 |
| 212 | Ga0157375_10015677 | 3300013308 | Bacteria | 6788 |
| 213 | Ga0157375_10245080 | 3300013308 | Bacteria | 1952 |
| 214 | Ga0163163_10079734 | 3300014325 | Bacteria | 3272 |
| 215 | Ga0157380_10157891 | 3300014326 | Bacteria | 1968 |
| 216 | Ga0182008_10000838 | 3300014497 | Bacteria | 21458 |
| 217 | Ga0182008_10011535 | 3300014497 | Bacteria | 4693 |
| 218 | Ga0182008_10021365 | 3300014497 | Bacteria | 3323 |
| 219 | Ga0157377_10000094 | 3300014745 | Bacteria | 64283 |
| 220 | Ga0157377_10003608 | 3300014745 | Bacteria | 7010 |
| 221 | Ga0157379_10002033 | 3300014968 | Bacteria | 16785 |
| 222 | Ga0157379_10004639 | 3300014968 | Bacteria | 11791 |
| 223 | Ga0157379_10026435 | 3300014968 | Bacteria | 5166 |
| 224 | Ga0157376_10011894 | 3300014969 | Bacteria | 6435 |
| 225 | Ga0157376_10021468 | 3300014969 | Bacteria | 5015 |
| 226 | Ga0157376_10125555 | 3300014969 | Bacteria | 2282 |
| 227 | Ga0157376_10374786 | 3300014969 | Bacteria | 1369 |
| 228 | Ga0182006_1002216 | 3300015261 | Bacteria | 10773 |
| 229 | Ga0182007_10000601 | 3300015262 | Bacteria | 21082 |
| 230 | Ga0182007_10000825 | 3300015262 | Bacteria | 17267 |
| 231 | Ga0182007_10020840 | 3300015262 | Bacteria | 2336 |
| 232 | Ga0182005_1014672 | 3300015265 | Bacteria | 2191 |
| 233 | Ga0163161_10009786 | 3300017792 | Bacteria | 6643 |
| 234 | Ga0163161_10011479 | 3300017792 | Bacteria | 6147 |
| 235 | Ga0163161_10046138 | 3300017792 | Bacteria | 3143 |
| 236 | Ga0163161_10051214 | 3300017792 | Bacteria | 2990 |
| 237 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 238 | Ga0209566_100238 | 3300025225 | Bacteria | 52918 |
| 239 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 240 | Ga0209147_101458 | 3300025229 | Bacteria | 8517 |
| 241 | Ga0209563_100049 | 3300025230 | Bacteria | 358472 |
| 242 | Ga0207427_100846 | 3300025231 | Bacteria | 13684 |
| 243 | Ga0209258_100189 | 3300025242 | Bacteria | 128268 |
| 244 | Ga0209258_100199 | 3300025242 | Bacteria | 123718 |
| 245 | Ga0207425_1004716 | 3300025245 | Bacteria | 4023 |
| 246 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 247 | Ga0209026_1000003 | 3300025250 | Bacteria | 1060571 |
| 248 | Ga0209677_100228 | 3300025253 | Bacteria | 39841 |
| 249 | Ga0209148_1000179 | 3300025254 | Bacteria | 126083 |
| 250 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 251 | Ga0209759_1001304 | 3300025256 | Bacteria | 14727 |
| 252 | Ga0209129_1000041 | 3300025258 | Bacteria | 307590 |
| 253 | Ga0209129_1000071 | 3300025258 | Bacteria | 210729 |
| 254 | Ga0209129_1001902 | 3300025258 | Bacteria | 11014 |
| 255 | Ga0209565_1000083 | 3300025263 | Bacteria | 154007 |
| 256 | Ga0209565_1002195 | 3300025263 | Bacteria | 7317 |
| 257 | Ga0209455_1000092 | 3300025272 | Bacteria | 220516 |
| 258 | Ga0209673_1000534 | 3300025273 | Bacteria | 62274 |
| 259 | Ga0209673_1001906 | 3300025273 | Bacteria | 16707 |
| 260 | Ga0209673_1006444 | 3300025273 | Bacteria | 5662 |
| 261 | Ga0209673_1014477 | 3300025273 | Bacteria | 3050 |
| 262 | Ga0209673_1023559 | 3300025273 | Bacteria | 2092 |
| 263 | Ga0209130_1000773 | 3300025284 | Bacteria | 27625 |
| 264 | Ga0209130_1002969 | 3300025284 | Bacteria | 7705 |
| 265 | Ga0209130_1016985 | 3300025284 | Bacteria | 1745 |
| 266 | Ga0209675_1000081 | 3300025291 | Bacteria | 154007 |
| 267 | Ga0209675_1002859 | 3300025291 | Bacteria | 8569 |
| 268 | Ga0209675_1006924 | 3300025291 | Bacteria | 4447 |
| 269 | Ga0209675_1009436 | 3300025291 | Bacteria | 3448 |
| 270 | Ga0209675_1015228 | 3300025291 | Bacteria | 2296 |
| 271 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 272 | Ga0209676_1001007 | 3300025292 | Bacteria | 33026 |
| 273 | Ga0209676_1003004 | 3300025292 | Bacteria | 10965 |
| 274 | Ga0209676_1020636 | 3300025292 | Bacteria | 2232 |
| 275 | Ga0209676_1024270 | 3300025292 | Bacteria | 1968 |
| 276 | Ga0209025_1000544 | 3300025294 | Bacteria | 70638 |
| 277 | Ga0209025_1004201 | 3300025294 | Bacteria | 12707 |
| 278 | Ga0209025_1007365 | 3300025294 | Bacteria | 8232 |
| 279 | Ga0209025_1017392 | 3300025294 | Bacteria | 4154 |
| 280 | Ga0209025_1033991 | 3300025294 | Bacteria | 2342 |
| 281 | Ga0209564_1000003 | 3300025295 | Bacteria | 1585848 |
| 282 | Ga0209564_1000029 | 3300025295 | Bacteria | 505995 |
| 283 | Ga0209564_1000239 | 3300025295 | Bacteria | 119761 |
| 284 | Ga0209564_1029136 | 3300025295 | Bacteria | 1745 |
| 285 | Ga0209758_1000027 | 3300025297 | Bacteria | 549650 |
| 286 | Ga0209758_1000043 | 3300025297 | Bacteria | 402310 |
| 287 | Ga0209758_1003037 | 3300025297 | Bacteria | 15990 |
| 288 | Ga0209758_1004896 | 3300025297 | Bacteria | 10767 |
| 289 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 290 | Ga0209050_1000672 | 3300025298 | Bacteria | 51771 |
| 291 | Ga0209050_1001089 | 3300025298 | Bacteria | 33034 |
| 292 | Ga0209050_1001494 | 3300025298 | Bacteria | 24797 |
| 293 | Ga0209050_1010817 | 3300025298 | Bacteria | 4432 |
| 294 | Ga0209050_1020188 | 3300025298 | Bacteria | 2490 |
| 295 | Ga0209050_1021104 | 3300025298 | Bacteria | 2389 |
| 296 | Ga0209256_1000071 | 3300025299 | Bacteria | 242618 |
| 297 | Ga0209256_1000081 | 3300025299 | Bacteria | 222908 |
| 298 | Ga0209256_1000637 | 3300025299 | Bacteria | 47908 |
| 299 | Ga0209256_1006944 | 3300025299 | Bacteria | 5779 |
| 300 | Ga0209256_1025046 | 3300025299 | Bacteria | 1745 |
| 301 | Ga0207426_1000027 | 3300025302 | Bacteria | 513176 |
| 302 | Ga0207426_1000614 | 3300025302 | Bacteria | 45951 |
| 303 | Ga0209051_1000009 | 3300025303 | Bacteria | 706778 |
| 304 | Ga0209051_1000210 | 3300025303 | Bacteria | 102629 |
| 305 | Ga0209051_1000347 | 3300025303 | Bacteria | 68841 |
| 306 | Ga0209051_1000373 | 3300025303 | Bacteria | 64348 |
| 307 | Ga0209051_1000553 | 3300025303 | Bacteria | 45537 |
| 308 | Ga0209051_1002578 | 3300025303 | Bacteria | 12758 |
| 309 | Ga0209051_1004580 | 3300025303 | Bacteria | 8448 |
| 310 | Ga0209051_1006092 | 3300025303 | Bacteria | 6869 |
| 311 | Ga0209051_1014665 | 3300025303 | Bacteria | 3644 |
| 312 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 313 | Ga0209257_1000017 | 3300025304 | Bacteria | 866287 |
| 314 | Ga0209257_1000314 | 3300025304 | Bacteria | 102629 |
| 315 | Ga0209257_1000449 | 3300025304 | Bacteria | 77522 |
| 316 | Ga0209257_1005834 | 3300025304 | Bacteria | 8351 |
| 317 | Ga0209257_1006088 | 3300025304 | Bacteria | 8015 |
| 318 | Ga0209257_1007816 | 3300025304 | Bacteria | 6334 |
| 319 | Ga0209257_1009230 | 3300025304 | Bacteria | 5347 |
| 320 | Ga0209257_1019812 | 3300025304 | Bacteria | 2515 |
| 321 | Ga0207656_10020715 | 3300025321 | Bacteria | 2616 |
| 322 | Ga0207656_10025101 | 3300025321 | Bacteria | 2417 |
| 323 | Ga0207656_10074611 | 3300025321 | Bacteria | 1514 |
| 324 | Ga0207655_1001731 | 3300025728 | Bacteria | 19151 |
| 325 | Ga0207682_10042804 | 3300025893 | Bacteria | 1851 |
| 326 | Ga0207642_10015239 | 3300025899 | Bacteria | 2859 |
| 327 | Ga0207688_10029556 | 3300025901 | Bacteria | 3018 |
| 328 | Ga0207680_10005119 | 3300025903 | Bacteria | 6250 |
| 329 | Ga0207680_10032011 | 3300025903 | Bacteria | 2984 |
| 330 | Ga0207645_10003951 | 3300025907 | Bacteria | 11066 |
| 331 | Ga0207645_10019697 | 3300025907 | Bacteria | 4422 |
| 332 | Ga0207645_10112118 | 3300025907 | Bacteria | 1766 |
| 333 | Ga0207705_10084324 | 3300025909 | Bacteria | 2320 |
| 334 | Ga0207705_10096464 | 3300025909 | Bacteria | 2171 |
| 335 | Ga0207707_10036154 | 3300025912 | Bacteria | 4319 |
| 336 | Ga0207695_10136443 | 3300025913 | Bacteria | 2406 |
| 337 | Ga0207660_10017896 | 3300025917 | Bacteria | 4717 |
| 338 | Ga0207649_10001141 | 3300025920 | Bacteria | 16077 |
| 339 | Ga0207649_10003480 | 3300025920 | Bacteria | 8602 |
| 340 | Ga0207652_10004261 | 3300025921 | Bacteria | 11672 |
| 341 | Ga0207681_10001915 | 3300025923 | Bacteria | 13327 |
| 342 | Ga0207694_10112687 | 3300025924 | Bacteria | 2165 |
| 343 | Ga0207694_10253970 | 3300025924 | Bacteria | 1439 |
| 344 | Ga0207650_10001268 | 3300025925 | Bacteria | 18324 |
| 345 | Ga0207650_10059135 | 3300025925 | Bacteria | 2856 |
| 346 | Ga0207659_10001828 | 3300025926 | Bacteria | 12600 |
| 347 | Ga0207659_10005032 | 3300025926 | Bacteria | 8012 |
| 348 | Ga0207659_10007870 | 3300025926 | Bacteria | 6589 |
| 349 | Ga0207659_10027698 | 3300025926 | Bacteria | 3841 |
| 350 | Ga0207687_10030790 | 3300025927 | Bacteria | 3621 |
| 351 | Ga0207690_10007376 | 3300025932 | Bacteria | 6527 |
| 352 | Ga0207690_10024614 | 3300025932 | Bacteria | 3772 |
| 353 | Ga0207706_10002276 | 3300025933 | Bacteria | 18747 |
| 354 | Ga0207706_10013403 | 3300025933 | Bacteria | 7454 |
| 355 | Ga0207706_10025344 | 3300025933 | Bacteria | 5314 |
| 356 | Ga0207706_10065915 | 3300025933 | Bacteria | 3188 |
| 357 | Ga0207706_10108219 | 3300025933 | Bacteria | 2446 |
| 358 | Ga0207706_10176074 | 3300025933 | Bacteria | 1879 |
| 359 | Ga0207709_10001584 | 3300025935 | Bacteria | 15523 |
| 360 | Ga0207709_10010549 | 3300025935 | Bacteria | 5088 |
| 361 | Ga0207709_10023429 | 3300025935 | Bacteria | 3513 |
| 362 | Ga0207709_10048245 | 3300025935 | Bacteria | 2594 |
| 363 | Ga0207691_10007407 | 3300025940 | Bacteria | 10568 |
| 364 | Ga0207691_10014538 | 3300025940 | Bacteria | 7508 |
| 365 | Ga0207691_10324899 | 3300025940 | Bacteria | 1319 |
| 366 | Ga0207711_10084753 | 3300025941 | Bacteria | 2775 |
| 367 | Ga0207711_10205708 | 3300025941 | Bacteria | 1797 |
| 368 | Ga0207711_10272333 | 3300025941 | Bacteria | 1558 |
| 369 | Ga0207689_10000169 | 3300025942 | Bacteria | 57089 |
| 370 | Ga0207689_10033478 | 3300025942 | Bacteria | 4270 |
| 371 | Ga0207661_10008632 | 3300025944 | Bacteria | 7280 |
| 372 | Ga0207679_10000201 | 3300025945 | Bacteria | 48099 |
| 373 | Ga0207679_10038726 | 3300025945 | Bacteria | 3399 |
| 374 | Ga0207679_10042670 | 3300025945 | Bacteria | 3261 |
| 375 | Ga0207679_10092092 | 3300025945 | Bacteria | 2348 |
| 376 | Ga0207667_10003340 | 3300025949 | Bacteria | 19799 |
| 377 | Ga0207667_10025900 | 3300025949 | Bacteria | 6416 |
| 378 | Ga0207667_10116090 | 3300025949 | Bacteria | 2759 |
| 379 | Ga0207651_10005930 | 3300025960 | Bacteria | 6327 |
| 380 | Ga0207651_10024218 | 3300025960 | Bacteria | 3750 |
| 381 | Ga0207651_10037938 | 3300025960 | Bacteria | 3161 |
| 382 | Ga0207712_10001833 | 3300025961 | Bacteria | 14012 |
| 383 | Ga0207658_10000336 | 3300025986 | Bacteria | 47108 |
| 384 | Ga0207658_10031032 | 3300025986 | Bacteria | 3791 |
| 385 | Ga0207658_10083045 | 3300025986 | Bacteria | 2461 |
| 386 | Ga0207677_10030695 | 3300026023 | Bacteria | 3434 |
| 387 | Ga0207677_10224051 | 3300026023 | Bacteria | 1510 |
| 388 | Ga0207703_10000277 | 3300026035 | Bacteria | 56761 |
| 389 | Ga0207703_10000866 | 3300026035 | Bacteria | 29661 |
| 390 | Ga0207639_10046919 | 3300026041 | Bacteria | 3261 |
| 391 | Ga0207639_10142245 | 3300026041 | Bacteria | 2000 |
| 392 | Ga0207639_10218115 | 3300026041 | Bacteria | 1646 |
| 393 | Ga0207678_10000522 | 3300026067 | Bacteria | 34895 |
| 394 | Ga0207678_10026579 | 3300026067 | Bacteria | 5049 |
| 395 | Ga0207678_10066914 | 3300026067 | Bacteria | 3084 |
| 396 | Ga0207678_10183439 | 3300026067 | Bacteria | 1787 |
| 397 | Ga0207708_10044572 | 3300026075 | Bacteria | 3380 |
| 398 | Ga0207702_10003457 | 3300026078 | Bacteria | 14415 |
| 399 | Ga0207702_10083180 | 3300026078 | Bacteria | 2784 |
| 400 | Ga0207648_10000193 | 3300026089 | Bacteria | 64119 |
| 401 | Ga0207648_10016909 | 3300026089 | Bacteria | 6648 |
| 402 | Ga0207676_10001342 | 3300026095 | Bacteria | 18294 |
| 403 | Ga0207676_10006001 | 3300026095 | Bacteria | 8567 |
| 404 | Ga0207676_10019417 | 3300026095 | Bacteria | 4959 |
| 405 | Ga0207676_10165952 | 3300026095 | Bacteria | 1918 |
| 406 | Ga0207674_10028197 | 3300026116 | Bacteria | 5930 |
| 407 | Ga0207674_10147027 | 3300026116 | Bacteria | 2315 |
| 408 | Ga0207675_100002188 | 3300026118 | Bacteria | 19420 |
| 409 | Ga0207675_100012833 | 3300026118 | Bacteria | 7825 |
| 410 | Ga0207683_10005419 | 3300026121 | Bacteria | 10931 |
| 411 | Ga0207683_10053921 | 3300026121 | Bacteria | 3526 |
| 412 | Ga0207683_10090600 | 3300026121 | Bacteria | 2723 |
| 413 | Ga0207683_10129230 | 3300026121 | Bacteria | 2271 |
| 414 | Ga0207698_10002643 | 3300026142 | Bacteria | 10651 |
| 415 | Ga0207698_10015587 | 3300026142 | Bacteria | 5095 |
| 416 | Ga0207698_10102988 | 3300026142 | Bacteria | 2371 |
| 417 | Ga0207698_10103117 | 3300026142 | Bacteria | 2370 |
| 418 | Ga0207698_10151905 | 3300026142 | Bacteria | 2011 |
| 419 | Ga0209281_1000084 | 3300027111 | Bacteria | 254215 |
| 420 | Ga0209389_1031428 | 3300027296 | Bacteria | 4443 |
| 421 | Ga0209996_1000266 | 3300027395 | Bacteria | 6565 |
| 422 | Ga0209282_1023309 | 3300027666 | Bacteria | 3893 |
| 423 | Ga0209966_1000003 | 3300027695 | Bacteria | 111077 |
| 424 | Ga0209813_10004852 | 3300027866 | Bacteria | 3233 |
| 425 | Ga0207428_10156042 | 3300027907 | Bacteria | 1736 |
| 426 | Ga0268265_10010320 | 3300028380 | Bacteria | 6306 |
| 427 | Ga0268264_10001554 | 3300028381 | Bacteria | 21267 |
| 428 | Ga0268264_10026955 | 3300028381 | Bacteria | 4694 |
| 429 | Ga0268264_10059434 | 3300028381 | Bacteria | 3203 |
| 430 | Ga0307517_10069268 | 3300028786 | Bacteria | 3200 |
| 431 | Ga0307515_10000093 | 3300028794 | Bacteria | 212053 |
| 432 | Ga0307515_10000110 | 3300028794 | Bacteria | 195560 |
| 433 | Ga0307515_10001261 | 3300028794 | Bacteria | 57708 |
| 434 | Ga0307515_10002344 | 3300028794 | Bacteria | 41339 |
| 435 | Ga0307515_10004636 | 3300028794 | Bacteria | 28226 |
| 436 | Ga0307515_10009359 | 3300028794 | Bacteria | 18952 |
| 437 | Ga0307515_10011478 | 3300028794 | Bacteria | 16813 |
| 438 | Ga0307515_10095741 | 3300028794 | Bacteria | 3650 |
| 439 | Ga0307515_10121365 | 3300028794 | Bacteria | 2957 |
| 440 | Ga0307515_10266180 | 3300028794 | Bacteria | 1442 |
| 441 | Ga0307512_10052945 | 3300030522 | Bacteria | 3232 |
| 442 | Ga0316177_1127556 | 3300030731 | Bacteria | 4449 |
| 443 | Ga0316179_1097547 | 3300030734 | Bacteria | 2026 |
| 444 | Ga0316178_1094039 | 3300030735 | Bacteria | 3328 |
| 445 | Ga0316183_1057193 | 3300030742 | Bacteria | 2250 |
| 446 | Ga0316181_1035278 | 3300030744 | Bacteria | 8135 |
| 447 | Ga0265332_10000009 | 3300031238 | Bacteria | 295760 |
| 448 | Ga0307513_10004823 | 3300031456 | Bacteria | 17907 |
| 449 | Ga0307513_10053003 | 3300031456 | Bacteria | 4363 |
| 450 | Ga0307513_10125808 | 3300031456 | Bacteria | 2519 |
| 451 | Ga0307513_10182362 | 3300031456 | Bacteria | 1961 |
| 452 | Ga0307408_100029808 | 3300031548 | Bacteria | 3784 |
| 453 | Ga0307408_100205089 | 3300031548 | Bacteria | 1598 |
| 454 | Ga0307408_100240990 | 3300031548 | Bacteria | 1486 |
| 455 | Ga0307508_10000212 | 3300031616 | Bacteria | 70345 |
| 456 | Ga0307508_10002342 | 3300031616 | Bacteria | 20078 |
| 457 | Ga0307514_10001506 | 3300031649 | Bacteria | 27927 |
| 458 | Ga0307514_10005380 | 3300031649 | Bacteria | 11470 |
| 459 | Ga0307514_10014898 | 3300031649 | Bacteria | 6422 |
| 460 | Ga0307514_10085169 | 3300031649 | Bacteria | 2324 |
| 461 | Ga0307516_10000383 | 3300031730 | Bacteria | 57684 |
| 462 | Ga0307516_10003730 | 3300031730 | Bacteria | 19364 |
| 463 | Ga0307516_10006738 | 3300031730 | Bacteria | 13428 |
| 464 | Ga0307516_10074732 | 3300031730 | Bacteria | 3244 |
| 465 | Ga0307516_10087585 | 3300031730 | Bacteria | 2948 |
| 466 | Ga0307405_10001308 | 3300031731 | Bacteria | 10408 |
| 467 | Ga0307405_10057533 | 3300031731 | Bacteria | 2443 |
| 468 | Ga0307405_10165237 | 3300031731 | Bacteria | 1572 |
| 469 | Ga0307406_10000749 | 3300031901 | Bacteria | 18227 |
| 470 | Ga0307412_10010335 | 3300031911 | Bacteria | 5375 |
| 471 | Ga0307412_10018432 | 3300031911 | Bacteria | 4200 |
| 472 | Ga0307412_10129725 | 3300031911 | Bacteria | 1829 |
| 473 | Ga0307409_100001082 | 3300031995 | Bacteria | 12863 |
| 474 | Ga0307416_100009480 | 3300032002 | Bacteria | 6376 |
| 475 | Ga0307411_10000263 | 3300032005 | Bacteria | 17179 |
| 476 | Ga0307415_100029020 | 3300032126 | Bacteria | 3529 |
| 477 | Ga0307507_10057406 | 3300033179 | Bacteria | 3666 |
| 478 | Ga0373934_0005907 | 3300035086 | Bacteria | 4530 |
| 479 | Ga0373939_0000017 | 3300035114 | Bacteria | 61924 |
| 480 | Ga0373927_0101333 | 3300035695 | Bacteria | 1873 |
| 481 | Ga0373937_0011642 | 3300036401 | Bacteria | 7723 |
| 482 | Ga0373937_0049070 | 3300036401 | Bacteria | 3866 |
| 483 | Ga0373937_0135862 | 3300036401 | Bacteria | 2299 |
| 484 | Ga0316584_0066702 | 3300036712 | Bacteria | 2697 |
| 485 | Ga0373925_0048137 | 3300037068 | Bacteria | 3176 |
| 486 | Ga0395899_0007650 | 3300037312 | Bacteria | 8331 |
| 487 | Ga0395900_0000025 | 3300037418 | Bacteria | 321217 |
| 488 | Ga0395900_0001269 | 3300037418 | Bacteria | 30864 |
| 489 | Ga0395898_0203000 | 3300037466 | Bacteria | 1892 |
| 490 | Ga0395905_0000653 | 3300037471 | Bacteria | 46132 |
| 491 | Ga0395905_0000733 | 3300037471 | Bacteria | 43190 |
| 492 | Ga0395905_0002495 | 3300037471 | Bacteria | 20355 |
| 493 | Ga0395905_0004455 | 3300037471 | Bacteria | 14558 |
| 494 | Ga0395905_0014861 | 3300037471 | Bacteria | 7426 |
| 495 | Ga0395905_0035039 | 3300037471 | Bacteria | 4712 |
| 496 | Ga0395905_0083332 | 3300037471 | Bacteria | 2995 |
| 497 | Ga0395905_0101728 | 3300037471 | Bacteria | 2697 |
| 498 | Ga0395905_0227784 | 3300037471 | Bacteria | 1743 |
| 499 | Ga0395901_0014101 | 3300038443 | Bacteria | 8135 |
| 500 | Ga0395901_0014228 | 3300038443 | Bacteria | 8100 |
| 501 | Ga0400483_028483 | 3300039062 | Bacteria | 154566 |
| 502 | Ga0400483_196526 | 3300039062 | Bacteria | 30829 |
| 503 | Ga0400483_246213 | 3300039062 | Bacteria | 42716 |
| 504 | Ga0436365_1804558 | 3300039437 | Bacteria | 4403 |
| 505 | Ga0439466_0035434 | 3300041411 | Bacteria | 1688 |
| 506 | Ga0451795_0407166 | 3300041456 | Bacteria | 1516 |
| 507 | Ga0439442_000506 | 3300042002 | Bacteria | 8767 |
| 508 | Ga0439455_0010450 | 3300042012 | Bacteria | 2042 |
| 509 | Ga0439455_0020619 | 3300042012 | Bacteria | 1565 |
| 510 | Ga0450917_000785 | 3300042120 | Bacteria | 2341 |
| 511 | Ga0450888_000705 | 3300042126 | Bacteria | 3173 |
| 512 | Ga0450890_000638 | 3300042127 | Bacteria | 5088 |
| 513 | Ga0450890_003778 | 3300042127 | Bacteria | 1998 |
| 514 | Ga0450891_000250 | 3300042129 | Bacteria | 5464 |
| 515 | Ga0450889_000080 | 3300042144 | Bacteria | 8812 |
| 516 | Ga0450906_001292 | 3300042145 | Bacteria | 5495 |
| 517 | Ga0439446_0036223 | 3300042156 | Bacteria | 1441 |
| 518 | Ga0450908_010111 | 3300042184 | Bacteria | 1746 |
| 519 | Ga0439434_0009598 | 3300042435 | Bacteria | 2847 |
| 520 | Ga0450918_000592 | 3300042531 | Bacteria | 7761 |
| 521 | Ga0451577_0000142 | 3300042876 | Bacteria | 160598 |
| 522 | Ga0451577_0003554 | 3300042876 | Bacteria | 17210 |
| 523 | Ga0451577_0003800 | 3300042876 | Bacteria | 16436 |
| 524 | Ga0466969_0000036 | 3300044656 | Bacteria | 75718 |
| 525 | Ga0466972_0009924 | 3300044658 | Bacteria | 4779 |
| 526 | Ga0466972_0024981 | 3300044658 | Bacteria | 2964 |
| 527 | Ga0453683_0001682 | 3300044673 | Bacteria | 18444 |
| 528 | Ga0466966_0012015 | 3300044684 | Bacteria | 5738 |
| 529 | Ga0466966_0048027 | 3300044684 | Bacteria | 2719 |
| 530 | Ga0466961_0056528 | 3300044693 | Bacteria | 2500 |
| 531 | Ga0466961_0098762 | 3300044693 | Bacteria | 1840 |
| 532 | Ga0466963_0042254 | 3300044694 | Bacteria | 2992 |
| 533 | Ga0466963_0065228 | 3300044694 | Bacteria | 2441 |
| 534 | Ga0466964_0016916 | 3300044706 | Bacteria | 2788 |
| 535 | Ga0453684_0000126 | 3300044712 | Bacteria | 336395 |
| 536 | Ga0453684_0017882 | 3300044712 | Bacteria | 10939 |
| 537 | Ga0466971_0037475 | 3300044719 | Bacteria | 2173 |
| 538 | Ga0466971_0056549 | 3300044719 | Bacteria | 1769 |
| 539 | Ga0466957_0005480 | 3300044842 | Bacteria | 7119 |
| 540 | Ga0466957_0093427 | 3300044842 | Bacteria | 1888 |
| 541 | Ga0466959_0032070 | 3300045049 | Bacteria | 3888 |
| 542 | Ga0466959_0040866 | 3300045049 | Bacteria | 3425 |
| 543 | Ga0466959_0107438 | 3300045049 | Bacteria | 1994 |
| 544 | Ga0451576_0014283 | 3300045051 | Bacteria | 8844 |
| 545 | Ga0451576_0064322 | 3300045051 | Bacteria | 3821 |
| 546 | Ga0451576_0134538 | 3300045051 | Bacteria | 2577 |
| 547 | Ga0451576_0140528 | 3300045051 | Bacteria | 2518 |
| 548 | Ga0466958_0148551 | 3300045836 | Bacteria | 1478 |
| 549 | Ga0466967_0010743 | 3300045976 | Bacteria | 6884 |
| 550 | Ga0466967_0041274 | 3300045976 | Bacteria | 3977 |
| 551 | Ga0495627_006332 | 3300046453 | Bacteria | 4650 |
| 552 | Ga0495638_0024239 | 3300046460 | Bacteria | 3959 |
| 553 | Ga0495638_0123473 | 3300046460 | Bacteria | 1528 |
| 554 | Ga0495650_0003802 | 3300046471 | Bacteria | 10751 |
| 555 | Ga0495650_0080946 | 3300046471 | Bacteria | 1252 |
| 556 | Ga0495580_0123075 | 3300046472 | Bacteria | 1800 |
| 557 | Ga0495639_0018524 | 3300046475 | Bacteria | 3032 |
| 558 | Ga0495608_0113896 | 3300046511 | Bacteria | 1737 |
| 559 | Ga0495610_0075811 | 3300046512 | Bacteria | 1556 |
| 560 | Ga0495616_0002637 | 3300046513 | Bacteria | 11790 |
| 561 | Ga0495620_0086969 | 3300046515 | Bacteria | 1257 |
| 562 | Ga0495632_0004484 | 3300046519 | Bacteria | 9469 |
| 563 | Ga0495632_0052114 | 3300046519 | Bacteria | 2012 |
| 564 | Ga0495637_0004867 | 3300046520 | Bacteria | 6907 |
| 565 | Ga0495643_0048586 | 3300046522 | Bacteria | 2292 |
| 566 | Ga0495663_0022314 | 3300046525 | Bacteria | 1828 |
| 567 | Ga0495654_0022343 | 3300046530 | Bacteria | 3286 |
| 568 | Ga0495598_0043203 | 3300046537 | Bacteria | 1326 |
| 569 | Ga0495621_0022524 | 3300046539 | Bacteria | 2089 |
| 570 | Ga0495668_0110275 | 3300046616 | Bacteria | 1505 |
| 571 | Ga0495625_0000637 | 3300046660 | Bacteria | 50416 |
| 572 | Ga0495625_0021004 | 3300046660 | Bacteria | 5033 |
| 573 | Ga0495625_0133678 | 3300046660 | Bacteria | 1678 |
| 574 | Ga0495661_0081481 | 3300046665 | Bacteria | 1865 |
| 575 | Ga0495588_0005864 | 3300046674 | Bacteria | 5500 |
| 576 | Ga0495588_0017568 | 3300046674 | Bacteria | 3477 |
| 577 | Ga0495588_0029275 | 3300046674 | Bacteria | 2762 |
| 578 | Ga0495658_0058335 | 3300046683 | Bacteria | 2208 |
| 579 | Ga0495658_0068172 | 3300046683 | Bacteria | 2059 |
| 580 | Ga0495671_0008248 | 3300046692 | Bacteria | 5872 |
| 581 | Ga0495649_0071007 | 3300046694 | Bacteria | 1866 |
| 582 | Ga0495600_0146387 | 3300046809 | Bacteria | 1531 |
| 583 | Ga0495680_0086877 | 3300047322 | Bacteria | 2353 |
| 584 | Ga0495687_008669 | 3300047443 | Bacteria | 5792 |
| 585 | Ga0495684_0062759 | 3300047471 | Bacteria | 2826 |
| 586 | Ga0495684_0111202 | 3300047471 | Bacteria | 2067 |
| 587 | Ga0495593_0032224 | 3300047673 | Bacteria | 2858 |
| 588 | Ga0495626_0036928 | 3300048091 | Bacteria | 2325 |
| 589 | Ga0496100_0165933 | 3300048903 | Bacteria | 1586 |
| 590 | Ga0496101_0001014 | 3300048904 | Bacteria | 16554 |
| 591 | Ga0496101_0044216 | 3300048904 | Bacteria | 3186 |
| 592 | Ga0496102_0048010 | 3300048905 | Bacteria | 3881 |
| 593 | Ga0496102_0174882 | 3300048905 | Bacteria | 2021 |
| 594 | Ga0496104_0140458 | 3300048907 | Bacteria | 2320 |
| 595 | Ga0496105_0020999 | 3300048908 | Bacteria | 5281 |
| 596 | Ga0496105_0123977 | 3300048908 | Bacteria | 2130 |
| 597 | Ga0496106_0060061 | 3300048909 | Bacteria | 2881 |
| 598 | Ga0496108_0031835 | 3300048911 | Bacteria | 4378 |
| 599 | Ga0496108_0041875 | 3300048911 | Bacteria | 3824 |
| 600 | Ga0496109_0089425 | 3300048912 | Bacteria | 2847 |
| 601 | Ga0496110_0058417 | 3300048913 | Bacteria | 3398 |
| 602 | Ga0496112_0042744 | 3300048915 | Bacteria | 4435 |
| 603 | Ga0496113_0009957 | 3300048916 | Bacteria | 6264 |
| 604 | Ga0496114_0036202 | 3300048917 | Bacteria | 4079 |
| 605 | Ga0496114_0059887 | 3300048917 | Bacteria | 3181 |
| 606 | Ga0496116_0000570 | 3300048919 | Bacteria | 49416 |
| 607 | Ga0496116_0023532 | 3300048919 | Bacteria | 4585 |
| 608 | Ga0496117_0040746 | 3300048920 | Bacteria | 3411 |
| 609 | Ga0496117_0043935 | 3300048920 | Bacteria | 3241 |
| 610 | Ga0496117_0096473 | 3300048920 | Bacteria | 1886 |
| 611 | Ga0496118_0015239 | 3300048921 | Bacteria | 7130 |
| 612 | Ga0496118_0026715 | 3300048921 | Bacteria | 4908 |
| 613 | Ga0496121_0013227 | 3300048924 | Bacteria | 8892 |
| 614 | Ga0496121_0039089 | 3300048924 | Bacteria | 4188 |
| 615 | Ga0496121_0045368 | 3300048924 | Bacteria | 3778 |
| 616 | Ga0496122_0002024 | 3300048925 | Bacteria | 30109 |
| 617 | Ga0496122_0039252 | 3300048925 | Bacteria | 3778 |
| 618 | Ga0496122_0101312 | 3300048925 | Bacteria | 1924 |
| 619 | Ga0496123_0011766 | 3300048926 | Bacteria | 7537 |
| 620 | Ga0496123_0018667 | 3300048926 | Bacteria | 5500 |
| 621 | Ga0496124_0024458 | 3300048927 | Bacteria | 5489 |
| 622 | Ga0496124_0102595 | 3300048927 | Bacteria | 2315 |
| 623 | Ga0496125_0000692 | 3300048928 | Bacteria | 55634 |
| 624 | Ga0496125_0034947 | 3300048928 | Bacteria | 4421 |
| 625 | Ga0496126_0019096 | 3300048929 | Bacteria | 6761 |
| 626 | Ga0496126_0042569 | 3300048929 | Bacteria | 4194 |
| 627 | Ga0501292_002565 | 3300049515 | Bacteria | 2356 |
| 628 | Ga0501031_0001649 | 3300049568 | Bacteria | 14009 |
| 629 | Ga0501032_0179638 | 3300049569 | Bacteria | 1386 |
| 630 | Ga0501034_0171427 | 3300049571 | Bacteria | 2137 |
| 631 | Ga0501047_0120255 | 3300049581 | Bacteria | 2508 |
| 632 | Ga0501207_005005 | 3300049654 | Bacteria | 1822 |
| 633 | Ga0501252_002568 | 3300049682 | Bacteria | 1812 |
| 634 | Ga0501221_000660 | 3300049704 | Bacteria | 5522 |
| 635 | Ga0501225_0013115 | 3300049705 | Bacteria | 2321 |
| 636 | Ga0501262_001158 | 3300049759 | Bacteria | 2988 |
| 637 | Ga0501035_0073876 | 3300049822 | Bacteria | 3017 |
| 638 | nmdc:mga03683_19859_c1 | 3300050489 | Bacteria | 2570 |
| 639 | nmdc:mga03683_4269_c1 | 3300050489 | Bacteria | 4716 |
| 640 | nmdc:mga03n38_3734_c1 | 3300050490 | Bacteria | 4934 |
| 641 | nmdc:mga03n38_75546_c1 | 3300050490 | Bacteria | 1570 |
| 642 | nmdc:mga00v17_35597_c1 | 3300050491 | Bacteria | 2964 |
| 643 | nmdc:mga0k408_108117_c1 | 3300050493 | Bacteria | 1643 |
| 644 | nmdc:mga0k408_1348_c1 | 3300050493 | Bacteria | 13248 |
| 645 | nmdc:mga0k408_1609_c1 | 3300050493 | Bacteria | 12223 |
| 646 | nmdc:mga0k408_31664_c1 | 3300050493 | Bacteria | 3021 |
| 647 | nmdc:mga0k408_56026_c1 | 3300050493 | Bacteria | 2287 |
| 648 | nmdc:mga0k408_70567_c1 | 3300050493 | Bacteria | 2039 |
| 649 | nmdc:mga0k408_77738_c1 | 3300050493 | Bacteria | 1941 |
| 650 | nmdc:mga06z11_79403_c1 | 3300050494 | Bacteria | 1757 |
| 651 | nmdc:mga07m45_10243_c1 | 3300050496 | Bacteria | 4890 |
| 652 | nmdc:mga07m45_116752_c1 | 3300050496 | Bacteria | 1540 |
| 653 | nmdc:mga07m45_2177_c1 | 3300050496 | Bacteria | 9135 |
| 654 | nmdc:mga07m45_3112_c1 | 3300050496 | Bacteria | 7611 |
| 655 | nmdc:mga07m45_350_c1 | 3300050496 | Bacteria | 18847 |
| 656 | nmdc:mga07m45_49265_c1 | 3300050496 | Bacteria | 2371 |
| 657 | nmdc:mga07m45_7137_c1 | 3300050496 | Bacteria | 5690 |
| 658 | Ga0495601_0015291 | 3300053077 | Bacteria | 4638 |
| 659 | Ga0495601_0065074 | 3300053077 | Bacteria | 2320 |
| 660 | Ga0500610_0046780 | 3300053079 | Bacteria | 2247 |
| 661 | Ga0500610_0046782 | 3300053079 | Bacteria | 2247 |
| 662 | Ga0500635_0000105 | 3300053080 | Bacteria | 50250 |
| 663 | Ga0500578_0000049 | 3300053086 | Bacteria | 124281 |
| 664 | Ga0500643_011857 | 3300053087 | Bacteria | 3154 |
| 665 | Ga0500644_0006796 | 3300053088 | Bacteria | 2950 |
| 666 | Ga0500646_0021966 | 3300053090 | Bacteria | 1703 |
| 667 | Ga0500651_0000029 | 3300053093 | Bacteria | 113528 |
| 668 | Ga0500651_0011703 | 3300053093 | Bacteria | 5298 |
| 669 | Ga0500651_0115430 | 3300053093 | Bacteria | 1635 |
| 670 | Ga0500562_011167 | 3300053108 | Bacteria | 2281 |
| 671 | Ga0500569_023293 | 3300053109 | Bacteria | 1662 |
| 672 | Ga0500571_001234 | 3300053110 | Bacteria | 11738 |
| 673 | Ga0500593_000854 | 3300053117 | Bacteria | 11342 |
| 674 | Ga0500593_022053 | 3300053117 | Bacteria | 2810 |
| 675 | Ga0500594_0006689 | 3300053118 | Bacteria | 2596 |
| 676 | Ga0500607_004123 | 3300053121 | Bacteria | 10147 |
| 677 | Ga0500626_051227 | 3300053128 | Bacteria | 1857 |
| 678 | Ga0500628_003445 | 3300053129 | Bacteria | 2611 |
| 679 | Ga0500652_000044 | 3300053131 | Bacteria | 64309 |
| 680 | Ga0500655_000253 | 3300053133 | Bacteria | 12573 |
| 681 | Ga0500658_0000243 | 3300053134 | Bacteria | 25613 |
| 682 | Ga0500658_0000358 | 3300053134 | Bacteria | 20187 |
| 683 | Ga0500658_0018256 | 3300053134 | Bacteria | 2628 |
| 684 | Ga0500564_020611 | 3300053138 | Bacteria | 3016 |
| 685 | Ga0500568_0014882 | 3300053139 | Bacteria | 3497 |
| 686 | Ga0500568_0034139 | 3300053139 | Bacteria | 2082 |
| 687 | Ga0500590_002579 | 3300053148 | Bacteria | 8104 |
| 688 | Ga0500604_0007709 | 3300053151 | Bacteria | 2853 |
| 689 | Ga0500619_000120 | 3300053154 | Bacteria | 20611 |
| 690 | Ga0500622_0000128 | 3300053156 | Bacteria | 79659 |
| 691 | Ga0500622_0001231 | 3300053156 | Bacteria | 21000 |
| 692 | Ga0500627_0001256 | 3300053158 | Bacteria | 7015 |
| 693 | Ga0500634_0018405 | 3300053161 | Bacteria | 3751 |
| 694 | Ga0500638_022850 | 3300053162 | Bacteria | 2967 |
| 695 | Ga0500570_055631 | 3300053724 | Bacteria | 1955 |
| 696 | Ga0500587_004322 | 3300053739 | Bacteria | 1955 |
| 697 | Ga0466962_0009491 | 3300061719 | Bacteria | 4666 |
| 698 | Ga0466962_0015254 | 3300061719 | Bacteria | 3704 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042184 | Ga0450908_010111 | Ga0450908_010111_496_1671 | 319 |
| 2 | 3300025231 | Ga0207427_100846 | Ga0207427_10084616 | 336 |
| 3 | 3300050496 | nmdc:mga07m45_116752_c1 | nmdc:mga07m45_116752_c1_27_1121 | 351 |
| 4 | 3300003320 | rootH2_10019508 | rootH2_100195083 | 354 |
| 5 | 3300003752 | Ga0055539_1000459 | Ga0055539_10004594 | 354 |
| 6 | 3300003756 | Ga0055533_1000080 | Ga0055533_100008095 | 354 |
| 7 | 3300003759 | Ga0055525_1001686 | Ga0055525_10016863 | 354 |
| 8 | 3300025226 | Ga0209674_100003 | Ga0209674_1000031829 | 354 |
| 9 | 3300025230 | Ga0209563_100049 | Ga0209563_100049291 | 354 |
| 10 | 3300025253 | Ga0209677_100228 | Ga0209677_10022838 | 354 |
| 11 | 3300046537 | Ga0495598_0043203 | Ga0495598_0043203_207_1310 | 360 |
| 12 | 3300048924 | Ga0496121_0013227 | Ga0496121_0013227_1189_2367 | 361 |
| 13 | 3300048928 | Ga0496125_0034947 | Ga0496125_0034947_2729_3907 | 361 |
| 14 | 3300053139 | Ga0500568_0034139 | Ga0500568_0034139_22_1113 | 361 |
| 15 | 3300028794 | Ga0307515_10001261 | Ga0307515_100012617 | 367 |
| 16 | 3300031649 | Ga0307514_10005380 | Ga0307514_1000538011 | 367 |
| 17 | 3300005367 | Ga0070667_100105980 | Ga0070667_1001059802 | 369 |
| 18 | 3300005843 | Ga0068860_100028441 | Ga0068860_1000284413 | 369 |
| 19 | 3300028381 | Ga0268264_10026955 | Ga0268264_100269552 | 369 |
| 20 | 3300050493 | nmdc:mga0k408_77738_c1 | nmdc:mga0k408_77738_c1_490_1707 | 369 |
| 21 | 3300005563 | Ga0068855_100103267 | Ga0068855_1001032674 | 371 |
| 22 | 3300025949 | Ga0207667_10116090 | Ga0207667_101160902 | 371 |
| 23 | 3300046471 | Ga0495650_0003802 | Ga0495650_0003802_1697_2923 | 371 |
| 24 | 3300037466 | Ga0395898_0203000 | Ga0395898_0203000_143_1399 | 373 |
| 25 | 3300038443 | Ga0395901_0014101 | Ga0395901_0014101_6606_7862 | 373 |
| 26 | 3300044658 | Ga0466972_0009924 | Ga0466972_0009924_1757_2980 | 374 |
| 27 | 3300005457 | Ga0070662_100004821 | Ga0070662_1000048212 | 375 |
| 28 | 3300025933 | Ga0207706_10002276 | Ga0207706_1000227614 | 375 |
| 29 | 3300035086 | Ga0373934_0005907 | Ga0373934_0005907_241_1497 | 375 |
| 30 | 3300042120 | Ga0450917_000785 | Ga0450917_000785_425_1648 | 375 |
| 31 | 3300042127 | Ga0450890_003778 | Ga0450890_003778_403_1626 | 375 |
| 32 | 3300042129 | Ga0450891_000250 | Ga0450891_000250_627_1850 | 375 |
| 33 | 3300042144 | Ga0450889_000080 | Ga0450889_000080_5217_6440 | 375 |
| 34 | 3300046616 | Ga0495668_0110275 | Ga0495668_0110275_55_1239 | 375 |
| 35 | 3300042126 | Ga0450888_000705 | Ga0450888_000705_1080_2303 | 376 |
| 36 | 3300003323 | rootH1_10022291 | rootH1_100222913 | 377 |
| 37 | 3300005336 | Ga0070680_100003562 | Ga0070680_1000035623 | 377 |
| 38 | 3300005458 | Ga0070681_10079088 | Ga0070681_100790884 | 377 |
| 39 | 3300025912 | Ga0207707_10036154 | Ga0207707_100361544 | 377 |
| 40 | 3300025917 | Ga0207660_10017896 | Ga0207660_100178966 | 377 |
| 41 | 3300025921 | Ga0207652_10004261 | Ga0207652_100042616 | 377 |
| 42 | 3300028794 | Ga0307515_10011478 | Ga0307515_1001147822 | 377 |
| 43 | 3300031616 | Ga0307508_10000212 | Ga0307508_1000021243 | 377 |
| 44 | 3300037471 | Ga0395905_0035039 | Ga0395905_0035039_2226_3524 | 377 |
| 45 | 3300037471 | Ga0395905_0101728 | Ga0395905_0101728_1398_2627 | 377 |
| 46 | 3300006038 | Ga0075365_10038179 | Ga0075365_100381792 | 378 |
| 47 | 3300006048 | Ga0075363_100035069 | Ga0075363_1000350693 | 378 |
| 48 | 3300006177 | Ga0075362_10001536 | Ga0075362_100015365 | 378 |
| 49 | 3300006195 | Ga0075366_10050324 | Ga0075366_100503242 | 378 |
| 50 | 3300027866 | Ga0209813_10004852 | Ga0209813_100048523 | 378 |
| 51 | 3300031548 | Ga0307408_100240990 | Ga0307408_1002409902 | 378 |
| 52 | 3300031911 | Ga0307412_10010335 | Ga0307412_100103352 | 378 |
| 53 | 3300031995 | Ga0307409_100001082 | Ga0307409_10000108214 | 378 |
| 54 | 3300032002 | Ga0307416_100009480 | Ga0307416_1000094804 | 378 |
| 55 | 3300032126 | Ga0307415_100029020 | Ga0307415_1000290203 | 378 |
| 56 | 3300037471 | Ga0395905_0002495 | Ga0395905_0002495_2029_3249 | 378 |
| 57 | 3300050493 | nmdc:mga0k408_108117_c1 | nmdc:mga0k408_108117_c1_103_1323 | 378 |
| 58 | 3300053117 | Ga0500593_000854 | Ga0500593_000854_9130_10311 | 378 |
| 59 | 3300005339 | Ga0070660_100221488 | Ga0070660_1002214882 | 379 |
| 60 | 3300005344 | Ga0070661_100000925 | Ga0070661_1000009254 | 379 |
| 61 | 3300005539 | Ga0068853_100179227 | Ga0068853_1001792271 | 379 |
| 62 | 3300005564 | Ga0070664_100000939 | Ga0070664_10000093924 | 379 |
| 63 | 3300005577 | Ga0068857_100054500 | Ga0068857_1000545004 | 379 |
| 64 | 3300009147 | Ga0114129_10753013 | Ga0114129_107530131 | 379 |
| 65 | 3300010375 | Ga0105239_10112957 | Ga0105239_101129573 | 379 |
| 66 | 3300025920 | Ga0207649_10001141 | Ga0207649_1000114114 | 379 |
| 67 | 3300025932 | Ga0207690_10007376 | Ga0207690_100073764 | 379 |
| 68 | 3300025945 | Ga0207679_10000201 | Ga0207679_1000020134 | 379 |
| 69 | 3300026041 | Ga0207639_10142245 | Ga0207639_101422452 | 379 |
| 70 | 3300026067 | Ga0207678_10183439 | Ga0207678_101834393 | 379 |
| 71 | 3300026116 | Ga0207674_10147027 | Ga0207674_101470272 | 379 |
| 72 | 3300037471 | Ga0395905_0014861 | Ga0395905_0014861_3186_4466 | 379 |
| 73 | 3300049569 | Ga0501032_0179638 | Ga0501032_0179638_36_1247 | 379 |
| 74 | 3300049581 | Ga0501047_0120255 | Ga0501047_0120255_351_1562 | 379 |
| 75 | 3300050491 | nmdc:mga00v17_35597_c1 | nmdc:mga00v17_35597_c1_246_1433 | 379 |
| 76 | 3300050496 | nmdc:mga07m45_49265_c1 | nmdc:mga07m45_49265_c1_691_1878 | 379 |
| 77 | 3300036712 | Ga0316584_0066702 | Ga0316584_0066702_407_1627 | 380 |
| 78 | 3300031456 | Ga0307513_10053003 | Ga0307513_100530035 | 381 |
| 79 | 3300048925 | Ga0496122_0039252 | Ga0496122_0039252_105_1274 | 381 |
| 80 | 3300050493 | nmdc:mga0k408_70567_c1 | nmdc:mga0k408_70567_c1_20_1237 | 381 |
| 81 | 3300003316 | rootH1_10007839 | rootH1_100078393 | 382 |
| 82 | 3300006195 | Ga0075366_10003846 | Ga0075366_100038464 | 382 |
| 83 | 3300006353 | Ga0075370_10000415 | Ga0075370_100004154 | 382 |
| 84 | 3300042876 | Ga0451577_0003554 | Ga0451577_0003554_14940_16157 | 382 |
| 85 | 3300046519 | Ga0495632_0004484 | Ga0495632_0004484_15_1169 | 382 |
| 86 | 3300048919 | Ga0496116_0000570 | Ga0496116_0000570_25294_26565 | 382 |
| 87 | 3300048925 | Ga0496122_0002024 | Ga0496122_0002024_3250_4521 | 382 |
| 88 | 3300048926 | Ga0496123_0011766 | Ga0496123_0011766_1113_2384 | 382 |
| 89 | 3300048929 | Ga0496126_0019096 | Ga0496126_0019096_4826_6097 | 382 |
| 90 | 3300050496 | nmdc:mga07m45_350_c1 | nmdc:mga07m45_350_c1_13553_14803 | 382 |
| 91 | iso_pu_bacteria | 2643221658 | 2644328763 | 382 |
| 92 | 3300031649 | Ga0307514_10014898 | Ga0307514_100148985 | 383 |
| 93 | 3300053080 | Ga0500635_0000105 | Ga0500635_0000105_13380_14597 | 383 |
| 94 | 3300005543 | Ga0070672_100173261 | Ga0070672_1001732612 | 384 |
| 95 | 3300014969 | Ga0157376_10021468 | Ga0157376_100214683 | 384 |
| 96 | 3300025321 | Ga0207656_10020715 | Ga0207656_100207152 | 384 |
| 97 | 3300026067 | Ga0207678_10066914 | Ga0207678_100669143 | 384 |
| 98 | 3300037312 | Ga0395899_0007650 | Ga0395899_0007650_6966_8192 | 384 |
| 99 | 3300037418 | Ga0395900_0001269 | Ga0395900_0001269_22772_23998 | 384 |
| 100 | 3300038443 | Ga0395901_0014228 | Ga0395901_0014228_6552_7778 | 384 |
| 101 | 3300048924 | Ga0496121_0045368 | Ga0496121_0045368_808_2079 | 384 |
| 102 | 3300044673 | Ga0453683_0001682 | Ga0453683_0001682_14306_15550 | 385 |
| 103 | 3300045051 | Ga0451576_0064322 | Ga0451576_0064322_1344_2588 | 385 |
| 104 | 3300048917 | Ga0496114_0036202 | Ga0496114_0036202_461_1675 | 385 |
| 105 | 3300005355 | Ga0070671_100010921 | Ga0070671_1000109213 | 386 |
| 106 | 3300005539 | Ga0068853_100005208 | Ga0068853_1000052089 | 386 |
| 107 | 3300009177 | Ga0105248_10066801 | Ga0105248_100668014 | 386 |
| 108 | 3300011119 | Ga0105246_10088977 | Ga0105246_100889774 | 386 |
| 109 | 3300015262 | Ga0182007_10000825 | Ga0182007_1000082520 | 386 |
| 110 | 3300025901 | Ga0207688_10029556 | Ga0207688_100295562 | 386 |
| 111 | 3300026041 | Ga0207639_10046919 | Ga0207639_100469193 | 386 |
| 112 | 3300042012 | Ga0439455_0020619 | Ga0439455_0020619_264_1433 | 386 |
| 113 | 3300046512 | Ga0495610_0075811 | Ga0495610_0075811_18_1190 | 386 |
| 114 | 3300046539 | Ga0495621_0022524 | Ga0495621_0022524_130_1302 | 386 |
| 115 | 3300046660 | Ga0495625_0133678 | Ga0495625_0133678_91_1263 | 386 |
| 116 | 3300046674 | Ga0495588_0029275 | Ga0495588_0029275_827_1999 | 386 |
| 117 | 3300048920 | Ga0496117_0043935 | Ga0496117_0043935_2048_3217 | 386 |
| 118 | 3300048921 | Ga0496118_0015239 | Ga0496118_0015239_4408_5577 | 386 |
| 119 | 3300048924 | Ga0496121_0039089 | Ga0496121_0039089_943_2115 | 386 |
| 120 | 3300048925 | Ga0496122_0101312 | Ga0496122_0101312_312_1484 | 386 |
| 121 | 3300048927 | Ga0496124_0024458 | Ga0496124_0024458_3901_5070 | 386 |
| 122 | 3300053133 | Ga0500655_000253 | Ga0500655_000253_1686_2858 | 386 |
| 123 | 3300053162 | Ga0500638_022850 | Ga0500638_022850_448_1620 | 386 |
| 124 | iso_pu_bacteria | 2886848708 | 2886853602 | 386 |
| 125 | 3300037471 | Ga0395905_0000653 | Ga0395905_0000653_13561_14751 | 387 |
| 126 | 3300048905 | Ga0496102_0048010 | Ga0496102_0048010_977_2197 | 387 |
| 127 | 3300048927 | Ga0496124_0102595 | Ga0496124_0102595_421_1599 | 387 |
| 128 | iso_pu_bacteria | 2585428058 | 2587731912 | 387 |
| 129 | 3300031731 | Ga0307405_10165237 | Ga0307405_101652371 | 388 |
| 130 | 3300031911 | Ga0307412_10018432 | Ga0307412_100184322 | 388 |
| 131 | 3300049759 | Ga0501262_001158 | Ga0501262_001158_56_1279 | 388 |
| 132 | iso_pu_bacteria | 2643221644 | 2644249024 | 388 |
| 133 | 3300006042 | Ga0075368_10037925 | Ga0075368_100379252 | 389 |
| 134 | 3300006048 | Ga0075363_100069036 | Ga0075363_1000690362 | 389 |
| 135 | 3300006178 | Ga0075367_10105277 | Ga0075367_101052772 | 389 |
| 136 | 3300006353 | Ga0075370_10000695 | Ga0075370_1000069510 | 389 |
| 137 | 3300031730 | Ga0307516_10074732 | Ga0307516_100747322 | 389 |
| 138 | 3300050490 | nmdc:mga03n38_3734_c1 | nmdc:mga03n38_3734_c1_1520_2734 | 389 |
| 139 | 3300050493 | nmdc:mga0k408_56026_c1 | nmdc:mga0k408_56026_c1_1022_2236 | 389 |
| 140 | 3300050494 | nmdc:mga06z11_79403_c1 | nmdc:mga06z11_79403_c1_220_1434 | 389 |
| 141 | 3300050496 | nmdc:mga07m45_2177_c1 | nmdc:mga07m45_2177_c1_1810_3027 | 389 |
| 142 | 3300005353 | Ga0070669_100093833 | Ga0070669_1000938332 | 390 |
| 143 | 3300005459 | Ga0068867_100038718 | Ga0068867_1000387182 | 390 |
| 144 | 3300005563 | Ga0068855_100009834 | Ga0068855_1000098347 | 390 |
| 145 | 3300005844 | Ga0068862_100061533 | Ga0068862_1000615334 | 390 |
| 146 | 3300014326 | Ga0157380_10157891 | Ga0157380_101578912 | 390 |
| 147 | 3300025949 | Ga0207667_10003340 | Ga0207667_1000334015 | 390 |
| 148 | 3300026089 | Ga0207648_10016909 | Ga0207648_100169093 | 390 |
| 149 | 3300046475 | Ga0495639_0018524 | Ga0495639_0018524_625_1938 | 390 |
| 150 | 3300046511 | Ga0495608_0113896 | Ga0495608_0113896_234_1547 | 390 |
| 151 | 3300005262 | Ga0065165_1003676 | Ga0065165_10036763 | 391 |
| 152 | 3300025273 | Ga0209673_1014477 | Ga0209673_10144774 | 391 |
| 153 | 3300025298 | Ga0209050_1000672 | Ga0209050_100067238 | 391 |
| 154 | 3300025303 | Ga0209051_1014665 | Ga0209051_10146652 | 391 |
| 155 | 3300041456 | Ga0451795_0407166 | Ga0451795_0407166_319_1500 | 391 |
| 156 | 3300046519 | Ga0495632_0052114 | Ga0495632_0052114_532_1746 | 391 |
| 157 | 3300046694 | Ga0495649_0071007 | Ga0495649_0071007_425_1639 | 391 |
| 158 | 3300050493 | nmdc:mga0k408_31664_c1 | nmdc:mga0k408_31664_c1_1743_2924 | 391 |
| 159 | 3300050496 | nmdc:mga07m45_10243_c1 | nmdc:mga07m45_10243_c1_13_1194 | 391 |
| 160 | 3300053086 | Ga0500578_0000049 | Ga0500578_0000049_82652_83833 | 391 |
| 161 | 3300053090 | Ga0500646_0021966 | Ga0500646_0021966_476_1657 | 391 |
| 162 | 3300053093 | Ga0500651_0115430 | Ga0500651_0115430_325_1506 | 391 |
| 163 | 3300053156 | Ga0500622_0000128 | Ga0500622_0000128_54524_55705 | 391 |
| 164 | 3300002773 | JGI25152J39213_1000898 | JGI25152J39213_100089813 | 392 |
| 165 | 3300003771 | Ga0055526_1000542 | Ga0055526_100054217 | 392 |
| 166 | 3300003775 | Ga0055524_1000084 | Ga0055524_10000846 | 392 |
| 167 | 3300003841 | Ga0055541_1002116 | Ga0055541_10021164 | 392 |
| 168 | 3300005262 | Ga0065165_1030210 | Ga0065165_10302103 | 392 |
| 169 | 3300005455 | Ga0070663_100000949 | Ga0070663_1000009499 | 392 |
| 170 | 3300006048 | Ga0075363_100056246 | Ga0075363_1000562463 | 392 |
| 171 | 3300006195 | Ga0075366_10001350 | Ga0075366_100013508 | 392 |
| 172 | 3300013296 | Ga0157374_10009590 | Ga0157374_100095902 | 392 |
| 173 | 3300025225 | Ga0209566_100238 | Ga0209566_10023814 | 392 |
| 174 | 3300025258 | Ga0209129_1000041 | Ga0209129_1000041171 | 392 |
| 175 | 3300025295 | Ga0209564_1000029 | Ga0209564_1000029317 | 392 |
| 176 | 3300025297 | Ga0209758_1000043 | Ga0209758_1000043123 | 392 |
| 177 | 3300026067 | Ga0207678_10000522 | Ga0207678_1000052222 | 392 |
| 178 | 3300028794 | Ga0307515_10000093 | Ga0307515_1000009340 | 392 |
| 179 | 3300028794 | Ga0307515_10004636 | Ga0307515_100046363 | 392 |
| 180 | 3300028794 | Ga0307515_10266180 | Ga0307515_102661801 | 392 |
| 181 | 3300030522 | Ga0307512_10052945 | Ga0307512_100529453 | 392 |
| 182 | 3300031456 | Ga0307513_10004823 | Ga0307513_100048232 | 392 |
| 183 | 3300031616 | Ga0307508_10002342 | Ga0307508_1000234212 | 392 |
| 184 | 3300031730 | Ga0307516_10003730 | Ga0307516_1000373015 | 392 |
| 185 | 3300031730 | Ga0307516_10006738 | Ga0307516_100067386 | 392 |
| 186 | 3300033179 | Ga0307507_10057406 | Ga0307507_100574065 | 392 |
| 187 | 3300046471 | Ga0495650_0080946 | Ga0495650_0080946_33_1217 | 392 |
| 188 | 3300046522 | Ga0495643_0048586 | Ga0495643_0048586_301_1485 | 392 |
| 189 | 3300053739 | Ga0500587_004322 | Ga0500587_004322_382_1566 | 392 |
| 190 | 3300005328 | Ga0070676_10008798 | Ga0070676_100087982 | 393 |
| 191 | 3300005330 | Ga0070690_100060008 | Ga0070690_1000600083 | 393 |
| 192 | 3300005331 | Ga0070670_100078288 | Ga0070670_1000782882 | 393 |
| 193 | 3300005333 | Ga0070677_10066794 | Ga0070677_100667942 | 393 |
| 194 | 3300005334 | Ga0068869_100016845 | Ga0068869_1000168455 | 393 |
| 195 | 3300005335 | Ga0070666_10002405 | Ga0070666_100024055 | 393 |
| 196 | 3300005335 | Ga0070666_10009812 | Ga0070666_100098126 | 393 |
| 197 | 3300005347 | Ga0070668_100005104 | Ga0070668_10000510411 | 393 |
| 198 | 3300005353 | Ga0070669_100008394 | Ga0070669_1000083945 | 393 |
| 199 | 3300005354 | Ga0070675_100000199 | Ga0070675_1000001999 | 393 |
| 200 | 3300005356 | Ga0070674_100002083 | Ga0070674_1000020835 | 393 |
| 201 | 3300005364 | Ga0070673_100008889 | Ga0070673_1000088893 | 393 |
| 202 | 3300005367 | Ga0070667_100001982 | Ga0070667_10000198216 | 393 |
| 203 | 3300005456 | Ga0070678_100016273 | Ga0070678_1000162734 | 393 |
| 204 | 3300005459 | Ga0068867_100003310 | Ga0068867_1000033105 | 393 |
| 205 | 3300005459 | Ga0068867_100017655 | Ga0068867_1000176553 | 393 |
| 206 | 3300005539 | Ga0068853_100347193 | Ga0068853_1003471931 | 393 |
| 207 | 3300005543 | Ga0070672_100002369 | Ga0070672_1000023695 | 393 |
| 208 | 3300005564 | Ga0070664_100052960 | Ga0070664_1000529603 | 393 |
| 209 | 3300005616 | Ga0068852_100039765 | Ga0068852_1000397655 | 393 |
| 210 | 3300005616 | Ga0068852_100052008 | Ga0068852_1000520084 | 393 |
| 211 | 3300005617 | Ga0068859_100016607 | Ga0068859_1000166076 | 393 |
| 212 | 3300005618 | Ga0068864_100000354 | Ga0068864_10000035420 | 393 |
| 213 | 3300005718 | Ga0068866_10058734 | Ga0068866_100587342 | 393 |
| 214 | 3300005719 | Ga0068861_100005261 | Ga0068861_1000052615 | 393 |
| 215 | 3300005841 | Ga0068863_100011545 | Ga0068863_1000115452 | 393 |
| 216 | 3300005842 | Ga0068858_100000262 | Ga0068858_10000026222 | 393 |
| 217 | 3300005842 | Ga0068858_100008391 | Ga0068858_1000083917 | 393 |
| 218 | 3300005843 | Ga0068860_100074043 | Ga0068860_1000740434 | 393 |
| 219 | 3300005844 | Ga0068862_100024627 | Ga0068862_1000246272 | 393 |
| 220 | 3300006358 | Ga0068871_100051800 | Ga0068871_1000518004 | 393 |
| 221 | 3300006881 | Ga0068865_100013265 | Ga0068865_1000132656 | 393 |
| 222 | 3300006931 | Ga0097620_100016607 | Ga0097620_1000166076 | 393 |
| 223 | 3300006946 | Ga0079104_1022553 | Ga0079104_10225533 | 393 |
| 224 | 3300009176 | Ga0105242_10091692 | Ga0105242_100916922 | 393 |
| 225 | 3300009177 | Ga0105248_10026083 | Ga0105248_100260836 | 393 |
| 226 | 3300009177 | Ga0105248_10083454 | Ga0105248_100834545 | 393 |
| 227 | 3300013104 | Ga0157370_10131317 | Ga0157370_101313173 | 393 |
| 228 | 3300013296 | Ga0157374_10008718 | Ga0157374_100087184 | 393 |
| 229 | 3300013297 | Ga0157378_10242282 | Ga0157378_102422821 | 393 |
| 230 | 3300013306 | Ga0163162_10003584 | Ga0163162_1000358411 | 393 |
| 231 | 3300013306 | Ga0163162_10006364 | Ga0163162_100063645 | 393 |
| 232 | 3300013308 | Ga0157375_10005659 | Ga0157375_1000565910 | 393 |
| 233 | 3300013308 | Ga0157375_10015677 | Ga0157375_100156776 | 393 |
| 234 | 3300014325 | Ga0163163_10079734 | Ga0163163_100797342 | 393 |
| 235 | 3300014968 | Ga0157379_10002033 | Ga0157379_1000203311 | 393 |
| 236 | 3300014968 | Ga0157379_10004639 | Ga0157379_100046395 | 393 |
| 237 | 3300014969 | Ga0157376_10011894 | Ga0157376_100118945 | 393 |
| 238 | 3300017792 | Ga0163161_10009786 | Ga0163161_100097865 | 393 |
| 239 | 3300025899 | Ga0207642_10015239 | Ga0207642_100152394 | 393 |
| 240 | 3300025903 | Ga0207680_10005119 | Ga0207680_100051194 | 393 |
| 241 | 3300025903 | Ga0207680_10032011 | Ga0207680_100320111 | 393 |
| 242 | 3300025907 | Ga0207645_10003951 | Ga0207645_100039518 | 393 |
| 243 | 3300025923 | Ga0207681_10001915 | Ga0207681_100019159 | 393 |
| 244 | 3300025925 | Ga0207650_10059135 | Ga0207650_100591352 | 393 |
| 245 | 3300025926 | Ga0207659_10001828 | Ga0207659_1000182812 | 393 |
| 246 | 3300025926 | Ga0207659_10027698 | Ga0207659_100276982 | 393 |
| 247 | 3300025933 | Ga0207706_10013403 | Ga0207706_100134035 | 393 |
| 248 | 3300025933 | Ga0207706_10176074 | Ga0207706_101760743 | 393 |
| 249 | 3300025935 | Ga0207709_10023429 | Ga0207709_100234293 | 393 |
| 250 | 3300025940 | Ga0207691_10014538 | Ga0207691_100145385 | 393 |
| 251 | 3300025941 | Ga0207711_10084753 | Ga0207711_100847531 | 393 |
| 252 | 3300025942 | Ga0207689_10033478 | Ga0207689_100334782 | 393 |
| 253 | 3300025960 | Ga0207651_10005930 | Ga0207651_100059308 | 393 |
| 254 | 3300025961 | Ga0207712_10001833 | Ga0207712_1000183310 | 393 |
| 255 | 3300025986 | Ga0207658_10000336 | Ga0207658_1000033615 | 393 |
| 256 | 3300025986 | Ga0207658_10031032 | Ga0207658_100310324 | 393 |
| 257 | 3300026023 | Ga0207677_10030695 | Ga0207677_100306952 | 393 |
| 258 | 3300026035 | Ga0207703_10000277 | Ga0207703_1000027713 | 393 |
| 259 | 3300026035 | Ga0207703_10000866 | Ga0207703_1000086610 | 393 |
| 260 | 3300026041 | Ga0207639_10218115 | Ga0207639_102181152 | 393 |
| 261 | 3300026075 | Ga0207708_10044572 | Ga0207708_100445724 | 393 |
| 262 | 3300026095 | Ga0207676_10001342 | Ga0207676_1000134220 | 393 |
| 263 | 3300026095 | Ga0207676_10165952 | Ga0207676_101659522 | 393 |
| 264 | 3300026118 | Ga0207675_100012833 | Ga0207675_1000128335 | 393 |
| 265 | 3300026142 | Ga0207698_10015587 | Ga0207698_100155875 | 393 |
| 266 | 3300026142 | Ga0207698_10151905 | Ga0207698_101519052 | 393 |
| 267 | 3300028380 | Ga0268265_10010320 | Ga0268265_100103202 | 393 |
| 268 | 3300028381 | Ga0268264_10001554 | Ga0268264_100015549 | 393 |
| 269 | 3300028381 | Ga0268264_10059434 | Ga0268264_100594344 | 393 |
| 270 | 3300044694 | Ga0466963_0065228 | Ga0466963_0065228_797_2053 | 393 |
| 271 | 3300044712 | Ga0453684_0017882 | Ga0453684_0017882_2249_3436 | 393 |
| 272 | 3300046660 | Ga0495625_0021004 | Ga0495625_0021004_339_1565 | 393 |
| 273 | 3300047443 | Ga0495687_008669 | Ga0495687_008669_1045_2259 | 393 |
| 274 | 3300048091 | Ga0495626_0036928 | Ga0495626_0036928_894_2108 | 393 |
| 275 | 3300048911 | Ga0496108_0041875 | Ga0496108_0041875_2051_3265 | 393 |
| 276 | 3300048913 | Ga0496110_0058417 | Ga0496110_0058417_822_2036 | 393 |
| 277 | 3300053134 | Ga0500658_0018256 | Ga0500658_0018256_319_1533 | 393 |
| 278 | 3300053148 | Ga0500590_002579 | Ga0500590_002579_5041_6228 | 393 |
| 279 | 3300003322 | rootL2_10014298 | rootL2_1001429811 | 394 |
| 280 | 3300003771 | Ga0055526_1002456 | Ga0055526_100245611 | 394 |
| 281 | 3300006358 | Ga0068871_100063594 | Ga0068871_1000635943 | 394 |
| 282 | 3300025295 | Ga0209564_1000003 | Ga0209564_10000031180 | 394 |
| 283 | 3300025321 | Ga0207656_10074611 | Ga0207656_100746112 | 394 |
| 284 | 3300025945 | Ga0207679_10092092 | Ga0207679_100920922 | 394 |
| 285 | 3300031730 | Ga0307516_10000383 | Ga0307516_100003837 | 394 |
| 286 | 3300044658 | Ga0466972_0024981 | Ga0466972_0024981_263_1450 | 394 |
| 287 | 3300044693 | Ga0466961_0056528 | Ga0466961_0056528_888_2078 | 394 |
| 288 | 3300044719 | Ga0466971_0037475 | Ga0466971_0037475_652_1842 | 394 |
| 289 | 3300044842 | Ga0466957_0093427 | Ga0466957_0093427_137_1327 | 394 |
| 290 | 3300045049 | Ga0466959_0107438 | Ga0466959_0107438_713_1903 | 394 |
| 291 | 3300045836 | Ga0466958_0148551 | Ga0466958_0148551_20_1210 | 394 |
| 292 | 3300046460 | Ga0495638_0123473 | Ga0495638_0123473_73_1263 | 394 |
| 293 | 3300048912 | Ga0496109_0089425 | Ga0496109_0089425_10_1233 | 394 |
| 294 | 3300049822 | Ga0501035_0073876 | Ga0501035_0073876_1676_2863 | 394 |
| 295 | 3300050489 | nmdc:mga03683_4269_c1 | nmdc:mga03683_4269_c1_1770_3005 | 394 |
| 296 | 3300061719 | Ga0466962_0009491 | Ga0466962_0009491_2087_3277 | 394 |
| 297 | iso_pu_bacteria | 2547132103 | 2547372187 | 394 |
| 298 | iso_pu_bacteria | 2643221580 | 2643911416 | 394 |
| 299 | iso_pu_bacteria | 2843690924 | 2843693349 | 394 |
| 300 | 3300005459 | Ga0068867_100000077 | Ga0068867_10000007729 | 395 |
| 301 | 3300014745 | Ga0157377_10000094 | Ga0157377_1000009424 | 395 |
| 302 | 3300026089 | Ga0207648_10000193 | Ga0207648_1000019324 | 395 |
| 303 | 3300028794 | Ga0307515_10009359 | Ga0307515_1000935915 | 395 |
| 304 | 3300037471 | Ga0395905_0083332 | Ga0395905_0083332_132_1325 | 395 |
| 305 | 3300039062 | Ga0400483_028483 | Ga0400483_028483_5965_7176 | 395 |
| 306 | 3300039062 | Ga0400483_196526 | Ga0400483_196526_7132_8343 | 395 |
| 307 | 3300039062 | Ga0400483_246213 | Ga0400483_246213_1182_2408 | 395 |
| 308 | 3300045976 | Ga0466967_0010743 | Ga0466967_0010743_1499_2746 | 395 |
| 309 | 3300006353 | Ga0075370_10006626 | Ga0075370_100066266 | 396 |
| 310 | 3300031238 | Ga0265332_10000009 | Ga0265332_10000009207 | 396 |
| 311 | 3300042876 | Ga0451577_0000142 | Ga0451577_0000142_41585_42784 | 396 |
| 312 | 3300044712 | Ga0453684_0000126 | Ga0453684_0000126_217382_218581 | 396 |
| 313 | 3300048928 | Ga0496125_0000692 | Ga0496125_0000692_35599_36816 | 396 |
| 314 | iso_pu_bacteria | 2585428057 | 2587727141 | 396 |
| 315 | iso_pu_bacteria | 2588253510 | 2588291551 | 396 |
| 316 | iso_pu_bacteria | 2643221592 | 2643970683 | 396 |
| 317 | iso_pu_bacteria | 2643221625 | 2644139035 | 396 |
| 318 | iso_pu_bacteria | 2643221648 | 2644274645 | 396 |
| 319 | iso_pu_bacteria | 2932401849 | 2932402901 | 396 |
| 320 | iso_pu_bacteria | 2585428062 | 2587757529 | 397 |
| 321 | iso_pu_bacteria | 2643221544 | 2643745749 | 397 |
| 322 | iso_pu_bacteria | 2643221585 | 2643936822 | 397 |
| 323 | iso_pu_bacteria | 2643221629 | 2644167751 | 397 |
| 324 | iso_pu_bacteria | 2643221639 | 2644221653 | 397 |
| 325 | iso_pu_bacteria | 2643221646 | 2644257582 | 397 |
| 326 | iso_pu_bacteria | 2643221656 | 2644318723 | 397 |
| 327 | iso_pu_bacteria | 2738541337 | 2739058568 | 397 |
| 328 | 3300003187 | JGI25151J46595_10007994 | JGI25151J46595_100079942 | 398 |
| 329 | 3300003316 | rootH1_10006805 | rootH1_100068052 | 398 |
| 330 | 3300003761 | Ga0055535_1000198 | Ga0055535_100019841 | 398 |
| 331 | 3300003763 | Ga0055529_1000449 | Ga0055529_100044910 | 398 |
| 332 | 3300003781 | Ga0055536_1010072 | Ga0055536_10100723 | 398 |
| 333 | 3300003792 | Ga0055540_1007552 | Ga0055540_10075523 | 398 |
| 334 | 3300006048 | Ga0075363_100028475 | Ga0075363_1000284752 | 398 |
| 335 | 3300006353 | Ga0075370_10024655 | Ga0075370_100246554 | 398 |
| 336 | 3300009148 | Ga0105243_10009710 | Ga0105243_100097105 | 398 |
| 337 | 3300025242 | Ga0209258_100189 | Ga0209258_10018984 | 398 |
| 338 | 3300025256 | Ga0209759_1001304 | Ga0209759_100130413 | 398 |
| 339 | 3300025272 | Ga0209455_1000092 | Ga0209455_100009282 | 398 |
| 340 | 3300025292 | Ga0209676_1003004 | Ga0209676_10030045 | 398 |
| 341 | 3300025294 | Ga0209025_1004201 | Ga0209025_10042012 | 398 |
| 342 | 3300025303 | Ga0209051_1002578 | Ga0209051_10025785 | 398 |
| 343 | 3300025304 | Ga0209257_1007816 | Ga0209257_10078164 | 398 |
| 344 | 3300025935 | Ga0207709_10010549 | Ga0207709_100105495 | 398 |
| 345 | 3300031730 | Ga0307516_10087585 | Ga0307516_100875855 | 398 |
| 346 | 3300046453 | Ga0495627_006332 | Ga0495627_006332_3145_4482 | 398 |
| 347 | 3300048926 | Ga0496123_0018667 | Ga0496123_0018667_945_2282 | 398 |
| 348 | 3300049571 | Ga0501034_0171427 | Ga0501034_0171427_135_1364 | 398 |
| 349 | 3300025297 | Ga0209758_1004896 | Ga0209758_10048968 | 399 |
| 350 | 3300025299 | Ga0209256_1000071 | Ga0209256_10000716 | 399 |
| 351 | 3300027395 | Ga0209996_1000266 | Ga0209996_10002664 | 399 |
| 352 | 3300027695 | Ga0209966_1000003 | Ga0209966_100000380 | 399 |
| 353 | 3300028786 | Ga0307517_10069268 | Ga0307517_100692682 | 399 |
| 354 | 3300031456 | Ga0307513_10182362 | Ga0307513_101823623 | 399 |
| 355 | 3300042876 | Ga0451577_0003800 | Ga0451577_0003800_2877_4091 | 399 |
| 356 | 3300046460 | Ga0495638_0024239 | Ga0495638_0024239_727_1956 | 399 |
| 357 | 3300053088 | Ga0500644_0006796 | Ga0500644_0006796_1213_2442 | 399 |
| 358 | 3300053093 | Ga0500651_0011703 | Ga0500651_0011703_423_1652 | 399 |
| 359 | 3300053108 | Ga0500562_011167 | Ga0500562_011167_965_2185 | 399 |
| 360 | 3300053109 | Ga0500569_023293 | Ga0500569_023293_199_1428 | 399 |
| 361 | 3300053129 | Ga0500628_003445 | Ga0500628_003445_883_2112 | 399 |
| 362 | 3300053131 | Ga0500652_000044 | Ga0500652_000044_31722_32951 | 399 |
| 363 | 3300053151 | Ga0500604_0007709 | Ga0500604_0007709_1310_2539 | 399 |
| 364 | 3300053724 | Ga0500570_055631 | Ga0500570_055631_703_1932 | 399 |
| 365 | iso_pu_bacteria | 2738543013 | 2739249853 | 399 |
| 366 | iso_pu_bacteria | 2928115317 | 2928119250 | 399 |
| 367 | iso_pu_bacteria | 2945945610 | 2945946854 | 399 |
| 368 | 3300003775 | Ga0055524_1006922 | Ga0055524_10069223 | 400 |
| 369 | 3300003794 | Ga0055531_10000314 | Ga0055531_1000031441 | 400 |
| 370 | 3300003794 | Ga0055531_10004814 | Ga0055531_100048146 | 400 |
| 371 | 3300005328 | Ga0070676_10054914 | Ga0070676_100549142 | 400 |
| 372 | 3300005329 | Ga0070683_100010932 | Ga0070683_1000109328 | 400 |
| 373 | 3300005331 | Ga0070670_100120485 | Ga0070670_1001204853 | 400 |
| 374 | 3300005331 | Ga0070670_100250349 | Ga0070670_1002503491 | 400 |
| 375 | 3300005331 | Ga0070670_100277018 | Ga0070670_1002770182 | 400 |
| 376 | 3300005354 | Ga0070675_100070491 | Ga0070675_1000704913 | 400 |
| 377 | 3300005354 | Ga0070675_100079444 | Ga0070675_1000794444 | 400 |
| 378 | 3300005354 | Ga0070675_100103246 | Ga0070675_1001032462 | 400 |
| 379 | 3300005356 | Ga0070674_100023449 | Ga0070674_1000234495 | 400 |
| 380 | 3300005366 | Ga0070659_100011073 | Ga0070659_1000110738 | 400 |
| 381 | 3300005456 | Ga0070678_100166660 | Ga0070678_1001666603 | 400 |
| 382 | 3300005456 | Ga0070678_100248149 | Ga0070678_1002481492 | 400 |
| 383 | 3300005535 | Ga0070684_100138264 | Ga0070684_1001382643 | 400 |
| 384 | 3300005539 | Ga0068853_100010853 | Ga0068853_1000108536 | 400 |
| 385 | 3300005547 | Ga0070693_100024527 | Ga0070693_1000245273 | 400 |
| 386 | 3300005548 | Ga0070665_100343037 | Ga0070665_1003430371 | 400 |
| 387 | 3300005563 | Ga0068855_100063457 | Ga0068855_1000634575 | 400 |
| 388 | 3300005564 | Ga0070664_100011705 | Ga0070664_1000117054 | 400 |
| 389 | 3300005577 | Ga0068857_100025674 | Ga0068857_1000256743 | 400 |
| 390 | 3300005578 | Ga0068854_100007790 | Ga0068854_1000077905 | 400 |
| 391 | 3300005614 | Ga0068856_100011297 | Ga0068856_10001129710 | 400 |
| 392 | 3300005614 | Ga0068856_100286755 | Ga0068856_1002867552 | 400 |
| 393 | 3300005616 | Ga0068852_100008550 | Ga0068852_1000085503 | 400 |
| 394 | 3300005618 | Ga0068864_100012237 | Ga0068864_1000122375 | 400 |
| 395 | 3300005834 | Ga0068851_10006140 | Ga0068851_100061403 | 400 |
| 396 | 3300005843 | Ga0068860_100175865 | Ga0068860_1001758652 | 400 |
| 397 | 3300005844 | Ga0068862_100044660 | Ga0068862_1000446605 | 400 |
| 398 | 3300006237 | Ga0097621_100008020 | Ga0097621_1000080202 | 400 |
| 399 | 3300006353 | Ga0075370_10023080 | Ga0075370_100230802 | 400 |
| 400 | 3300006358 | Ga0068871_100053359 | Ga0068871_1000533594 | 400 |
| 401 | 3300006944 | Ga0099823_1006231 | Ga0099823_100623113 | 400 |
| 402 | 3300009093 | Ga0105240_10274345 | Ga0105240_102743452 | 400 |
| 403 | 3300009177 | Ga0105248_10366178 | Ga0105248_103661782 | 400 |
| 404 | 3300009551 | Ga0105238_10003844 | Ga0105238_100038445 | 400 |
| 405 | 3300013105 | Ga0157369_10012571 | Ga0157369_100125716 | 400 |
| 406 | 3300013105 | Ga0157369_10218354 | Ga0157369_102183543 | 400 |
| 407 | 3300013296 | Ga0157374_10082615 | Ga0157374_100826153 | 400 |
| 408 | 3300013296 | Ga0157374_10109813 | Ga0157374_101098134 | 400 |
| 409 | 3300013306 | Ga0163162_10041320 | Ga0163162_100413203 | 400 |
| 410 | 3300013307 | Ga0157372_10028646 | Ga0157372_100286465 | 400 |
| 411 | 3300013307 | Ga0157372_10033440 | Ga0157372_100334403 | 400 |
| 412 | 3300013308 | Ga0157375_10245080 | Ga0157375_102450802 | 400 |
| 413 | 3300014745 | Ga0157377_10003608 | Ga0157377_100036085 | 400 |
| 414 | 3300014968 | Ga0157379_10026435 | Ga0157379_100264355 | 400 |
| 415 | 3300014969 | Ga0157376_10125555 | Ga0157376_101255552 | 400 |
| 416 | 3300014969 | Ga0157376_10374786 | Ga0157376_103747862 | 400 |
| 417 | 3300025273 | Ga0209673_1006444 | Ga0209673_10064443 | 400 |
| 418 | 3300025298 | Ga0209050_1001494 | Ga0209050_10014945 | 400 |
| 419 | 3300025298 | Ga0209050_1021104 | Ga0209050_10211042 | 400 |
| 420 | 3300025299 | Ga0209256_1006944 | Ga0209256_10069444 | 400 |
| 421 | 3300025303 | Ga0209051_1006092 | Ga0209051_10060922 | 400 |
| 422 | 3300025304 | Ga0209257_1000017 | Ga0209257_1000017532 | 400 |
| 423 | 3300025304 | Ga0209257_1006088 | Ga0209257_10060883 | 400 |
| 424 | 3300025304 | Ga0209257_1019812 | Ga0209257_10198122 | 400 |
| 425 | 3300025321 | Ga0207656_10025101 | Ga0207656_100251014 | 400 |
| 426 | 3300025893 | Ga0207682_10042804 | Ga0207682_100428043 | 400 |
| 427 | 3300025907 | Ga0207645_10019697 | Ga0207645_100196972 | 400 |
| 428 | 3300025907 | Ga0207645_10112118 | Ga0207645_101121182 | 400 |
| 429 | 3300025909 | Ga0207705_10096464 | Ga0207705_100964642 | 400 |
| 430 | 3300025913 | Ga0207695_10136443 | Ga0207695_101364433 | 400 |
| 431 | 3300025920 | Ga0207649_10003480 | Ga0207649_100034803 | 400 |
| 432 | 3300025924 | Ga0207694_10253970 | Ga0207694_102539703 | 400 |
| 433 | 3300025925 | Ga0207650_10001268 | Ga0207650_1000126815 | 400 |
| 434 | 3300025926 | Ga0207659_10007870 | Ga0207659_100078705 | 400 |
| 435 | 3300025927 | Ga0207687_10030790 | Ga0207687_100307904 | 400 |
| 436 | 3300025932 | Ga0207690_10024614 | Ga0207690_100246145 | 400 |
| 437 | 3300025933 | Ga0207706_10065915 | Ga0207706_100659152 | 400 |
| 438 | 3300025933 | Ga0207706_10108219 | Ga0207706_101082192 | 400 |
| 439 | 3300025941 | Ga0207711_10205708 | Ga0207711_102057083 | 400 |
| 440 | 3300025941 | Ga0207711_10272333 | Ga0207711_102723332 | 400 |
| 441 | 3300025942 | Ga0207689_10000169 | Ga0207689_1000016948 | 400 |
| 442 | 3300025944 | Ga0207661_10008632 | Ga0207661_100086322 | 400 |
| 443 | 3300025945 | Ga0207679_10038726 | Ga0207679_100387262 | 400 |
| 444 | 3300025949 | Ga0207667_10025900 | Ga0207667_100259005 | 400 |
| 445 | 3300026067 | Ga0207678_10026579 | Ga0207678_100265792 | 400 |
| 446 | 3300026078 | Ga0207702_10003457 | Ga0207702_100034573 | 400 |
| 447 | 3300026078 | Ga0207702_10083180 | Ga0207702_100831802 | 400 |
| 448 | 3300026095 | Ga0207676_10019417 | Ga0207676_100194176 | 400 |
| 449 | 3300026116 | Ga0207674_10028197 | Ga0207674_100281973 | 400 |
| 450 | 3300026118 | Ga0207675_100002188 | Ga0207675_10000218811 | 400 |
| 451 | 3300026142 | Ga0207698_10102988 | Ga0207698_101029883 | 400 |
| 452 | 3300027296 | Ga0209389_1031428 | Ga0209389_10314286 | 400 |
| 453 | 3300028794 | Ga0307515_10002344 | Ga0307515_1000234429 | 400 |
| 454 | 3300028794 | Ga0307515_10095741 | Ga0307515_100957411 | 400 |
| 455 | 3300032005 | Ga0307411_10000263 | Ga0307411_100002635 | 400 |
| 456 | 3300035114 | Ga0373939_0000017 | Ga0373939_0000017_26133_27350 | 400 |
| 457 | 3300035695 | Ga0373927_0101333 | Ga0373927_0101333_361_1569 | 400 |
| 458 | 3300036401 | Ga0373937_0011642 | Ga0373937_0011642_5684_6910 | 400 |
| 459 | 3300036401 | Ga0373937_0049070 | Ga0373937_0049070_1319_2527 | 400 |
| 460 | 3300036401 | Ga0373937_0135862 | Ga0373937_0135862_1060_2268 | 400 |
| 461 | 3300037068 | Ga0373925_0048137 | Ga0373925_0048137_1773_2981 | 400 |
| 462 | 3300037471 | Ga0395905_0000733 | Ga0395905_0000733_18773_19987 | 400 |
| 463 | 3300039437 | Ga0436365_1804558 | Ga0436365_1804558_1290_2495 | 400 |
| 464 | 3300045051 | Ga0451576_0014283 | Ga0451576_0014283_5981_7195 | 400 |
| 465 | 3300045051 | Ga0451576_0140528 | Ga0451576_0140528_413_1630 | 400 |
| 466 | 3300046472 | Ga0495580_0123075 | Ga0495580_0123075_561_1766 | 400 |
| 467 | 3300046683 | Ga0495658_0058335 | Ga0495658_0058335_29_1237 | 400 |
| 468 | 3300046683 | Ga0495658_0068172 | Ga0495658_0068172_300_1508 | 400 |
| 469 | 3300046809 | Ga0495600_0146387 | Ga0495600_0146387_93_1301 | 400 |
| 470 | 3300047322 | Ga0495680_0086877 | Ga0495680_0086877_989_2197 | 400 |
| 471 | 3300047471 | Ga0495684_0062759 | Ga0495684_0062759_998_2206 | 400 |
| 472 | 3300047471 | Ga0495684_0111202 | Ga0495684_0111202_601_1809 | 400 |
| 473 | 3300048915 | Ga0496112_0042744 | Ga0496112_0042744_128_1333 | 400 |
| 474 | 3300049654 | Ga0501207_005005 | Ga0501207_005005_377_1600 | 400 |
| 475 | 3300049682 | Ga0501252_002568 | Ga0501252_002568_14_1231 | 400 |
| 476 | 3300049704 | Ga0501221_000660 | Ga0501221_000660_2416_3639 | 400 |
| 477 | 3300050493 | nmdc:mga0k408_1609_c1 | nmdc:mga0k408_1609_c1_10041_11252 | 400 |
| 478 | 3300053077 | Ga0495601_0015291 | Ga0495601_0015291_1707_2915 | 400 |
| 479 | 3300053077 | Ga0495601_0065074 | Ga0495601_0065074_47_1255 | 400 |
| 480 | 3300053154 | Ga0500619_000120 | Ga0500619_000120_2256_3506 | 400 |
| 481 | iso_pu_bacteria | 2513020051 | 2513230261 | 400 |
| 482 | iso_pu_bacteria | 2643221544 | 2643742169 | 400 |
| 483 | iso_pu_bacteria | 2643221660 | 2644340717 | 400 |
| 484 | iso_pu_bacteria | 2643221672 | 2644398089 | 400 |
| 485 | iso_pu_bacteria | 2738541277 | 2738719990 | 400 |
| 486 | iso_pu_bacteria | 2738543019 | 2739279189 | 400 |
| 487 | iso_pu_bacteria | 2831864461 | 2831865667 | 400 |
| 488 | iso_pu_bacteria | 2842677519 | 2842682388 | 400 |
| 489 | iso_pu_bacteria | 2886848708 | 2886848849 | 400 |
| 490 | iso_pu_bacteria | 2904449895 | 2904454826 | 400 |
| 491 | iso_pu_bacteria | 2904456579 | 2904462601 | 400 |
| 492 | iso_pu_bacteria | 2919462493 | 2919464042 | 400 |
| 493 | iso_pu_bacteria | 2929520902 | 2929523861 | 400 |
| 494 | iso_pu_bacteria | 2945972063 | 2945976571 | 400 |
| 495 | 3300003791 | Ga0055530_10002750 | Ga0055530_100027502 | 401 |
| 496 | 3300003792 | Ga0055540_1000086 | Ga0055540_100008647 | 401 |
| 497 | 3300003794 | Ga0055531_10004962 | Ga0055531_100049621 | 401 |
| 498 | 3300005331 | Ga0070670_100000948 | Ga0070670_1000009483 | 401 |
| 499 | 3300005355 | Ga0070671_100166654 | Ga0070671_1001666543 | 401 |
| 500 | 3300005543 | Ga0070672_100002690 | Ga0070672_1000026903 | 401 |
| 501 | 3300005564 | Ga0070664_100092362 | Ga0070664_1000923622 | 401 |
| 502 | 3300006946 | Ga0079104_1000100 | Ga0079104_100010076 | 401 |
| 503 | 3300025298 | Ga0209050_1010817 | Ga0209050_10108172 | 401 |
| 504 | 3300025303 | Ga0209051_1000210 | Ga0209051_100021047 | 401 |
| 505 | 3300025304 | Ga0209257_1000314 | Ga0209257_100031447 | 401 |
| 506 | 3300025926 | Ga0207659_10005032 | Ga0207659_100050325 | 401 |
| 507 | 3300025940 | Ga0207691_10007407 | Ga0207691_100074073 | 401 |
| 508 | 3300025960 | Ga0207651_10024218 | Ga0207651_100242184 | 401 |
| 509 | 3300026023 | Ga0207677_10224051 | Ga0207677_102240512 | 401 |
| 510 | 3300026095 | Ga0207676_10006001 | Ga0207676_100060019 | 401 |
| 511 | 3300026121 | Ga0207683_10005419 | Ga0207683_1000541911 | 401 |
| 512 | 3300026121 | Ga0207683_10129230 | Ga0207683_101292303 | 401 |
| 513 | 3300027111 | Ga0209281_1000084 | Ga0209281_100008433 | 401 |
| 514 | 3300028794 | Ga0307515_10000110 | Ga0307515_1000011065 | 401 |
| 515 | 3300031456 | Ga0307513_10125808 | Ga0307513_101258082 | 401 |
| 516 | 3300037418 | Ga0395900_0000025 | Ga0395900_0000025_209347_210567 | 401 |
| 517 | 3300037471 | Ga0395905_0227784 | Ga0395905_0227784_393_1616 | 401 |
| 518 | 3300042012 | Ga0439455_0010450 | Ga0439455_0010450_207_1466 | 401 |
| 519 | 3300044656 | Ga0466969_0000036 | Ga0466969_0000036_65979_67205 | 401 |
| 520 | 3300044684 | Ga0466966_0012015 | Ga0466966_0012015_1623_2849 | 401 |
| 521 | 3300044684 | Ga0466966_0048027 | Ga0466966_0048027_803_2020 | 401 |
| 522 | 3300044693 | Ga0466961_0098762 | Ga0466961_0098762_423_1649 | 401 |
| 523 | 3300044694 | Ga0466963_0042254 | Ga0466963_0042254_631_1848 | 401 |
| 524 | 3300044706 | Ga0466964_0016916 | Ga0466964_0016916_488_1705 | 401 |
| 525 | 3300044719 | Ga0466971_0056549 | Ga0466971_0056549_139_1356 | 401 |
| 526 | 3300044842 | Ga0466957_0005480 | Ga0466957_0005480_5051_6268 | 401 |
| 527 | 3300045049 | Ga0466959_0032070 | Ga0466959_0032070_1356_2573 | 401 |
| 528 | 3300045049 | Ga0466959_0040866 | Ga0466959_0040866_597_1823 | 401 |
| 529 | 3300045976 | Ga0466967_0041274 | Ga0466967_0041274_303_1520 | 401 |
| 530 | 3300048911 | Ga0496108_0031835 | Ga0496108_0031835_1057_2271 | 401 |
| 531 | 3300049515 | Ga0501292_002565 | Ga0501292_002565_1092_2315 | 401 |
| 532 | 3300061719 | Ga0466962_0015254 | Ga0466962_0015254_1435_2652 | 401 |
| 533 | iso_pu_bacteria | 2599185214 | 2599624002 | 401 |
| 534 | iso_pu_bacteria | 2599185226 | 2599672013 | 401 |
| 535 | iso_pu_bacteria | 2599185227 | 2599681905 | 401 |
| 536 | iso_pu_bacteria | 2599185229 | 2599693918 | 401 |
| 537 | iso_pu_bacteria | 2643221683 | 2644469207 | 401 |
| 538 | iso_pu_bacteria | 2818991446 | 2819596454 | 401 |
| 539 | iso_pu_bacteria | 2831265667 | 2831270215 | 401 |
| 540 | iso_pu_bacteria | 2838054893 | 2838059980 | 401 |
| 541 | iso_pu_bacteria | 2885198086 | 2885199588 | 401 |
| 542 | iso_pu_bacteria | 2885211737 | 2885213139 | 401 |
| 543 | iso_pu_bacteria | 2899924645 | 2899931167 | 401 |
| 544 | iso_pu_bacteria | 2904541872 | 2904546808 | 401 |
| 545 | iso_pu_bacteria | 2928037797 | 2928038056 | 401 |
| 546 | iso_pu_bacteria | 2928044640 | 2928046338 | 401 |
| 547 | iso_pu_bacteria | 2928051484 | 2928054030 | 401 |
| 548 | iso_pu_bacteria | 2928064002 | 2928065783 | 401 |
| 549 | iso_pu_bacteria | 2928070936 | 2928077894 | 401 |
| 550 | iso_pu_bacteria | 2928084124 | 2928088676 | 401 |
| 551 | iso_pu_bacteria | 2929160207 | 2929164281 | 401 |
| 552 | iso_pu_bacteria | 2954767861 | 2954771604 | 401 |
| 553 | 3300003792 | Ga0055540_1025041 | Ga0055540_10250412 | 402 |
| 554 | 3300005354 | Ga0070675_100035240 | Ga0070675_1000352403 | 402 |
| 555 | 3300005364 | Ga0070673_100038837 | Ga0070673_1000388373 | 402 |
| 556 | 3300005456 | Ga0070678_100036463 | Ga0070678_1000364633 | 402 |
| 557 | 3300009177 | Ga0105248_10014983 | Ga0105248_100149836 | 402 |
| 558 | 3300025303 | Ga0209051_1004580 | Ga0209051_10045804 | 402 |
| 559 | 3300025940 | Ga0207691_10324899 | Ga0207691_103248992 | 402 |
| 560 | 3300025960 | Ga0207651_10037938 | Ga0207651_100379384 | 402 |
| 561 | 3300026121 | Ga0207683_10053921 | Ga0207683_100539214 | 402 |
| 562 | 3300031649 | Ga0307514_10001506 | Ga0307514_1000150625 | 402 |
| 563 | 3300031911 | Ga0307412_10129725 | Ga0307412_101297251 | 402 |
| 564 | 3300037471 | Ga0395905_0004455 | Ga0395905_0004455_11032_12255 | 402 |
| 565 | 3300048908 | Ga0496105_0123977 | Ga0496105_0123977_578_1828 | 402 |
| 566 | 3300048916 | Ga0496113_0009957 | Ga0496113_0009957_3950_5200 | 402 |
| 567 | 3300049568 | Ga0501031_0001649 | Ga0501031_0001649_3794_5086 | 402 |
| 568 | iso_pu_bacteria | 2643221585 | 2643933730 | 402 |
| 569 | iso_pu_bacteria | 2643221656 | 2644315223 | 402 |
| 570 | iso_pu_bacteria | 2643221660 | 2644341188 | 402 |
| 571 | 3300003316 | rootH1_10001837 | rootH1_1000183711 | 403 |
| 572 | 3300003320 | rootH2_10007324 | rootH2_100073244 | 403 |
| 573 | 3300003322 | rootL2_10004836 | rootL2_1000483620 | 403 |
| 574 | 3300003773 | Ga0055537_1009910 | Ga0055537_10099102 | 403 |
| 575 | 3300003781 | Ga0055536_1003127 | Ga0055536_10031274 | 403 |
| 576 | 3300003784 | Ga0055534_1000722 | Ga0055534_10007225 | 403 |
| 577 | 3300003790 | Ga0055528_1021372 | Ga0055528_10213722 | 403 |
| 578 | 3300003791 | Ga0055530_10005842 | Ga0055530_100058425 | 403 |
| 579 | 3300003792 | Ga0055540_1003253 | Ga0055540_10032533 | 403 |
| 580 | 3300003794 | Ga0055531_10001855 | Ga0055531_1000185511 | 403 |
| 581 | 3300005262 | Ga0065165_1000239 | Ga0065165_100023941 | 403 |
| 582 | 3300005334 | Ga0068869_100160653 | Ga0068869_1001606531 | 403 |
| 583 | 3300005366 | Ga0070659_100123416 | Ga0070659_1001234163 | 403 |
| 584 | 3300005457 | Ga0070662_100015528 | Ga0070662_1000155283 | 403 |
| 585 | 3300005539 | Ga0068853_100273601 | Ga0068853_1002736012 | 403 |
| 586 | 3300005564 | Ga0070664_100084929 | Ga0070664_1000849293 | 403 |
| 587 | 3300005616 | Ga0068852_100010615 | Ga0068852_1000106155 | 403 |
| 588 | 3300005616 | Ga0068852_100138477 | Ga0068852_1001384773 | 403 |
| 589 | 3300006353 | Ga0075370_10012978 | Ga0075370_100129782 | 403 |
| 590 | 3300009036 | Ga0105244_10004693 | Ga0105244_100046935 | 403 |
| 591 | 3300009148 | Ga0105243_10020150 | Ga0105243_100201503 | 403 |
| 592 | 3300009545 | Ga0105237_10050257 | Ga0105237_100502571 | 403 |
| 593 | 3300009551 | Ga0105238_10243712 | Ga0105238_102437122 | 403 |
| 594 | 3300012497 | Ga0157319_1000031 | Ga0157319_100003118 | 403 |
| 595 | 3300013104 | Ga0157370_10102679 | Ga0157370_101026793 | 403 |
| 596 | 3300013104 | Ga0157370_10361301 | Ga0157370_103613012 | 403 |
| 597 | 3300013105 | Ga0157369_10013458 | Ga0157369_100134587 | 403 |
| 598 | 3300013306 | Ga0163162_10024877 | Ga0163162_100248772 | 403 |
| 599 | 3300014497 | Ga0182008_10000838 | Ga0182008_100008384 | 403 |
| 600 | 3300014497 | Ga0182008_10011535 | Ga0182008_100115351 | 403 |
| 601 | 3300015261 | Ga0182006_1002216 | Ga0182006_10022161 | 403 |
| 602 | 3300015262 | Ga0182007_10000601 | Ga0182007_100006018 | 403 |
| 603 | 3300015265 | Ga0182005_1014672 | Ga0182005_10146723 | 403 |
| 604 | 3300025273 | Ga0209673_1023559 | Ga0209673_10235592 | 403 |
| 605 | 3300025284 | Ga0209130_1002969 | Ga0209130_10029694 | 403 |
| 606 | 3300025291 | Ga0209675_1002859 | Ga0209675_10028593 | 403 |
| 607 | 3300025292 | Ga0209676_1001007 | Ga0209676_10010075 | 403 |
| 608 | 3300025292 | Ga0209676_1024270 | Ga0209676_10242702 | 403 |
| 609 | 3300025298 | Ga0209050_1001089 | Ga0209050_10010895 | 403 |
| 610 | 3300025299 | Ga0209256_1000637 | Ga0209256_100063724 | 403 |
| 611 | 3300025303 | Ga0209051_1000347 | Ga0209051_100034757 | 403 |
| 612 | 3300025304 | Ga0209257_1000449 | Ga0209257_100044954 | 403 |
| 613 | 3300025304 | Ga0209257_1005834 | Ga0209257_10058346 | 403 |
| 614 | 3300025304 | Ga0209257_1009230 | Ga0209257_10092304 | 403 |
| 615 | 3300025728 | Ga0207655_1001731 | Ga0207655_100173117 | 403 |
| 616 | 3300025933 | Ga0207706_10025344 | Ga0207706_100253444 | 403 |
| 617 | 3300025935 | Ga0207709_10001584 | Ga0207709_1000158415 | 403 |
| 618 | 3300025945 | Ga0207679_10042670 | Ga0207679_100426703 | 403 |
| 619 | 3300025986 | Ga0207658_10083045 | Ga0207658_100830454 | 403 |
| 620 | 3300026121 | Ga0207683_10090600 | Ga0207683_100906003 | 403 |
| 621 | 3300026142 | Ga0207698_10002643 | Ga0207698_100026436 | 403 |
| 622 | 3300026142 | Ga0207698_10103117 | Ga0207698_101031174 | 403 |
| 623 | 3300031548 | Ga0307408_100029808 | Ga0307408_1000298085 | 403 |
| 624 | 3300042127 | Ga0450890_000638 | Ga0450890_000638_2687_3976 | 403 |
| 625 | 3300046674 | Ga0495588_0017568 | Ga0495588_0017568_957_2171 | 403 |
| 626 | 3300048903 | Ga0496100_0165933 | Ga0496100_0165933_338_1552 | 403 |
| 627 | 3300048904 | Ga0496101_0001014 | Ga0496101_0001014_13915_15129 | 403 |
| 628 | 3300048904 | Ga0496101_0044216 | Ga0496101_0044216_626_2047 | 403 |
| 629 | 3300048905 | Ga0496102_0174882 | Ga0496102_0174882_593_1807 | 403 |
| 630 | 3300048907 | Ga0496104_0140458 | Ga0496104_0140458_908_2122 | 403 |
| 631 | 3300048908 | Ga0496105_0020999 | Ga0496105_0020999_3495_4709 | 403 |
| 632 | 3300048909 | Ga0496106_0060061 | Ga0496106_0060061_330_1544 | 403 |
| 633 | 3300048917 | Ga0496114_0059887 | Ga0496114_0059887_886_2100 | 403 |
| 634 | 3300048919 | Ga0496116_0023532 | Ga0496116_0023532_627_1853 | 403 |
| 635 | 3300048920 | Ga0496117_0040746 | Ga0496117_0040746_330_1556 | 403 |
| 636 | 3300048921 | Ga0496118_0026715 | Ga0496118_0026715_1225_2451 | 403 |
| 637 | 3300048929 | Ga0496126_0042569 | Ga0496126_0042569_2759_3994 | 403 |
| 638 | 3300050496 | nmdc:mga07m45_3112_c1 | nmdc:mga07m45_3112_c1_1521_2810 | 403 |
| 639 | 3300053156 | Ga0500622_0001231 | Ga0500622_0001231_17717_18952 | 403 |
| 640 | iso_pu_bacteria | 2738541307 | 2738881491 | 403 |
| 641 | 3300003187 | JGI25151J46595_10001314 | JGI25151J46595_100013143 | 404 |
| 642 | 3300003578 | Ga0006562J51391_1114750 | Ga0006562J51391_11147502 | 404 |
| 643 | 3300003773 | Ga0055537_1000490 | Ga0055537_10004903 | 404 |
| 644 | 3300003784 | Ga0055534_1000042 | Ga0055534_100004294 | 404 |
| 645 | 3300003790 | Ga0055528_1000242 | Ga0055528_100024249 | 404 |
| 646 | 3300003791 | Ga0055530_10000492 | Ga0055530_1000049229 | 404 |
| 647 | 3300003792 | Ga0055540_1006309 | Ga0055540_10063093 | 404 |
| 648 | 3300006038 | Ga0075365_10055119 | Ga0075365_100551192 | 404 |
| 649 | 3300006051 | Ga0075364_10053785 | Ga0075364_100537851 | 404 |
| 650 | 3300006177 | Ga0075362_10029707 | Ga0075362_100297074 | 404 |
| 651 | 3300006353 | Ga0075370_10002974 | Ga0075370_100029749 | 404 |
| 652 | 3300006353 | Ga0075370_10008542 | Ga0075370_100085426 | 404 |
| 653 | 3300006353 | Ga0075370_10046427 | Ga0075370_100464272 | 404 |
| 654 | 3300006948 | Ga0099826_10061797 | Ga0099826_100617974 | 404 |
| 655 | 3300013100 | Ga0157373_10027789 | Ga0157373_100277894 | 404 |
| 656 | 3300013104 | Ga0157370_10037489 | Ga0157370_100374892 | 404 |
| 657 | 3300014497 | Ga0182008_10021365 | Ga0182008_100213654 | 404 |
| 658 | 3300015262 | Ga0182007_10020840 | Ga0182007_100208401 | 404 |
| 659 | 3300017792 | Ga0163161_10011479 | Ga0163161_100114796 | 404 |
| 660 | 3300017792 | Ga0163161_10046138 | Ga0163161_100461383 | 404 |
| 661 | 3300017792 | Ga0163161_10051214 | Ga0163161_100512142 | 404 |
| 662 | 3300025229 | Ga0209147_101458 | Ga0209147_1014587 | 404 |
| 663 | 3300025242 | Ga0209258_100199 | Ga0209258_10019910 | 404 |
| 664 | 3300025245 | Ga0207425_1004716 | Ga0207425_10047163 | 404 |
| 665 | 3300025254 | Ga0209148_1000179 | Ga0209148_100017910 | 404 |
| 666 | 3300025258 | Ga0209129_1000071 | Ga0209129_1000071123 | 404 |
| 667 | 3300025258 | Ga0209129_1001902 | Ga0209129_10019028 | 404 |
| 668 | 3300025263 | Ga0209565_1000083 | Ga0209565_100008395 | 404 |
| 669 | 3300025263 | Ga0209565_1002195 | Ga0209565_10021951 | 404 |
| 670 | 3300025273 | Ga0209673_1000534 | Ga0209673_100053452 | 404 |
| 671 | 3300025273 | Ga0209673_1001906 | Ga0209673_10019062 | 404 |
| 672 | 3300025284 | Ga0209130_1000773 | Ga0209130_100077323 | 404 |
| 673 | 3300025284 | Ga0209130_1016985 | Ga0209130_10169852 | 404 |
| 674 | 3300025291 | Ga0209675_1000081 | Ga0209675_100008195 | 404 |
| 675 | 3300025291 | Ga0209675_1006924 | Ga0209675_10069243 | 404 |
| 676 | 3300025291 | Ga0209675_1009436 | Ga0209675_10094362 | 404 |
| 677 | 3300025291 | Ga0209675_1015228 | Ga0209675_10152281 | 404 |
| 678 | 3300025292 | Ga0209676_1000005 | Ga0209676_100000560 | 404 |
| 679 | 3300025292 | Ga0209676_1020636 | Ga0209676_10206363 | 404 |
| 680 | 3300025294 | Ga0209025_1000544 | Ga0209025_100054414 | 404 |
| 681 | 3300025294 | Ga0209025_1007365 | Ga0209025_10073653 | 404 |
| 682 | 3300025294 | Ga0209025_1017392 | Ga0209025_10173922 | 404 |
| 683 | 3300025294 | Ga0209025_1033991 | Ga0209025_10339912 | 404 |
| 684 | 3300025295 | Ga0209564_1000239 | Ga0209564_100023946 | 404 |
| 685 | 3300025295 | Ga0209564_1029136 | Ga0209564_10291362 | 404 |
| 686 | 3300025297 | Ga0209758_1000027 | Ga0209758_1000027386 | 404 |
| 687 | 3300025297 | Ga0209758_1003037 | Ga0209758_10030373 | 404 |
| 688 | 3300025298 | Ga0209050_1000007 | Ga0209050_10000071038 | 404 |
| 689 | 3300025298 | Ga0209050_1020188 | Ga0209050_10201882 | 404 |
| 690 | 3300025299 | Ga0209256_1000081 | Ga0209256_1000081123 | 404 |
| 691 | 3300025299 | Ga0209256_1025046 | Ga0209256_10250462 | 404 |
| 692 | 3300025302 | Ga0207426_1000027 | Ga0207426_1000027351 | 404 |
| 693 | 3300025302 | Ga0207426_1000614 | Ga0207426_100061453 | 404 |
| 694 | 3300025303 | Ga0209051_1000009 | Ga0209051_100000960 | 404 |
| 695 | 3300025303 | Ga0209051_1000373 | Ga0209051_100037340 | 404 |
| 696 | 3300025303 | Ga0209051_1000553 | Ga0209051_100055335 | 404 |
| 697 | 3300025304 | Ga0209257_1000011 | Ga0209257_100001134 | 404 |
| 698 | 3300025909 | Ga0207705_10084324 | Ga0207705_100843242 | 404 |
| 699 | 3300025924 | Ga0207694_10112687 | Ga0207694_101126873 | 404 |
| 700 | 3300025935 | Ga0207709_10048245 | Ga0207709_100482454 | 404 |
| 701 | 3300027666 | Ga0209282_1023309 | Ga0209282_10233095 | 404 |
| 702 | 3300027907 | Ga0207428_10156042 | Ga0207428_101560421 | 404 |
| 703 | 3300030731 | Ga0316177_1127556 | Ga0316177_11275564 | 404 |
| 704 | 3300030734 | Ga0316179_1097547 | Ga0316179_10975471 | 404 |
| 705 | 3300030735 | Ga0316178_1094039 | Ga0316178_10940392 | 404 |
| 706 | 3300030742 | Ga0316183_1057193 | Ga0316183_10571933 | 404 |
| 707 | 3300030744 | Ga0316181_1035278 | Ga0316181_10352783 | 404 |
| 708 | 3300031548 | Ga0307408_100205089 | Ga0307408_1002050892 | 404 |
| 709 | 3300031649 | Ga0307514_10085169 | Ga0307514_100851694 | 404 |
| 710 | 3300031731 | Ga0307405_10001308 | Ga0307405_100013087 | 404 |
| 711 | 3300031731 | Ga0307405_10057533 | Ga0307405_100575332 | 404 |
| 712 | 3300031901 | Ga0307406_10000749 | Ga0307406_100007499 | 404 |
| 713 | 3300041411 | Ga0439466_0035434 | Ga0439466_0035434_120_1343 | 404 |
| 714 | 3300042002 | Ga0439442_000506 | Ga0439442_000506_397_1620 | 404 |
| 715 | 3300042145 | Ga0450906_001292 | Ga0450906_001292_2922_4145 | 404 |
| 716 | 3300042156 | Ga0439446_0036223 | Ga0439446_0036223_41_1264 | 404 |
| 717 | 3300042435 | Ga0439434_0009598 | Ga0439434_0009598_1434_2657 | 404 |
| 718 | 3300042531 | Ga0450918_000592 | Ga0450918_000592_2941_4164 | 404 |
| 719 | 3300046513 | Ga0495616_0002637 | Ga0495616_0002637_1444_2673 | 404 |
| 720 | 3300046515 | Ga0495620_0086969 | Ga0495620_0086969_13_1236 | 404 |
| 721 | 3300046520 | Ga0495637_0004867 | Ga0495637_0004867_2189_3412 | 404 |
| 722 | 3300046525 | Ga0495663_0022314 | Ga0495663_0022314_380_1609 | 404 |
| 723 | 3300046530 | Ga0495654_0022343 | Ga0495654_0022343_696_1925 | 404 |
| 724 | 3300046660 | Ga0495625_0000637 | Ga0495625_0000637_42696_43919 | 404 |
| 725 | 3300046665 | Ga0495661_0081481 | Ga0495661_0081481_128_1351 | 404 |
| 726 | 3300046674 | Ga0495588_0005864 | Ga0495588_0005864_3830_5053 | 404 |
| 727 | 3300046692 | Ga0495671_0008248 | Ga0495671_0008248_3183_4406 | 404 |
| 728 | 3300047673 | Ga0495593_0032224 | Ga0495593_0032224_974_2203 | 404 |
| 729 | 3300048920 | Ga0496117_0096473 | Ga0496117_0096473_352_1581 | 404 |
| 730 | 3300049705 | Ga0501225_0013115 | Ga0501225_0013115_448_1671 | 404 |
| 731 | 3300050489 | nmdc:mga03683_19859_c1 | nmdc:mga03683_19859_c1_1072_2295 | 404 |
| 732 | 3300050490 | nmdc:mga03n38_75546_c1 | nmdc:mga03n38_75546_c1_147_1370 | 404 |
| 733 | 3300050496 | nmdc:mga07m45_7137_c1 | nmdc:mga07m45_7137_c1_2534_3757 | 404 |
| 734 | 3300053079 | Ga0500610_0046780 | Ga0500610_0046780_201_1424 | 404 |
| 735 | 3300053079 | Ga0500610_0046782 | Ga0500610_0046782_201_1424 | 404 |
| 736 | 3300053087 | Ga0500643_011857 | Ga0500643_011857_192_1421 | 404 |
| 737 | 3300053093 | Ga0500651_0000029 | Ga0500651_0000029_70736_71965 | 404 |
| 738 | 3300053110 | Ga0500571_001234 | Ga0500571_001234_810_2039 | 404 |
| 739 | 3300053117 | Ga0500593_022053 | Ga0500593_022053_1321_2544 | 404 |
| 740 | 3300053118 | Ga0500594_0006689 | Ga0500594_0006689_728_1957 | 404 |
| 741 | 3300053121 | Ga0500607_004123 | Ga0500607_004123_1602_2825 | 404 |
| 742 | 3300053128 | Ga0500626_051227 | Ga0500626_051227_473_1702 | 404 |
| 743 | 3300053134 | Ga0500658_0000243 | Ga0500658_0000243_22794_24023 | 404 |
| 744 | 3300053134 | Ga0500658_0000358 | Ga0500658_0000358_17368_18597 | 404 |
| 745 | 3300053138 | Ga0500564_020611 | Ga0500564_020611_1496_2725 | 404 |
| 746 | 3300053139 | Ga0500568_0014882 | Ga0500568_0014882_900_2129 | 404 |
| 747 | 3300053158 | Ga0500627_0001256 | Ga0500627_0001256_2505_3728 | 404 |
| 748 | 3300053161 | Ga0500634_0018405 | Ga0500634_0018405_2403_3626 | 404 |
| 749 | iso_pu_bacteria | 2643221628 | 2644162818 | 404 |
| 750 | iso_pu_bacteria | 2904479285 | 2904482634 | 404 |
| 751 | iso_pu_bacteria | 2945909444 | 2945913043 | 404 |
| 752 | iso_pu_bacteria | 2945984333 | 2945984673 | 404 |
| 753 | 3300002704 | JGI25155J39150_1000079 | JGI25155J39150_100007924 | 405 |
| 754 | 3300002705 | JGI25156J39149_1000125 | JGI25156J39149_100012524 | 405 |
| 755 | 3300002738 | JGI25154J39366_1000141 | JGI25154J39366_100014130 | 405 |
| 756 | 3300002741 | JGI25157J39369_1000159 | JGI25157J39369_100015924 | 405 |
| 757 | 3300006195 | Ga0075366_10004344 | Ga0075366_100043443 | 405 |
| 758 | 3300025206 | Ga0209435_100001 | Ga0209435_10000129 | 405 |
| 759 | 3300025246 | Ga0209646_1000001 | Ga0209646_1000001398 | 405 |
| 760 | 3300025250 | Ga0209026_1000003 | Ga0209026_100000329 | 405 |
| 761 | 3300025256 | Ga0209759_1000001 | Ga0209759_100000129 | 405 |
| 762 | 3300028794 | Ga0307515_10121365 | Ga0307515_101213652 | 405 |
| 763 | 3300045051 | Ga0451576_0134538 | Ga0451576_0134538_1012_2238 | 405 |
| 764 | 3300050493 | nmdc:mga0k408_1348_c1 | nmdc:mga0k408_1348_c1_10368_11591 | 405 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hpk-assembly1.cif.gz_A | crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form | 0.9256 | 9 | 391 |
| 6zgr-assembly2.cif.gz_B | crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution | 0.9101 | 13 | 393 |
| 6hcl-assembly2.cif.gz_B | crystal structure of a mfs transporter with ligand at 2.69 angstroem resolution | 0.9078 | 13 | 393 |
| 7ckr-assembly1.cif.gz_A | cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate bay-8002 in the outward-open conformation. | 0.9021 | 11 | 391 |
| 6zgr-assembly2.cif.gz_B | crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution | 0.9008 | 13 | 393 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5NC32_11_193_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9439 | 10 | 189 | 1.20.1250.20 |
| af_H2L0E6_75_299_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9351 | 11 | 189 | 1.20.1250.20 |
| af_F1QFN0_14_227_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9229 | 9 | 195 | 1.20.1250.20 |
| af_Q556Y5_341_577_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9215 | 216 | 394 | 1.20.1250.20 |
| af_O15375_7_200_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9188 | 10 | 202 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7M2JH25-F1-model_v4 | MFS transporter | 0.9884 | 10 | 397 |
GO:0016020
GO:0022857 |
| AF-A0A024EIE2-F1-model_v4 | Putative transporter | 0.9875 | 14 | 397 |
GO:0016020
GO:0022857 |
| AF-A0A7Y8UWI0-F1-model_v4 | MFS transporter | 0.9866 | 10 | 397 |
GO:0016020
GO:0022857 |
| AF-A0A5R9QNT0-F1-model_v4 | MFS transporter | 0.9866 | 10 | 399 |
GO:0016020
GO:0022857 |
| AF-Q9I458-F1-model_v4 | Probable major facilitator superfamily (MFS) transporter | 0.9858 | 10 | 397 |
GO:0005886
GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar