F479748

General Info

Members Datasets Scaffolds Average Seq Length
764 416 698 400

Family's Representative Sequence

Representative Sequence 3300048904|Ga0496101_0044216|Ga0496101_0044216_626_2047
Length 473
Sequence MAGGHPGSARPDRSPAVRARALSRARQRHKRGGIDAQGASKRRPQIINGLGRQPACRSRRVVTFDAMHAPAPALSIKQVLFCGAMIVTLSMGIRHGFGLWLQPITQAQDWSRQTFSFALAVQNLSWGIFGVFAGMLADRFGAFRVLIGGAVFYALGLFGMAHSPTPLLFTLSAGVLIGAAQAGSTYAVIYGVIGRQIPAERRSWAMGVAAAAGSFGQFLMAPIEGRLIGHLGWQSALAVVAVLVLVIIPLAFGLREPKTAALAGHREQSVLQAVGEAFRYPSFGLLMAGYFVCGFQLAFIGIHMPTYLRDRSLPAEVAGYALALIGLFNVFGTYTVGLLGQKLAKRKILAAIYFARAVSIALFLLAPISPLSVYVFSAAMGFLWLSTVPATNAIVAGIFGVAHLSMFSGFVFLSHQVGSFLGVWLGGYLYDTTGSYDVVWYLSIALGVFAALINLPVKETAIARAPRAVGAAG

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
3 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
4 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
5 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
6 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
7 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
8 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
9 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
10 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
11 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
12 2643221580 Devosia sp. Root635 Isolate Unclassified
13 2643221585 Pelomonas sp. Root662 Isolate Unclassified
14 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
15 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
16 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
17 2643221629 Devosia sp. Root105 Isolate Unclassified
18 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
19 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
20 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
21 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
22 2643221656 Pelomonas sp. Root405 Isolate Unclassified
23 2643221658 Variovorax sp. Root411 Isolate Unclassified
24 2643221660 Methylibium sp. Root1272 Isolate Unclassified
25 2643221672 Variovorax sp. Root434 Isolate Unclassified
26 2643221683 Variovorax sp. Root473 Isolate Unclassified
27 2738541277 Variovorax sp. GV051 Isolate Unclassified
28 2738541307 Variovorax sp. GV008 Isolate Unclassified
29 2738541337 Pelomonas sp. BT06 Isolate Unclassified
30 2738543013 Variovorax sp. BT01 Isolate Unclassified
31 2738543019 Variovorax sp. GV040 Isolate Unclassified
32 2818991446 Variovorax sp. 1180 Isolate Unclassified
33 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
34 2831864461 Roseateles noduli HZ7 Isolate Nodule
35 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
36 2842677519 Variovorax sp. R-72495 Isolate Unclassified
37 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
38 2885198086 Variovorax sp. 679 Isolate Unclassified
39 2885211737 Variovorax sp. 553 Isolate Unclassified
40 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
41 2899924645 Variovorax sp. 369 Isolate Unclassified
42 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
43 2904456579 Variovorax sp. 2002 Isolate Unclassified
44 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
45 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
46 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
47 2928037797 Variovorax sp. 1126 Isolate Unclassified
48 2928044640 Variovorax sp. 1128 Isolate Unclassified
49 2928051484 Variovorax sp. 1133 Isolate Unclassified
50 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
51 2928070936 Variovorax gossypii 1167 Isolate Unclassified
52 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
53 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
54 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
55 2929520902 Variovorax beijingensis 502 Isolate Unclassified
56 2932401849 Devosia sp. 2618 Isolate Rhizosphere
57 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
58 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
59 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
60 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
61 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
62 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
63 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
64 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
65 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
66 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
67 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
68 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
69 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
70 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
71 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
72 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
73 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
74 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
75 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
76 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
77 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
78 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
79 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
80 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
81 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
82 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
83 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
84 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
85 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
86 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
87 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
88 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
89 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
90 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
91 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
92 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
93 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
94 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
95 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
96 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
97 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
98 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
99 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
100 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
101 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
102 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
103 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
104 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
105 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
106 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
107 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
108 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
109 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
110 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
111 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
112 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
113 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
114 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
115 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
116 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
117 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
118 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
119 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
120 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
121 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
122 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
123 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
124 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
125 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
126 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
127 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
128 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
129 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
130 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
131 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
132 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
133 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
134 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
135 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
136 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
137 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
138 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
139 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
140 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
141 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
142 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
143 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
144 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
145 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
146 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
147 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
148 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
149 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
150 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
151 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
152 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
153 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
154 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
155 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
156 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
157 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
158 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
159 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
160 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
161 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
162 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
163 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
164 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
165 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
166 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
167 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
168 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
169 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
170 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
171 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
172 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
173 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
174 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
175 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
176 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
177 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
182 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
184 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
185 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
186 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
189 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
190 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
194 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
195 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
197 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
198 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
199 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
201 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
202 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
247 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
248 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
250 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
252 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
253 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
256 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
257 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
258 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
259 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
260 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
261 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
262 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
263 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
264 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
265 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
266 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
267 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
268 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
269 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
270 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
271 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
272 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
273 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
274 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
275 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
276 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
277 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
278 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
279 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
280 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
281 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
282 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
283 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
284 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
285 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
286 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
287 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
288 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
289 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
290 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
291 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
292 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
293 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
294 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
295 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
296 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
297 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
298 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
299 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
300 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
301 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
302 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
303 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
304 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
305 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
306 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
307 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
308 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
309 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
310 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
311 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
312 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
313 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
314 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
315 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
316 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
317 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
318 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
319 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
320 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
321 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
322 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
323 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
324 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
325 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
326 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
327 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
328 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
329 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
330 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
331 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
332 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
333 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
334 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
335 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
336 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
337 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
338 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
339 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
340 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
341 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
342 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
343 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
344 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
345 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
346 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
347 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
348 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
349 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
350 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
351 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
352 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
353 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
354 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
355 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
356 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
357 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
358 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
359 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
360 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
361 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
362 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
363 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
364 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
365 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
366 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
367 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
368 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
369 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
370 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
375 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
376 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
377 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
378 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
379 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
380 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
381 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
382 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
383 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
384 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
385 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
386 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
387 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
388 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
389 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
390 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
391 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
392 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
393 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
394 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
395 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
396 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
397 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
398 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
399 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
400 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
401 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
402 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
403 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
404 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
405 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
406 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
407 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
408 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
409 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
410 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
411 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
412 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
413 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
414 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
415 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
416 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.23
Metatranscriptomes 0.13
Isolates 8.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.92
Nodule 1.18
Rhizoplane 2.75
Rhizosphere 55.89
Stem 0
Stem Tuber 0
Unclassified 14.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000079 3300002704 Bacteria 56287
2 JGI25156J39149_1000125 3300002705 Bacteria 56308
3 JGI25154J39366_1000141 3300002738 Bacteria 56305
4 JGI25157J39369_1000159 3300002741 Bacteria 56308
5 JGI25152J39213_1000898 3300002773 Bacteria 14563
6 JGI25151J46595_10001314 3300003187 Bacteria 17394
7 JGI25151J46595_10007994 3300003187 Bacteria 5128
8 rootH1_10001837 3300003316 Bacteria 9095
9 rootH1_10006805 3300003316 Bacteria 3738
10 rootH1_10007839 3300003316 Bacteria 2707
11 rootH2_10007324 3300003320 Bacteria 5197
12 rootH2_10019508 3300003320 Bacteria 4926
13 rootL2_10004836 3300003322 Bacteria 21607
14 rootL2_10014298 3300003322 Bacteria 14509
15 rootH1_10022291 3300003323 Bacteria 2135
16 Ga0006562J51391_1114750 3300003578 Bacteria 1790
17 Ga0055539_1000459 3300003752 Bacteria 13689
18 Ga0055533_1000080 3300003756 Bacteria 131291
19 Ga0055525_1001686 3300003759 Bacteria 3330
20 Ga0055535_1000198 3300003761 Bacteria 63889
21 Ga0055529_1000449 3300003763 Bacteria 40616
22 Ga0055526_1000542 3300003771 Bacteria 29770
23 Ga0055526_1002456 3300003771 Bacteria 12531
24 Ga0055537_1000490 3300003773 Bacteria 24227
25 Ga0055537_1009910 3300003773 Bacteria 2056
26 Ga0055524_1000084 3300003775 Bacteria 119107
27 Ga0055524_1006922 3300003775 Bacteria 4877
28 Ga0055536_1003127 3300003781 Bacteria 8989
29 Ga0055536_1010072 3300003781 Bacteria 3808
30 Ga0055534_1000042 3300003784 Bacteria 99433
31 Ga0055534_1000722 3300003784 Bacteria 15998
32 Ga0055528_1000242 3300003790 Bacteria 45905
33 Ga0055528_1021372 3300003790 Bacteria 2057
34 Ga0055530_10000492 3300003791 Bacteria 34175
35 Ga0055530_10002750 3300003791 Bacteria 10882
36 Ga0055530_10005842 3300003791 Bacteria 5704
37 Ga0055540_1000086 3300003792 Bacteria 102576
38 Ga0055540_1003253 3300003792 Bacteria 7961
39 Ga0055540_1006309 3300003792 Bacteria 4739
40 Ga0055540_1007552 3300003792 Bacteria 4073
41 Ga0055540_1025041 3300003792 Bacteria 1468
42 Ga0055531_10000314 3300003794 Bacteria 47668
43 Ga0055531_10001855 3300003794 Bacteria 14853
44 Ga0055531_10004814 3300003794 Bacteria 8061
45 Ga0055531_10004962 3300003794 Bacteria 7902
46 Ga0055541_1002116 3300003841 Bacteria 4049
47 Ga0065165_1000239 3300005262 Bacteria 94061
48 Ga0065165_1003676 3300005262 Bacteria 10442
49 Ga0065165_1030210 3300005262 Bacteria 1727
50 Ga0070676_10008798 3300005328 Bacteria 5450
51 Ga0070676_10054914 3300005328 Bacteria 2350
52 Ga0070683_100010932 3300005329 Bacteria 7817
53 Ga0070690_100060008 3300005330 Bacteria 2447
54 Ga0070670_100000948 3300005331 Bacteria 22791
55 Ga0070670_100078288 3300005331 Bacteria 2840
56 Ga0070670_100120485 3300005331 Bacteria 2263
57 Ga0070670_100250349 3300005331 Bacteria 1543
58 Ga0070670_100277018 3300005331 Bacteria 1464
59 Ga0070677_10066794 3300005333 Bacteria 1500
60 Ga0068869_100016845 3300005334 Bacteria 4939
61 Ga0068869_100160653 3300005334 Bacteria 1749
62 Ga0070666_10002405 3300005335 Bacteria 11320
63 Ga0070666_10009812 3300005335 Bacteria 5980
64 Ga0070680_100003562 3300005336 Bacteria 11616
65 Ga0070660_100221488 3300005339 Bacteria 1538
66 Ga0070661_100000925 3300005344 Bacteria 21020
67 Ga0070668_100005104 3300005347 Bacteria 9724
68 Ga0070669_100008394 3300005353 Bacteria 7371
69 Ga0070669_100093833 3300005353 Bacteria 2254
70 Ga0070675_100000199 3300005354 Bacteria 37845
71 Ga0070675_100035240 3300005354 Bacteria 4065
72 Ga0070675_100070491 3300005354 Bacteria 2897
73 Ga0070675_100079444 3300005354 Bacteria 2733
74 Ga0070675_100103246 3300005354 Bacteria 2403
75 Ga0070671_100010921 3300005355 Bacteria 7293
76 Ga0070671_100166654 3300005355 Bacteria 1863
77 Ga0070674_100002083 3300005356 Bacteria 10952
78 Ga0070674_100023449 3300005356 Bacteria 3995
79 Ga0070673_100008889 3300005364 Bacteria 6712
80 Ga0070673_100038837 3300005364 Bacteria 3639
81 Ga0070659_100011073 3300005366 Bacteria 6662
82 Ga0070659_100123416 3300005366 Bacteria 2100
83 Ga0070667_100001982 3300005367 Bacteria 18152
84 Ga0070667_100105980 3300005367 Bacteria 2433
85 Ga0070663_100000949 3300005455 Bacteria 15767
86 Ga0070678_100016273 3300005456 Bacteria 4752
87 Ga0070678_100036463 3300005456 Bacteria 3442
88 Ga0070678_100166660 3300005456 Bacteria 1790
89 Ga0070678_100248149 3300005456 Bacteria 1491
90 Ga0070662_100004821 3300005457 Bacteria 8548
91 Ga0070662_100015528 3300005457 Bacteria 5103
92 Ga0070681_10079088 3300005458 Bacteria 3245
93 Ga0068867_100000077 3300005459 Bacteria 59836
94 Ga0068867_100003310 3300005459 Bacteria 11351
95 Ga0068867_100017655 3300005459 Bacteria 5066
96 Ga0068867_100038718 3300005459 Bacteria 3472
97 Ga0070684_100138264 3300005535 Bacteria 2201
98 Ga0068853_100005208 3300005539 Bacteria 10169
99 Ga0068853_100010853 3300005539 Bacteria 7380
100 Ga0068853_100179227 3300005539 Bacteria 1921
101 Ga0068853_100273601 3300005539 Bacteria 1555
102 Ga0068853_100347193 3300005539 Bacteria 1380
103 Ga0070672_100002369 3300005543 Bacteria 11933
104 Ga0070672_100002690 3300005543 Bacteria 11370
105 Ga0070672_100173261 3300005543 Bacteria 1795
106 Ga0070693_100024527 3300005547 Bacteria 3235
107 Ga0070665_100343037 3300005548 Bacteria 1499
108 Ga0068855_100009834 3300005563 Bacteria 11535
109 Ga0068855_100063457 3300005563 Bacteria 4311
110 Ga0068855_100103267 3300005563 Bacteria 3280
111 Ga0070664_100000939 3300005564 Bacteria 22774
112 Ga0070664_100011705 3300005564 Bacteria 7120
113 Ga0070664_100052960 3300005564 Bacteria 3439
114 Ga0070664_100084929 3300005564 Bacteria 2733
115 Ga0070664_100092362 3300005564 Bacteria 2620
116 Ga0068857_100025674 3300005577 Bacteria 5187
117 Ga0068857_100054500 3300005577 Bacteria 3548
118 Ga0068854_100007790 3300005578 Bacteria 6850
119 Ga0068856_100011297 3300005614 Bacteria 8666
120 Ga0068856_100286755 3300005614 Bacteria 1663
121 Ga0068852_100008550 3300005616 Bacteria 7551
122 Ga0068852_100010615 3300005616 Bacteria 6892
123 Ga0068852_100039765 3300005616 Bacteria 3962
124 Ga0068852_100052008 3300005616 Bacteria 3519
125 Ga0068852_100138477 3300005616 Bacteria 2250
126 Ga0068859_100016607 3300005617 Bacteria 7390
127 Ga0068864_100000354 3300005618 Bacteria 40336
128 Ga0068864_100012237 3300005618 Bacteria 7090
129 Ga0068866_10058734 3300005718 Bacteria 1988
130 Ga0068861_100005261 3300005719 Bacteria 8725
131 Ga0068851_10006140 3300005834 Bacteria 5482
132 Ga0068863_100011545 3300005841 Bacteria 8546
133 Ga0068858_100000262 3300005842 Bacteria 56062
134 Ga0068858_100008391 3300005842 Bacteria 9937
135 Ga0068860_100028441 3300005843 Bacteria 5380
136 Ga0068860_100074043 3300005843 Bacteria 3237
137 Ga0068860_100175865 3300005843 Bacteria 2069
138 Ga0068862_100024627 3300005844 Bacteria 5051
139 Ga0068862_100044660 3300005844 Bacteria 3780
140 Ga0068862_100061533 3300005844 Bacteria 3227
141 Ga0075365_10038179 3300006038 Bacteria 3120
142 Ga0075365_10055119 3300006038 Bacteria 2638
143 Ga0075368_10037925 3300006042 Bacteria 1885
144 Ga0075363_100028475 3300006048 Bacteria 2874
145 Ga0075363_100035069 3300006048 Bacteria 2623
146 Ga0075363_100056246 3300006048 Bacteria 2109
147 Ga0075363_100069036 3300006048 Bacteria 1917
148 Ga0075364_10053785 3300006051 Bacteria 2632
149 Ga0075362_10001536 3300006177 Bacteria 7443
150 Ga0075362_10029707 3300006177 Bacteria 2357
151 Ga0075367_10105277 3300006178 Bacteria 1727
152 Ga0075366_10001350 3300006195 Bacteria 12267
153 Ga0075366_10003846 3300006195 Bacteria 7997
154 Ga0075366_10004344 3300006195 Bacteria 7598
155 Ga0075366_10050324 3300006195 Bacteria 2473
156 Ga0097621_100008020 3300006237 Bacteria 7582
157 Ga0075370_10000415 3300006353 Bacteria 15744
158 Ga0075370_10000695 3300006353 Bacteria 13246
159 Ga0075370_10002974 3300006353 Bacteria 7966
160 Ga0075370_10006626 3300006353 Bacteria 5838
161 Ga0075370_10008542 3300006353 Bacteria 5276
162 Ga0075370_10012978 3300006353 Bacteria 4419
163 Ga0075370_10023080 3300006353 Bacteria 3423
164 Ga0075370_10024655 3300006353 Bacteria 3324
165 Ga0075370_10046427 3300006353 Bacteria 2458
166 Ga0068871_100051800 3300006358 Bacteria 3324
167 Ga0068871_100053359 3300006358 Bacteria 3276
168 Ga0068871_100063594 3300006358 Bacteria 3019
169 Ga0068865_100013265 3300006881 Bacteria 5205
170 Ga0097620_100016607 3300006931 Bacteria 7390
171 Ga0099823_1006231 3300006944 Bacteria 12019
172 Ga0079104_1000100 3300006946 Bacteria 126924
173 Ga0079104_1022553 3300006946 Bacteria 1691
174 Ga0099826_10061797 3300006948 Bacteria 2431
175 Ga0105244_10004693 3300009036 Bacteria 9311
176 Ga0105240_10274345 3300009093 Bacteria 1940
177 Ga0114129_10753013 3300009147 Bacteria 1247
178 Ga0105243_10009710 3300009148 Bacteria 7328
179 Ga0105243_10020150 3300009148 Bacteria 5055
180 Ga0105242_10091692 3300009176 Bacteria 2558
181 Ga0105248_10014983 3300009177 Bacteria 8535
182 Ga0105248_10026083 3300009177 Bacteria 6502
183 Ga0105248_10066801 3300009177 Bacteria 4037
184 Ga0105248_10083454 3300009177 Bacteria 3594
185 Ga0105248_10366178 3300009177 Bacteria 1623
186 Ga0105237_10050257 3300009545 Bacteria 4189
187 Ga0105238_10003844 3300009551 Bacteria 14913
188 Ga0105238_10243712 3300009551 Bacteria 1775
189 Ga0105239_10112957 3300010375 Bacteria 3012
190 Ga0105246_10088977 3300011119 Bacteria 2220
191 Ga0157319_1000031 3300012497 Bacteria 48442
192 Ga0157373_10027789 3300013100 Bacteria 4081
193 Ga0157370_10037489 3300013104 Bacteria 4699
194 Ga0157370_10102679 3300013104 Bacteria 2677
195 Ga0157370_10131317 3300013104 Bacteria 2336
196 Ga0157370_10361301 3300013104 Bacteria 1338
197 Ga0157369_10012571 3300013105 Bacteria 9602
198 Ga0157369_10013458 3300013105 Bacteria 9246
199 Ga0157369_10218354 3300013105 Bacteria 1996
200 Ga0157374_10008718 3300013296 Bacteria 8674
201 Ga0157374_10009590 3300013296 Bacteria 8313
202 Ga0157374_10082615 3300013296 Bacteria 3051
203 Ga0157374_10109813 3300013296 Bacteria 2652
204 Ga0157378_10242282 3300013297 Bacteria 1723
205 Ga0163162_10003584 3300013306 Bacteria 14856
206 Ga0163162_10006364 3300013306 Bacteria 11432
207 Ga0163162_10024877 3300013306 Bacteria 5914
208 Ga0163162_10041320 3300013306 Bacteria 4613
209 Ga0157372_10028646 3300013307 Bacteria 6080
210 Ga0157372_10033440 3300013307 Bacteria 5648
211 Ga0157375_10005659 3300013308 Bacteria 10875
212 Ga0157375_10015677 3300013308 Bacteria 6788
213 Ga0157375_10245080 3300013308 Bacteria 1952
214 Ga0163163_10079734 3300014325 Bacteria 3272
215 Ga0157380_10157891 3300014326 Bacteria 1968
216 Ga0182008_10000838 3300014497 Bacteria 21458
217 Ga0182008_10011535 3300014497 Bacteria 4693
218 Ga0182008_10021365 3300014497 Bacteria 3323
219 Ga0157377_10000094 3300014745 Bacteria 64283
220 Ga0157377_10003608 3300014745 Bacteria 7010
221 Ga0157379_10002033 3300014968 Bacteria 16785
222 Ga0157379_10004639 3300014968 Bacteria 11791
223 Ga0157379_10026435 3300014968 Bacteria 5166
224 Ga0157376_10011894 3300014969 Bacteria 6435
225 Ga0157376_10021468 3300014969 Bacteria 5015
226 Ga0157376_10125555 3300014969 Bacteria 2282
227 Ga0157376_10374786 3300014969 Bacteria 1369
228 Ga0182006_1002216 3300015261 Bacteria 10773
229 Ga0182007_10000601 3300015262 Bacteria 21082
230 Ga0182007_10000825 3300015262 Bacteria 17267
231 Ga0182007_10020840 3300015262 Bacteria 2336
232 Ga0182005_1014672 3300015265 Bacteria 2191
233 Ga0163161_10009786 3300017792 Bacteria 6643
234 Ga0163161_10011479 3300017792 Bacteria 6147
235 Ga0163161_10046138 3300017792 Bacteria 3143
236 Ga0163161_10051214 3300017792 Bacteria 2990
237 Ga0209435_100001 3300025206 Bacteria 1424171
238 Ga0209566_100238 3300025225 Bacteria 52918
239 Ga0209674_100003 3300025226 Bacteria 2196646
240 Ga0209147_101458 3300025229 Bacteria 8517
241 Ga0209563_100049 3300025230 Bacteria 358472
242 Ga0207427_100846 3300025231 Bacteria 13684
243 Ga0209258_100189 3300025242 Bacteria 128268
244 Ga0209258_100199 3300025242 Bacteria 123718
245 Ga0207425_1004716 3300025245 Bacteria 4023
246 Ga0209646_1000001 3300025246 Bacteria 3092932
247 Ga0209026_1000003 3300025250 Bacteria 1060571
248 Ga0209677_100228 3300025253 Bacteria 39841
249 Ga0209148_1000179 3300025254 Bacteria 126083
250 Ga0209759_1000001 3300025256 Bacteria 2799452
251 Ga0209759_1001304 3300025256 Bacteria 14727
252 Ga0209129_1000041 3300025258 Bacteria 307590
253 Ga0209129_1000071 3300025258 Bacteria 210729
254 Ga0209129_1001902 3300025258 Bacteria 11014
255 Ga0209565_1000083 3300025263 Bacteria 154007
256 Ga0209565_1002195 3300025263 Bacteria 7317
257 Ga0209455_1000092 3300025272 Bacteria 220516
258 Ga0209673_1000534 3300025273 Bacteria 62274
259 Ga0209673_1001906 3300025273 Bacteria 16707
260 Ga0209673_1006444 3300025273 Bacteria 5662
261 Ga0209673_1014477 3300025273 Bacteria 3050
262 Ga0209673_1023559 3300025273 Bacteria 2092
263 Ga0209130_1000773 3300025284 Bacteria 27625
264 Ga0209130_1002969 3300025284 Bacteria 7705
265 Ga0209130_1016985 3300025284 Bacteria 1745
266 Ga0209675_1000081 3300025291 Bacteria 154007
267 Ga0209675_1002859 3300025291 Bacteria 8569
268 Ga0209675_1006924 3300025291 Bacteria 4447
269 Ga0209675_1009436 3300025291 Bacteria 3448
270 Ga0209675_1015228 3300025291 Bacteria 2296
271 Ga0209676_1000005 3300025292 Bacteria 1076001
272 Ga0209676_1001007 3300025292 Bacteria 33026
273 Ga0209676_1003004 3300025292 Bacteria 10965
274 Ga0209676_1020636 3300025292 Bacteria 2232
275 Ga0209676_1024270 3300025292 Bacteria 1968
276 Ga0209025_1000544 3300025294 Bacteria 70638
277 Ga0209025_1004201 3300025294 Bacteria 12707
278 Ga0209025_1007365 3300025294 Bacteria 8232
279 Ga0209025_1017392 3300025294 Bacteria 4154
280 Ga0209025_1033991 3300025294 Bacteria 2342
281 Ga0209564_1000003 3300025295 Bacteria 1585848
282 Ga0209564_1000029 3300025295 Bacteria 505995
283 Ga0209564_1000239 3300025295 Bacteria 119761
284 Ga0209564_1029136 3300025295 Bacteria 1745
285 Ga0209758_1000027 3300025297 Bacteria 549650
286 Ga0209758_1000043 3300025297 Bacteria 402310
287 Ga0209758_1003037 3300025297 Bacteria 15990
288 Ga0209758_1004896 3300025297 Bacteria 10767
289 Ga0209050_1000007 3300025298 Bacteria 1187891
290 Ga0209050_1000672 3300025298 Bacteria 51771
291 Ga0209050_1001089 3300025298 Bacteria 33034
292 Ga0209050_1001494 3300025298 Bacteria 24797
293 Ga0209050_1010817 3300025298 Bacteria 4432
294 Ga0209050_1020188 3300025298 Bacteria 2490
295 Ga0209050_1021104 3300025298 Bacteria 2389
296 Ga0209256_1000071 3300025299 Bacteria 242618
297 Ga0209256_1000081 3300025299 Bacteria 222908
298 Ga0209256_1000637 3300025299 Bacteria 47908
299 Ga0209256_1006944 3300025299 Bacteria 5779
300 Ga0209256_1025046 3300025299 Bacteria 1745
301 Ga0207426_1000027 3300025302 Bacteria 513176
302 Ga0207426_1000614 3300025302 Bacteria 45951
303 Ga0209051_1000009 3300025303 Bacteria 706778
304 Ga0209051_1000210 3300025303 Bacteria 102629
305 Ga0209051_1000347 3300025303 Bacteria 68841
306 Ga0209051_1000373 3300025303 Bacteria 64348
307 Ga0209051_1000553 3300025303 Bacteria 45537
308 Ga0209051_1002578 3300025303 Bacteria 12758
309 Ga0209051_1004580 3300025303 Bacteria 8448
310 Ga0209051_1006092 3300025303 Bacteria 6869
311 Ga0209051_1014665 3300025303 Bacteria 3644
312 Ga0209257_1000011 3300025304 Bacteria 1112630
313 Ga0209257_1000017 3300025304 Bacteria 866287
314 Ga0209257_1000314 3300025304 Bacteria 102629
315 Ga0209257_1000449 3300025304 Bacteria 77522
316 Ga0209257_1005834 3300025304 Bacteria 8351
317 Ga0209257_1006088 3300025304 Bacteria 8015
318 Ga0209257_1007816 3300025304 Bacteria 6334
319 Ga0209257_1009230 3300025304 Bacteria 5347
320 Ga0209257_1019812 3300025304 Bacteria 2515
321 Ga0207656_10020715 3300025321 Bacteria 2616
322 Ga0207656_10025101 3300025321 Bacteria 2417
323 Ga0207656_10074611 3300025321 Bacteria 1514
324 Ga0207655_1001731 3300025728 Bacteria 19151
325 Ga0207682_10042804 3300025893 Bacteria 1851
326 Ga0207642_10015239 3300025899 Bacteria 2859
327 Ga0207688_10029556 3300025901 Bacteria 3018
328 Ga0207680_10005119 3300025903 Bacteria 6250
329 Ga0207680_10032011 3300025903 Bacteria 2984
330 Ga0207645_10003951 3300025907 Bacteria 11066
331 Ga0207645_10019697 3300025907 Bacteria 4422
332 Ga0207645_10112118 3300025907 Bacteria 1766
333 Ga0207705_10084324 3300025909 Bacteria 2320
334 Ga0207705_10096464 3300025909 Bacteria 2171
335 Ga0207707_10036154 3300025912 Bacteria 4319
336 Ga0207695_10136443 3300025913 Bacteria 2406
337 Ga0207660_10017896 3300025917 Bacteria 4717
338 Ga0207649_10001141 3300025920 Bacteria 16077
339 Ga0207649_10003480 3300025920 Bacteria 8602
340 Ga0207652_10004261 3300025921 Bacteria 11672
341 Ga0207681_10001915 3300025923 Bacteria 13327
342 Ga0207694_10112687 3300025924 Bacteria 2165
343 Ga0207694_10253970 3300025924 Bacteria 1439
344 Ga0207650_10001268 3300025925 Bacteria 18324
345 Ga0207650_10059135 3300025925 Bacteria 2856
346 Ga0207659_10001828 3300025926 Bacteria 12600
347 Ga0207659_10005032 3300025926 Bacteria 8012
348 Ga0207659_10007870 3300025926 Bacteria 6589
349 Ga0207659_10027698 3300025926 Bacteria 3841
350 Ga0207687_10030790 3300025927 Bacteria 3621
351 Ga0207690_10007376 3300025932 Bacteria 6527
352 Ga0207690_10024614 3300025932 Bacteria 3772
353 Ga0207706_10002276 3300025933 Bacteria 18747
354 Ga0207706_10013403 3300025933 Bacteria 7454
355 Ga0207706_10025344 3300025933 Bacteria 5314
356 Ga0207706_10065915 3300025933 Bacteria 3188
357 Ga0207706_10108219 3300025933 Bacteria 2446
358 Ga0207706_10176074 3300025933 Bacteria 1879
359 Ga0207709_10001584 3300025935 Bacteria 15523
360 Ga0207709_10010549 3300025935 Bacteria 5088
361 Ga0207709_10023429 3300025935 Bacteria 3513
362 Ga0207709_10048245 3300025935 Bacteria 2594
363 Ga0207691_10007407 3300025940 Bacteria 10568
364 Ga0207691_10014538 3300025940 Bacteria 7508
365 Ga0207691_10324899 3300025940 Bacteria 1319
366 Ga0207711_10084753 3300025941 Bacteria 2775
367 Ga0207711_10205708 3300025941 Bacteria 1797
368 Ga0207711_10272333 3300025941 Bacteria 1558
369 Ga0207689_10000169 3300025942 Bacteria 57089
370 Ga0207689_10033478 3300025942 Bacteria 4270
371 Ga0207661_10008632 3300025944 Bacteria 7280
372 Ga0207679_10000201 3300025945 Bacteria 48099
373 Ga0207679_10038726 3300025945 Bacteria 3399
374 Ga0207679_10042670 3300025945 Bacteria 3261
375 Ga0207679_10092092 3300025945 Bacteria 2348
376 Ga0207667_10003340 3300025949 Bacteria 19799
377 Ga0207667_10025900 3300025949 Bacteria 6416
378 Ga0207667_10116090 3300025949 Bacteria 2759
379 Ga0207651_10005930 3300025960 Bacteria 6327
380 Ga0207651_10024218 3300025960 Bacteria 3750
381 Ga0207651_10037938 3300025960 Bacteria 3161
382 Ga0207712_10001833 3300025961 Bacteria 14012
383 Ga0207658_10000336 3300025986 Bacteria 47108
384 Ga0207658_10031032 3300025986 Bacteria 3791
385 Ga0207658_10083045 3300025986 Bacteria 2461
386 Ga0207677_10030695 3300026023 Bacteria 3434
387 Ga0207677_10224051 3300026023 Bacteria 1510
388 Ga0207703_10000277 3300026035 Bacteria 56761
389 Ga0207703_10000866 3300026035 Bacteria 29661
390 Ga0207639_10046919 3300026041 Bacteria 3261
391 Ga0207639_10142245 3300026041 Bacteria 2000
392 Ga0207639_10218115 3300026041 Bacteria 1646
393 Ga0207678_10000522 3300026067 Bacteria 34895
394 Ga0207678_10026579 3300026067 Bacteria 5049
395 Ga0207678_10066914 3300026067 Bacteria 3084
396 Ga0207678_10183439 3300026067 Bacteria 1787
397 Ga0207708_10044572 3300026075 Bacteria 3380
398 Ga0207702_10003457 3300026078 Bacteria 14415
399 Ga0207702_10083180 3300026078 Bacteria 2784
400 Ga0207648_10000193 3300026089 Bacteria 64119
401 Ga0207648_10016909 3300026089 Bacteria 6648
402 Ga0207676_10001342 3300026095 Bacteria 18294
403 Ga0207676_10006001 3300026095 Bacteria 8567
404 Ga0207676_10019417 3300026095 Bacteria 4959
405 Ga0207676_10165952 3300026095 Bacteria 1918
406 Ga0207674_10028197 3300026116 Bacteria 5930
407 Ga0207674_10147027 3300026116 Bacteria 2315
408 Ga0207675_100002188 3300026118 Bacteria 19420
409 Ga0207675_100012833 3300026118 Bacteria 7825
410 Ga0207683_10005419 3300026121 Bacteria 10931
411 Ga0207683_10053921 3300026121 Bacteria 3526
412 Ga0207683_10090600 3300026121 Bacteria 2723
413 Ga0207683_10129230 3300026121 Bacteria 2271
414 Ga0207698_10002643 3300026142 Bacteria 10651
415 Ga0207698_10015587 3300026142 Bacteria 5095
416 Ga0207698_10102988 3300026142 Bacteria 2371
417 Ga0207698_10103117 3300026142 Bacteria 2370
418 Ga0207698_10151905 3300026142 Bacteria 2011
419 Ga0209281_1000084 3300027111 Bacteria 254215
420 Ga0209389_1031428 3300027296 Bacteria 4443
421 Ga0209996_1000266 3300027395 Bacteria 6565
422 Ga0209282_1023309 3300027666 Bacteria 3893
423 Ga0209966_1000003 3300027695 Bacteria 111077
424 Ga0209813_10004852 3300027866 Bacteria 3233
425 Ga0207428_10156042 3300027907 Bacteria 1736
426 Ga0268265_10010320 3300028380 Bacteria 6306
427 Ga0268264_10001554 3300028381 Bacteria 21267
428 Ga0268264_10026955 3300028381 Bacteria 4694
429 Ga0268264_10059434 3300028381 Bacteria 3203
430 Ga0307517_10069268 3300028786 Bacteria 3200
431 Ga0307515_10000093 3300028794 Bacteria 212053
432 Ga0307515_10000110 3300028794 Bacteria 195560
433 Ga0307515_10001261 3300028794 Bacteria 57708
434 Ga0307515_10002344 3300028794 Bacteria 41339
435 Ga0307515_10004636 3300028794 Bacteria 28226
436 Ga0307515_10009359 3300028794 Bacteria 18952
437 Ga0307515_10011478 3300028794 Bacteria 16813
438 Ga0307515_10095741 3300028794 Bacteria 3650
439 Ga0307515_10121365 3300028794 Bacteria 2957
440 Ga0307515_10266180 3300028794 Bacteria 1442
441 Ga0307512_10052945 3300030522 Bacteria 3232
442 Ga0316177_1127556 3300030731 Bacteria 4449
443 Ga0316179_1097547 3300030734 Bacteria 2026
444 Ga0316178_1094039 3300030735 Bacteria 3328
445 Ga0316183_1057193 3300030742 Bacteria 2250
446 Ga0316181_1035278 3300030744 Bacteria 8135
447 Ga0265332_10000009 3300031238 Bacteria 295760
448 Ga0307513_10004823 3300031456 Bacteria 17907
449 Ga0307513_10053003 3300031456 Bacteria 4363
450 Ga0307513_10125808 3300031456 Bacteria 2519
451 Ga0307513_10182362 3300031456 Bacteria 1961
452 Ga0307408_100029808 3300031548 Bacteria 3784
453 Ga0307408_100205089 3300031548 Bacteria 1598
454 Ga0307408_100240990 3300031548 Bacteria 1486
455 Ga0307508_10000212 3300031616 Bacteria 70345
456 Ga0307508_10002342 3300031616 Bacteria 20078
457 Ga0307514_10001506 3300031649 Bacteria 27927
458 Ga0307514_10005380 3300031649 Bacteria 11470
459 Ga0307514_10014898 3300031649 Bacteria 6422
460 Ga0307514_10085169 3300031649 Bacteria 2324
461 Ga0307516_10000383 3300031730 Bacteria 57684
462 Ga0307516_10003730 3300031730 Bacteria 19364
463 Ga0307516_10006738 3300031730 Bacteria 13428
464 Ga0307516_10074732 3300031730 Bacteria 3244
465 Ga0307516_10087585 3300031730 Bacteria 2948
466 Ga0307405_10001308 3300031731 Bacteria 10408
467 Ga0307405_10057533 3300031731 Bacteria 2443
468 Ga0307405_10165237 3300031731 Bacteria 1572
469 Ga0307406_10000749 3300031901 Bacteria 18227
470 Ga0307412_10010335 3300031911 Bacteria 5375
471 Ga0307412_10018432 3300031911 Bacteria 4200
472 Ga0307412_10129725 3300031911 Bacteria 1829
473 Ga0307409_100001082 3300031995 Bacteria 12863
474 Ga0307416_100009480 3300032002 Bacteria 6376
475 Ga0307411_10000263 3300032005 Bacteria 17179
476 Ga0307415_100029020 3300032126 Bacteria 3529
477 Ga0307507_10057406 3300033179 Bacteria 3666
478 Ga0373934_0005907 3300035086 Bacteria 4530
479 Ga0373939_0000017 3300035114 Bacteria 61924
480 Ga0373927_0101333 3300035695 Bacteria 1873
481 Ga0373937_0011642 3300036401 Bacteria 7723
482 Ga0373937_0049070 3300036401 Bacteria 3866
483 Ga0373937_0135862 3300036401 Bacteria 2299
484 Ga0316584_0066702 3300036712 Bacteria 2697
485 Ga0373925_0048137 3300037068 Bacteria 3176
486 Ga0395899_0007650 3300037312 Bacteria 8331
487 Ga0395900_0000025 3300037418 Bacteria 321217
488 Ga0395900_0001269 3300037418 Bacteria 30864
489 Ga0395898_0203000 3300037466 Bacteria 1892
490 Ga0395905_0000653 3300037471 Bacteria 46132
491 Ga0395905_0000733 3300037471 Bacteria 43190
492 Ga0395905_0002495 3300037471 Bacteria 20355
493 Ga0395905_0004455 3300037471 Bacteria 14558
494 Ga0395905_0014861 3300037471 Bacteria 7426
495 Ga0395905_0035039 3300037471 Bacteria 4712
496 Ga0395905_0083332 3300037471 Bacteria 2995
497 Ga0395905_0101728 3300037471 Bacteria 2697
498 Ga0395905_0227784 3300037471 Bacteria 1743
499 Ga0395901_0014101 3300038443 Bacteria 8135
500 Ga0395901_0014228 3300038443 Bacteria 8100
501 Ga0400483_028483 3300039062 Bacteria 154566
502 Ga0400483_196526 3300039062 Bacteria 30829
503 Ga0400483_246213 3300039062 Bacteria 42716
504 Ga0436365_1804558 3300039437 Bacteria 4403
505 Ga0439466_0035434 3300041411 Bacteria 1688
506 Ga0451795_0407166 3300041456 Bacteria 1516
507 Ga0439442_000506 3300042002 Bacteria 8767
508 Ga0439455_0010450 3300042012 Bacteria 2042
509 Ga0439455_0020619 3300042012 Bacteria 1565
510 Ga0450917_000785 3300042120 Bacteria 2341
511 Ga0450888_000705 3300042126 Bacteria 3173
512 Ga0450890_000638 3300042127 Bacteria 5088
513 Ga0450890_003778 3300042127 Bacteria 1998
514 Ga0450891_000250 3300042129 Bacteria 5464
515 Ga0450889_000080 3300042144 Bacteria 8812
516 Ga0450906_001292 3300042145 Bacteria 5495
517 Ga0439446_0036223 3300042156 Bacteria 1441
518 Ga0450908_010111 3300042184 Bacteria 1746
519 Ga0439434_0009598 3300042435 Bacteria 2847
520 Ga0450918_000592 3300042531 Bacteria 7761
521 Ga0451577_0000142 3300042876 Bacteria 160598
522 Ga0451577_0003554 3300042876 Bacteria 17210
523 Ga0451577_0003800 3300042876 Bacteria 16436
524 Ga0466969_0000036 3300044656 Bacteria 75718
525 Ga0466972_0009924 3300044658 Bacteria 4779
526 Ga0466972_0024981 3300044658 Bacteria 2964
527 Ga0453683_0001682 3300044673 Bacteria 18444
528 Ga0466966_0012015 3300044684 Bacteria 5738
529 Ga0466966_0048027 3300044684 Bacteria 2719
530 Ga0466961_0056528 3300044693 Bacteria 2500
531 Ga0466961_0098762 3300044693 Bacteria 1840
532 Ga0466963_0042254 3300044694 Bacteria 2992
533 Ga0466963_0065228 3300044694 Bacteria 2441
534 Ga0466964_0016916 3300044706 Bacteria 2788
535 Ga0453684_0000126 3300044712 Bacteria 336395
536 Ga0453684_0017882 3300044712 Bacteria 10939
537 Ga0466971_0037475 3300044719 Bacteria 2173
538 Ga0466971_0056549 3300044719 Bacteria 1769
539 Ga0466957_0005480 3300044842 Bacteria 7119
540 Ga0466957_0093427 3300044842 Bacteria 1888
541 Ga0466959_0032070 3300045049 Bacteria 3888
542 Ga0466959_0040866 3300045049 Bacteria 3425
543 Ga0466959_0107438 3300045049 Bacteria 1994
544 Ga0451576_0014283 3300045051 Bacteria 8844
545 Ga0451576_0064322 3300045051 Bacteria 3821
546 Ga0451576_0134538 3300045051 Bacteria 2577
547 Ga0451576_0140528 3300045051 Bacteria 2518
548 Ga0466958_0148551 3300045836 Bacteria 1478
549 Ga0466967_0010743 3300045976 Bacteria 6884
550 Ga0466967_0041274 3300045976 Bacteria 3977
551 Ga0495627_006332 3300046453 Bacteria 4650
552 Ga0495638_0024239 3300046460 Bacteria 3959
553 Ga0495638_0123473 3300046460 Bacteria 1528
554 Ga0495650_0003802 3300046471 Bacteria 10751
555 Ga0495650_0080946 3300046471 Bacteria 1252
556 Ga0495580_0123075 3300046472 Bacteria 1800
557 Ga0495639_0018524 3300046475 Bacteria 3032
558 Ga0495608_0113896 3300046511 Bacteria 1737
559 Ga0495610_0075811 3300046512 Bacteria 1556
560 Ga0495616_0002637 3300046513 Bacteria 11790
561 Ga0495620_0086969 3300046515 Bacteria 1257
562 Ga0495632_0004484 3300046519 Bacteria 9469
563 Ga0495632_0052114 3300046519 Bacteria 2012
564 Ga0495637_0004867 3300046520 Bacteria 6907
565 Ga0495643_0048586 3300046522 Bacteria 2292
566 Ga0495663_0022314 3300046525 Bacteria 1828
567 Ga0495654_0022343 3300046530 Bacteria 3286
568 Ga0495598_0043203 3300046537 Bacteria 1326
569 Ga0495621_0022524 3300046539 Bacteria 2089
570 Ga0495668_0110275 3300046616 Bacteria 1505
571 Ga0495625_0000637 3300046660 Bacteria 50416
572 Ga0495625_0021004 3300046660 Bacteria 5033
573 Ga0495625_0133678 3300046660 Bacteria 1678
574 Ga0495661_0081481 3300046665 Bacteria 1865
575 Ga0495588_0005864 3300046674 Bacteria 5500
576 Ga0495588_0017568 3300046674 Bacteria 3477
577 Ga0495588_0029275 3300046674 Bacteria 2762
578 Ga0495658_0058335 3300046683 Bacteria 2208
579 Ga0495658_0068172 3300046683 Bacteria 2059
580 Ga0495671_0008248 3300046692 Bacteria 5872
581 Ga0495649_0071007 3300046694 Bacteria 1866
582 Ga0495600_0146387 3300046809 Bacteria 1531
583 Ga0495680_0086877 3300047322 Bacteria 2353
584 Ga0495687_008669 3300047443 Bacteria 5792
585 Ga0495684_0062759 3300047471 Bacteria 2826
586 Ga0495684_0111202 3300047471 Bacteria 2067
587 Ga0495593_0032224 3300047673 Bacteria 2858
588 Ga0495626_0036928 3300048091 Bacteria 2325
589 Ga0496100_0165933 3300048903 Bacteria 1586
590 Ga0496101_0001014 3300048904 Bacteria 16554
591 Ga0496101_0044216 3300048904 Bacteria 3186
592 Ga0496102_0048010 3300048905 Bacteria 3881
593 Ga0496102_0174882 3300048905 Bacteria 2021
594 Ga0496104_0140458 3300048907 Bacteria 2320
595 Ga0496105_0020999 3300048908 Bacteria 5281
596 Ga0496105_0123977 3300048908 Bacteria 2130
597 Ga0496106_0060061 3300048909 Bacteria 2881
598 Ga0496108_0031835 3300048911 Bacteria 4378
599 Ga0496108_0041875 3300048911 Bacteria 3824
600 Ga0496109_0089425 3300048912 Bacteria 2847
601 Ga0496110_0058417 3300048913 Bacteria 3398
602 Ga0496112_0042744 3300048915 Bacteria 4435
603 Ga0496113_0009957 3300048916 Bacteria 6264
604 Ga0496114_0036202 3300048917 Bacteria 4079
605 Ga0496114_0059887 3300048917 Bacteria 3181
606 Ga0496116_0000570 3300048919 Bacteria 49416
607 Ga0496116_0023532 3300048919 Bacteria 4585
608 Ga0496117_0040746 3300048920 Bacteria 3411
609 Ga0496117_0043935 3300048920 Bacteria 3241
610 Ga0496117_0096473 3300048920 Bacteria 1886
611 Ga0496118_0015239 3300048921 Bacteria 7130
612 Ga0496118_0026715 3300048921 Bacteria 4908
613 Ga0496121_0013227 3300048924 Bacteria 8892
614 Ga0496121_0039089 3300048924 Bacteria 4188
615 Ga0496121_0045368 3300048924 Bacteria 3778
616 Ga0496122_0002024 3300048925 Bacteria 30109
617 Ga0496122_0039252 3300048925 Bacteria 3778
618 Ga0496122_0101312 3300048925 Bacteria 1924
619 Ga0496123_0011766 3300048926 Bacteria 7537
620 Ga0496123_0018667 3300048926 Bacteria 5500
621 Ga0496124_0024458 3300048927 Bacteria 5489
622 Ga0496124_0102595 3300048927 Bacteria 2315
623 Ga0496125_0000692 3300048928 Bacteria 55634
624 Ga0496125_0034947 3300048928 Bacteria 4421
625 Ga0496126_0019096 3300048929 Bacteria 6761
626 Ga0496126_0042569 3300048929 Bacteria 4194
627 Ga0501292_002565 3300049515 Bacteria 2356
628 Ga0501031_0001649 3300049568 Bacteria 14009
629 Ga0501032_0179638 3300049569 Bacteria 1386
630 Ga0501034_0171427 3300049571 Bacteria 2137
631 Ga0501047_0120255 3300049581 Bacteria 2508
632 Ga0501207_005005 3300049654 Bacteria 1822
633 Ga0501252_002568 3300049682 Bacteria 1812
634 Ga0501221_000660 3300049704 Bacteria 5522
635 Ga0501225_0013115 3300049705 Bacteria 2321
636 Ga0501262_001158 3300049759 Bacteria 2988
637 Ga0501035_0073876 3300049822 Bacteria 3017
638 nmdc:mga03683_19859_c1 3300050489 Bacteria 2570
639 nmdc:mga03683_4269_c1 3300050489 Bacteria 4716
640 nmdc:mga03n38_3734_c1 3300050490 Bacteria 4934
641 nmdc:mga03n38_75546_c1 3300050490 Bacteria 1570
642 nmdc:mga00v17_35597_c1 3300050491 Bacteria 2964
643 nmdc:mga0k408_108117_c1 3300050493 Bacteria 1643
644 nmdc:mga0k408_1348_c1 3300050493 Bacteria 13248
645 nmdc:mga0k408_1609_c1 3300050493 Bacteria 12223
646 nmdc:mga0k408_31664_c1 3300050493 Bacteria 3021
647 nmdc:mga0k408_56026_c1 3300050493 Bacteria 2287
648 nmdc:mga0k408_70567_c1 3300050493 Bacteria 2039
649 nmdc:mga0k408_77738_c1 3300050493 Bacteria 1941
650 nmdc:mga06z11_79403_c1 3300050494 Bacteria 1757
651 nmdc:mga07m45_10243_c1 3300050496 Bacteria 4890
652 nmdc:mga07m45_116752_c1 3300050496 Bacteria 1540
653 nmdc:mga07m45_2177_c1 3300050496 Bacteria 9135
654 nmdc:mga07m45_3112_c1 3300050496 Bacteria 7611
655 nmdc:mga07m45_350_c1 3300050496 Bacteria 18847
656 nmdc:mga07m45_49265_c1 3300050496 Bacteria 2371
657 nmdc:mga07m45_7137_c1 3300050496 Bacteria 5690
658 Ga0495601_0015291 3300053077 Bacteria 4638
659 Ga0495601_0065074 3300053077 Bacteria 2320
660 Ga0500610_0046780 3300053079 Bacteria 2247
661 Ga0500610_0046782 3300053079 Bacteria 2247
662 Ga0500635_0000105 3300053080 Bacteria 50250
663 Ga0500578_0000049 3300053086 Bacteria 124281
664 Ga0500643_011857 3300053087 Bacteria 3154
665 Ga0500644_0006796 3300053088 Bacteria 2950
666 Ga0500646_0021966 3300053090 Bacteria 1703
667 Ga0500651_0000029 3300053093 Bacteria 113528
668 Ga0500651_0011703 3300053093 Bacteria 5298
669 Ga0500651_0115430 3300053093 Bacteria 1635
670 Ga0500562_011167 3300053108 Bacteria 2281
671 Ga0500569_023293 3300053109 Bacteria 1662
672 Ga0500571_001234 3300053110 Bacteria 11738
673 Ga0500593_000854 3300053117 Bacteria 11342
674 Ga0500593_022053 3300053117 Bacteria 2810
675 Ga0500594_0006689 3300053118 Bacteria 2596
676 Ga0500607_004123 3300053121 Bacteria 10147
677 Ga0500626_051227 3300053128 Bacteria 1857
678 Ga0500628_003445 3300053129 Bacteria 2611
679 Ga0500652_000044 3300053131 Bacteria 64309
680 Ga0500655_000253 3300053133 Bacteria 12573
681 Ga0500658_0000243 3300053134 Bacteria 25613
682 Ga0500658_0000358 3300053134 Bacteria 20187
683 Ga0500658_0018256 3300053134 Bacteria 2628
684 Ga0500564_020611 3300053138 Bacteria 3016
685 Ga0500568_0014882 3300053139 Bacteria 3497
686 Ga0500568_0034139 3300053139 Bacteria 2082
687 Ga0500590_002579 3300053148 Bacteria 8104
688 Ga0500604_0007709 3300053151 Bacteria 2853
689 Ga0500619_000120 3300053154 Bacteria 20611
690 Ga0500622_0000128 3300053156 Bacteria 79659
691 Ga0500622_0001231 3300053156 Bacteria 21000
692 Ga0500627_0001256 3300053158 Bacteria 7015
693 Ga0500634_0018405 3300053161 Bacteria 3751
694 Ga0500638_022850 3300053162 Bacteria 2967
695 Ga0500570_055631 3300053724 Bacteria 1955
696 Ga0500587_004322 3300053739 Bacteria 1955
697 Ga0466962_0009491 3300061719 Bacteria 4666
698 Ga0466962_0015254 3300061719 Bacteria 3704

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042184 Ga0450908_010111 Ga0450908_010111_496_1671 319
2 3300025231 Ga0207427_100846 Ga0207427_10084616 336
3 3300050496 nmdc:mga07m45_116752_c1 nmdc:mga07m45_116752_c1_27_1121 351
4 3300003320 rootH2_10019508 rootH2_100195083 354
5 3300003752 Ga0055539_1000459 Ga0055539_10004594 354
6 3300003756 Ga0055533_1000080 Ga0055533_100008095 354
7 3300003759 Ga0055525_1001686 Ga0055525_10016863 354
8 3300025226 Ga0209674_100003 Ga0209674_1000031829 354
9 3300025230 Ga0209563_100049 Ga0209563_100049291 354
10 3300025253 Ga0209677_100228 Ga0209677_10022838 354
11 3300046537 Ga0495598_0043203 Ga0495598_0043203_207_1310 360
12 3300048924 Ga0496121_0013227 Ga0496121_0013227_1189_2367 361
13 3300048928 Ga0496125_0034947 Ga0496125_0034947_2729_3907 361
14 3300053139 Ga0500568_0034139 Ga0500568_0034139_22_1113 361
15 3300028794 Ga0307515_10001261 Ga0307515_100012617 367
16 3300031649 Ga0307514_10005380 Ga0307514_1000538011 367
17 3300005367 Ga0070667_100105980 Ga0070667_1001059802 369
18 3300005843 Ga0068860_100028441 Ga0068860_1000284413 369
19 3300028381 Ga0268264_10026955 Ga0268264_100269552 369
20 3300050493 nmdc:mga0k408_77738_c1 nmdc:mga0k408_77738_c1_490_1707 369
21 3300005563 Ga0068855_100103267 Ga0068855_1001032674 371
22 3300025949 Ga0207667_10116090 Ga0207667_101160902 371
23 3300046471 Ga0495650_0003802 Ga0495650_0003802_1697_2923 371
24 3300037466 Ga0395898_0203000 Ga0395898_0203000_143_1399 373
25 3300038443 Ga0395901_0014101 Ga0395901_0014101_6606_7862 373
26 3300044658 Ga0466972_0009924 Ga0466972_0009924_1757_2980 374
27 3300005457 Ga0070662_100004821 Ga0070662_1000048212 375
28 3300025933 Ga0207706_10002276 Ga0207706_1000227614 375
29 3300035086 Ga0373934_0005907 Ga0373934_0005907_241_1497 375
30 3300042120 Ga0450917_000785 Ga0450917_000785_425_1648 375
31 3300042127 Ga0450890_003778 Ga0450890_003778_403_1626 375
32 3300042129 Ga0450891_000250 Ga0450891_000250_627_1850 375
33 3300042144 Ga0450889_000080 Ga0450889_000080_5217_6440 375
34 3300046616 Ga0495668_0110275 Ga0495668_0110275_55_1239 375
35 3300042126 Ga0450888_000705 Ga0450888_000705_1080_2303 376
36 3300003323 rootH1_10022291 rootH1_100222913 377
37 3300005336 Ga0070680_100003562 Ga0070680_1000035623 377
38 3300005458 Ga0070681_10079088 Ga0070681_100790884 377
39 3300025912 Ga0207707_10036154 Ga0207707_100361544 377
40 3300025917 Ga0207660_10017896 Ga0207660_100178966 377
41 3300025921 Ga0207652_10004261 Ga0207652_100042616 377
42 3300028794 Ga0307515_10011478 Ga0307515_1001147822 377
43 3300031616 Ga0307508_10000212 Ga0307508_1000021243 377
44 3300037471 Ga0395905_0035039 Ga0395905_0035039_2226_3524 377
45 3300037471 Ga0395905_0101728 Ga0395905_0101728_1398_2627 377
46 3300006038 Ga0075365_10038179 Ga0075365_100381792 378
47 3300006048 Ga0075363_100035069 Ga0075363_1000350693 378
48 3300006177 Ga0075362_10001536 Ga0075362_100015365 378
49 3300006195 Ga0075366_10050324 Ga0075366_100503242 378
50 3300027866 Ga0209813_10004852 Ga0209813_100048523 378
51 3300031548 Ga0307408_100240990 Ga0307408_1002409902 378
52 3300031911 Ga0307412_10010335 Ga0307412_100103352 378
53 3300031995 Ga0307409_100001082 Ga0307409_10000108214 378
54 3300032002 Ga0307416_100009480 Ga0307416_1000094804 378
55 3300032126 Ga0307415_100029020 Ga0307415_1000290203 378
56 3300037471 Ga0395905_0002495 Ga0395905_0002495_2029_3249 378
57 3300050493 nmdc:mga0k408_108117_c1 nmdc:mga0k408_108117_c1_103_1323 378
58 3300053117 Ga0500593_000854 Ga0500593_000854_9130_10311 378
59 3300005339 Ga0070660_100221488 Ga0070660_1002214882 379
60 3300005344 Ga0070661_100000925 Ga0070661_1000009254 379
61 3300005539 Ga0068853_100179227 Ga0068853_1001792271 379
62 3300005564 Ga0070664_100000939 Ga0070664_10000093924 379
63 3300005577 Ga0068857_100054500 Ga0068857_1000545004 379
64 3300009147 Ga0114129_10753013 Ga0114129_107530131 379
65 3300010375 Ga0105239_10112957 Ga0105239_101129573 379
66 3300025920 Ga0207649_10001141 Ga0207649_1000114114 379
67 3300025932 Ga0207690_10007376 Ga0207690_100073764 379
68 3300025945 Ga0207679_10000201 Ga0207679_1000020134 379
69 3300026041 Ga0207639_10142245 Ga0207639_101422452 379
70 3300026067 Ga0207678_10183439 Ga0207678_101834393 379
71 3300026116 Ga0207674_10147027 Ga0207674_101470272 379
72 3300037471 Ga0395905_0014861 Ga0395905_0014861_3186_4466 379
73 3300049569 Ga0501032_0179638 Ga0501032_0179638_36_1247 379
74 3300049581 Ga0501047_0120255 Ga0501047_0120255_351_1562 379
75 3300050491 nmdc:mga00v17_35597_c1 nmdc:mga00v17_35597_c1_246_1433 379
76 3300050496 nmdc:mga07m45_49265_c1 nmdc:mga07m45_49265_c1_691_1878 379
77 3300036712 Ga0316584_0066702 Ga0316584_0066702_407_1627 380
78 3300031456 Ga0307513_10053003 Ga0307513_100530035 381
79 3300048925 Ga0496122_0039252 Ga0496122_0039252_105_1274 381
80 3300050493 nmdc:mga0k408_70567_c1 nmdc:mga0k408_70567_c1_20_1237 381
81 3300003316 rootH1_10007839 rootH1_100078393 382
82 3300006195 Ga0075366_10003846 Ga0075366_100038464 382
83 3300006353 Ga0075370_10000415 Ga0075370_100004154 382
84 3300042876 Ga0451577_0003554 Ga0451577_0003554_14940_16157 382
85 3300046519 Ga0495632_0004484 Ga0495632_0004484_15_1169 382
86 3300048919 Ga0496116_0000570 Ga0496116_0000570_25294_26565 382
87 3300048925 Ga0496122_0002024 Ga0496122_0002024_3250_4521 382
88 3300048926 Ga0496123_0011766 Ga0496123_0011766_1113_2384 382
89 3300048929 Ga0496126_0019096 Ga0496126_0019096_4826_6097 382
90 3300050496 nmdc:mga07m45_350_c1 nmdc:mga07m45_350_c1_13553_14803 382
91 iso_pu_bacteria 2643221658 2644328763 382
92 3300031649 Ga0307514_10014898 Ga0307514_100148985 383
93 3300053080 Ga0500635_0000105 Ga0500635_0000105_13380_14597 383
94 3300005543 Ga0070672_100173261 Ga0070672_1001732612 384
95 3300014969 Ga0157376_10021468 Ga0157376_100214683 384
96 3300025321 Ga0207656_10020715 Ga0207656_100207152 384
97 3300026067 Ga0207678_10066914 Ga0207678_100669143 384
98 3300037312 Ga0395899_0007650 Ga0395899_0007650_6966_8192 384
99 3300037418 Ga0395900_0001269 Ga0395900_0001269_22772_23998 384
100 3300038443 Ga0395901_0014228 Ga0395901_0014228_6552_7778 384
101 3300048924 Ga0496121_0045368 Ga0496121_0045368_808_2079 384
102 3300044673 Ga0453683_0001682 Ga0453683_0001682_14306_15550 385
103 3300045051 Ga0451576_0064322 Ga0451576_0064322_1344_2588 385
104 3300048917 Ga0496114_0036202 Ga0496114_0036202_461_1675 385
105 3300005355 Ga0070671_100010921 Ga0070671_1000109213 386
106 3300005539 Ga0068853_100005208 Ga0068853_1000052089 386
107 3300009177 Ga0105248_10066801 Ga0105248_100668014 386
108 3300011119 Ga0105246_10088977 Ga0105246_100889774 386
109 3300015262 Ga0182007_10000825 Ga0182007_1000082520 386
110 3300025901 Ga0207688_10029556 Ga0207688_100295562 386
111 3300026041 Ga0207639_10046919 Ga0207639_100469193 386
112 3300042012 Ga0439455_0020619 Ga0439455_0020619_264_1433 386
113 3300046512 Ga0495610_0075811 Ga0495610_0075811_18_1190 386
114 3300046539 Ga0495621_0022524 Ga0495621_0022524_130_1302 386
115 3300046660 Ga0495625_0133678 Ga0495625_0133678_91_1263 386
116 3300046674 Ga0495588_0029275 Ga0495588_0029275_827_1999 386
117 3300048920 Ga0496117_0043935 Ga0496117_0043935_2048_3217 386
118 3300048921 Ga0496118_0015239 Ga0496118_0015239_4408_5577 386
119 3300048924 Ga0496121_0039089 Ga0496121_0039089_943_2115 386
120 3300048925 Ga0496122_0101312 Ga0496122_0101312_312_1484 386
121 3300048927 Ga0496124_0024458 Ga0496124_0024458_3901_5070 386
122 3300053133 Ga0500655_000253 Ga0500655_000253_1686_2858 386
123 3300053162 Ga0500638_022850 Ga0500638_022850_448_1620 386
124 iso_pu_bacteria 2886848708 2886853602 386
125 3300037471 Ga0395905_0000653 Ga0395905_0000653_13561_14751 387
126 3300048905 Ga0496102_0048010 Ga0496102_0048010_977_2197 387
127 3300048927 Ga0496124_0102595 Ga0496124_0102595_421_1599 387
128 iso_pu_bacteria 2585428058 2587731912 387
129 3300031731 Ga0307405_10165237 Ga0307405_101652371 388
130 3300031911 Ga0307412_10018432 Ga0307412_100184322 388
131 3300049759 Ga0501262_001158 Ga0501262_001158_56_1279 388
132 iso_pu_bacteria 2643221644 2644249024 388
133 3300006042 Ga0075368_10037925 Ga0075368_100379252 389
134 3300006048 Ga0075363_100069036 Ga0075363_1000690362 389
135 3300006178 Ga0075367_10105277 Ga0075367_101052772 389
136 3300006353 Ga0075370_10000695 Ga0075370_1000069510 389
137 3300031730 Ga0307516_10074732 Ga0307516_100747322 389
138 3300050490 nmdc:mga03n38_3734_c1 nmdc:mga03n38_3734_c1_1520_2734 389
139 3300050493 nmdc:mga0k408_56026_c1 nmdc:mga0k408_56026_c1_1022_2236 389
140 3300050494 nmdc:mga06z11_79403_c1 nmdc:mga06z11_79403_c1_220_1434 389
141 3300050496 nmdc:mga07m45_2177_c1 nmdc:mga07m45_2177_c1_1810_3027 389
142 3300005353 Ga0070669_100093833 Ga0070669_1000938332 390
143 3300005459 Ga0068867_100038718 Ga0068867_1000387182 390
144 3300005563 Ga0068855_100009834 Ga0068855_1000098347 390
145 3300005844 Ga0068862_100061533 Ga0068862_1000615334 390
146 3300014326 Ga0157380_10157891 Ga0157380_101578912 390
147 3300025949 Ga0207667_10003340 Ga0207667_1000334015 390
148 3300026089 Ga0207648_10016909 Ga0207648_100169093 390
149 3300046475 Ga0495639_0018524 Ga0495639_0018524_625_1938 390
150 3300046511 Ga0495608_0113896 Ga0495608_0113896_234_1547 390
151 3300005262 Ga0065165_1003676 Ga0065165_10036763 391
152 3300025273 Ga0209673_1014477 Ga0209673_10144774 391
153 3300025298 Ga0209050_1000672 Ga0209050_100067238 391
154 3300025303 Ga0209051_1014665 Ga0209051_10146652 391
155 3300041456 Ga0451795_0407166 Ga0451795_0407166_319_1500 391
156 3300046519 Ga0495632_0052114 Ga0495632_0052114_532_1746 391
157 3300046694 Ga0495649_0071007 Ga0495649_0071007_425_1639 391
158 3300050493 nmdc:mga0k408_31664_c1 nmdc:mga0k408_31664_c1_1743_2924 391
159 3300050496 nmdc:mga07m45_10243_c1 nmdc:mga07m45_10243_c1_13_1194 391
160 3300053086 Ga0500578_0000049 Ga0500578_0000049_82652_83833 391
161 3300053090 Ga0500646_0021966 Ga0500646_0021966_476_1657 391
162 3300053093 Ga0500651_0115430 Ga0500651_0115430_325_1506 391
163 3300053156 Ga0500622_0000128 Ga0500622_0000128_54524_55705 391
164 3300002773 JGI25152J39213_1000898 JGI25152J39213_100089813 392
165 3300003771 Ga0055526_1000542 Ga0055526_100054217 392
166 3300003775 Ga0055524_1000084 Ga0055524_10000846 392
167 3300003841 Ga0055541_1002116 Ga0055541_10021164 392
168 3300005262 Ga0065165_1030210 Ga0065165_10302103 392
169 3300005455 Ga0070663_100000949 Ga0070663_1000009499 392
170 3300006048 Ga0075363_100056246 Ga0075363_1000562463 392
171 3300006195 Ga0075366_10001350 Ga0075366_100013508 392
172 3300013296 Ga0157374_10009590 Ga0157374_100095902 392
173 3300025225 Ga0209566_100238 Ga0209566_10023814 392
174 3300025258 Ga0209129_1000041 Ga0209129_1000041171 392
175 3300025295 Ga0209564_1000029 Ga0209564_1000029317 392
176 3300025297 Ga0209758_1000043 Ga0209758_1000043123 392
177 3300026067 Ga0207678_10000522 Ga0207678_1000052222 392
178 3300028794 Ga0307515_10000093 Ga0307515_1000009340 392
179 3300028794 Ga0307515_10004636 Ga0307515_100046363 392
180 3300028794 Ga0307515_10266180 Ga0307515_102661801 392
181 3300030522 Ga0307512_10052945 Ga0307512_100529453 392
182 3300031456 Ga0307513_10004823 Ga0307513_100048232 392
183 3300031616 Ga0307508_10002342 Ga0307508_1000234212 392
184 3300031730 Ga0307516_10003730 Ga0307516_1000373015 392
185 3300031730 Ga0307516_10006738 Ga0307516_100067386 392
186 3300033179 Ga0307507_10057406 Ga0307507_100574065 392
187 3300046471 Ga0495650_0080946 Ga0495650_0080946_33_1217 392
188 3300046522 Ga0495643_0048586 Ga0495643_0048586_301_1485 392
189 3300053739 Ga0500587_004322 Ga0500587_004322_382_1566 392
190 3300005328 Ga0070676_10008798 Ga0070676_100087982 393
191 3300005330 Ga0070690_100060008 Ga0070690_1000600083 393
192 3300005331 Ga0070670_100078288 Ga0070670_1000782882 393
193 3300005333 Ga0070677_10066794 Ga0070677_100667942 393
194 3300005334 Ga0068869_100016845 Ga0068869_1000168455 393
195 3300005335 Ga0070666_10002405 Ga0070666_100024055 393
196 3300005335 Ga0070666_10009812 Ga0070666_100098126 393
197 3300005347 Ga0070668_100005104 Ga0070668_10000510411 393
198 3300005353 Ga0070669_100008394 Ga0070669_1000083945 393
199 3300005354 Ga0070675_100000199 Ga0070675_1000001999 393
200 3300005356 Ga0070674_100002083 Ga0070674_1000020835 393
201 3300005364 Ga0070673_100008889 Ga0070673_1000088893 393
202 3300005367 Ga0070667_100001982 Ga0070667_10000198216 393
203 3300005456 Ga0070678_100016273 Ga0070678_1000162734 393
204 3300005459 Ga0068867_100003310 Ga0068867_1000033105 393
205 3300005459 Ga0068867_100017655 Ga0068867_1000176553 393
206 3300005539 Ga0068853_100347193 Ga0068853_1003471931 393
207 3300005543 Ga0070672_100002369 Ga0070672_1000023695 393
208 3300005564 Ga0070664_100052960 Ga0070664_1000529603 393
209 3300005616 Ga0068852_100039765 Ga0068852_1000397655 393
210 3300005616 Ga0068852_100052008 Ga0068852_1000520084 393
211 3300005617 Ga0068859_100016607 Ga0068859_1000166076 393
212 3300005618 Ga0068864_100000354 Ga0068864_10000035420 393
213 3300005718 Ga0068866_10058734 Ga0068866_100587342 393
214 3300005719 Ga0068861_100005261 Ga0068861_1000052615 393
215 3300005841 Ga0068863_100011545 Ga0068863_1000115452 393
216 3300005842 Ga0068858_100000262 Ga0068858_10000026222 393
217 3300005842 Ga0068858_100008391 Ga0068858_1000083917 393
218 3300005843 Ga0068860_100074043 Ga0068860_1000740434 393
219 3300005844 Ga0068862_100024627 Ga0068862_1000246272 393
220 3300006358 Ga0068871_100051800 Ga0068871_1000518004 393
221 3300006881 Ga0068865_100013265 Ga0068865_1000132656 393
222 3300006931 Ga0097620_100016607 Ga0097620_1000166076 393
223 3300006946 Ga0079104_1022553 Ga0079104_10225533 393
224 3300009176 Ga0105242_10091692 Ga0105242_100916922 393
225 3300009177 Ga0105248_10026083 Ga0105248_100260836 393
226 3300009177 Ga0105248_10083454 Ga0105248_100834545 393
227 3300013104 Ga0157370_10131317 Ga0157370_101313173 393
228 3300013296 Ga0157374_10008718 Ga0157374_100087184 393
229 3300013297 Ga0157378_10242282 Ga0157378_102422821 393
230 3300013306 Ga0163162_10003584 Ga0163162_1000358411 393
231 3300013306 Ga0163162_10006364 Ga0163162_100063645 393
232 3300013308 Ga0157375_10005659 Ga0157375_1000565910 393
233 3300013308 Ga0157375_10015677 Ga0157375_100156776 393
234 3300014325 Ga0163163_10079734 Ga0163163_100797342 393
235 3300014968 Ga0157379_10002033 Ga0157379_1000203311 393
236 3300014968 Ga0157379_10004639 Ga0157379_100046395 393
237 3300014969 Ga0157376_10011894 Ga0157376_100118945 393
238 3300017792 Ga0163161_10009786 Ga0163161_100097865 393
239 3300025899 Ga0207642_10015239 Ga0207642_100152394 393
240 3300025903 Ga0207680_10005119 Ga0207680_100051194 393
241 3300025903 Ga0207680_10032011 Ga0207680_100320111 393
242 3300025907 Ga0207645_10003951 Ga0207645_100039518 393
243 3300025923 Ga0207681_10001915 Ga0207681_100019159 393
244 3300025925 Ga0207650_10059135 Ga0207650_100591352 393
245 3300025926 Ga0207659_10001828 Ga0207659_1000182812 393
246 3300025926 Ga0207659_10027698 Ga0207659_100276982 393
247 3300025933 Ga0207706_10013403 Ga0207706_100134035 393
248 3300025933 Ga0207706_10176074 Ga0207706_101760743 393
249 3300025935 Ga0207709_10023429 Ga0207709_100234293 393
250 3300025940 Ga0207691_10014538 Ga0207691_100145385 393
251 3300025941 Ga0207711_10084753 Ga0207711_100847531 393
252 3300025942 Ga0207689_10033478 Ga0207689_100334782 393
253 3300025960 Ga0207651_10005930 Ga0207651_100059308 393
254 3300025961 Ga0207712_10001833 Ga0207712_1000183310 393
255 3300025986 Ga0207658_10000336 Ga0207658_1000033615 393
256 3300025986 Ga0207658_10031032 Ga0207658_100310324 393
257 3300026023 Ga0207677_10030695 Ga0207677_100306952 393
258 3300026035 Ga0207703_10000277 Ga0207703_1000027713 393
259 3300026035 Ga0207703_10000866 Ga0207703_1000086610 393
260 3300026041 Ga0207639_10218115 Ga0207639_102181152 393
261 3300026075 Ga0207708_10044572 Ga0207708_100445724 393
262 3300026095 Ga0207676_10001342 Ga0207676_1000134220 393
263 3300026095 Ga0207676_10165952 Ga0207676_101659522 393
264 3300026118 Ga0207675_100012833 Ga0207675_1000128335 393
265 3300026142 Ga0207698_10015587 Ga0207698_100155875 393
266 3300026142 Ga0207698_10151905 Ga0207698_101519052 393
267 3300028380 Ga0268265_10010320 Ga0268265_100103202 393
268 3300028381 Ga0268264_10001554 Ga0268264_100015549 393
269 3300028381 Ga0268264_10059434 Ga0268264_100594344 393
270 3300044694 Ga0466963_0065228 Ga0466963_0065228_797_2053 393
271 3300044712 Ga0453684_0017882 Ga0453684_0017882_2249_3436 393
272 3300046660 Ga0495625_0021004 Ga0495625_0021004_339_1565 393
273 3300047443 Ga0495687_008669 Ga0495687_008669_1045_2259 393
274 3300048091 Ga0495626_0036928 Ga0495626_0036928_894_2108 393
275 3300048911 Ga0496108_0041875 Ga0496108_0041875_2051_3265 393
276 3300048913 Ga0496110_0058417 Ga0496110_0058417_822_2036 393
277 3300053134 Ga0500658_0018256 Ga0500658_0018256_319_1533 393
278 3300053148 Ga0500590_002579 Ga0500590_002579_5041_6228 393
279 3300003322 rootL2_10014298 rootL2_1001429811 394
280 3300003771 Ga0055526_1002456 Ga0055526_100245611 394
281 3300006358 Ga0068871_100063594 Ga0068871_1000635943 394
282 3300025295 Ga0209564_1000003 Ga0209564_10000031180 394
283 3300025321 Ga0207656_10074611 Ga0207656_100746112 394
284 3300025945 Ga0207679_10092092 Ga0207679_100920922 394
285 3300031730 Ga0307516_10000383 Ga0307516_100003837 394
286 3300044658 Ga0466972_0024981 Ga0466972_0024981_263_1450 394
287 3300044693 Ga0466961_0056528 Ga0466961_0056528_888_2078 394
288 3300044719 Ga0466971_0037475 Ga0466971_0037475_652_1842 394
289 3300044842 Ga0466957_0093427 Ga0466957_0093427_137_1327 394
290 3300045049 Ga0466959_0107438 Ga0466959_0107438_713_1903 394
291 3300045836 Ga0466958_0148551 Ga0466958_0148551_20_1210 394
292 3300046460 Ga0495638_0123473 Ga0495638_0123473_73_1263 394
293 3300048912 Ga0496109_0089425 Ga0496109_0089425_10_1233 394
294 3300049822 Ga0501035_0073876 Ga0501035_0073876_1676_2863 394
295 3300050489 nmdc:mga03683_4269_c1 nmdc:mga03683_4269_c1_1770_3005 394
296 3300061719 Ga0466962_0009491 Ga0466962_0009491_2087_3277 394
297 iso_pu_bacteria 2547132103 2547372187 394
298 iso_pu_bacteria 2643221580 2643911416 394
299 iso_pu_bacteria 2843690924 2843693349 394
300 3300005459 Ga0068867_100000077 Ga0068867_10000007729 395
301 3300014745 Ga0157377_10000094 Ga0157377_1000009424 395
302 3300026089 Ga0207648_10000193 Ga0207648_1000019324 395
303 3300028794 Ga0307515_10009359 Ga0307515_1000935915 395
304 3300037471 Ga0395905_0083332 Ga0395905_0083332_132_1325 395
305 3300039062 Ga0400483_028483 Ga0400483_028483_5965_7176 395
306 3300039062 Ga0400483_196526 Ga0400483_196526_7132_8343 395
307 3300039062 Ga0400483_246213 Ga0400483_246213_1182_2408 395
308 3300045976 Ga0466967_0010743 Ga0466967_0010743_1499_2746 395
309 3300006353 Ga0075370_10006626 Ga0075370_100066266 396
310 3300031238 Ga0265332_10000009 Ga0265332_10000009207 396
311 3300042876 Ga0451577_0000142 Ga0451577_0000142_41585_42784 396
312 3300044712 Ga0453684_0000126 Ga0453684_0000126_217382_218581 396
313 3300048928 Ga0496125_0000692 Ga0496125_0000692_35599_36816 396
314 iso_pu_bacteria 2585428057 2587727141 396
315 iso_pu_bacteria 2588253510 2588291551 396
316 iso_pu_bacteria 2643221592 2643970683 396
317 iso_pu_bacteria 2643221625 2644139035 396
318 iso_pu_bacteria 2643221648 2644274645 396
319 iso_pu_bacteria 2932401849 2932402901 396
320 iso_pu_bacteria 2585428062 2587757529 397
321 iso_pu_bacteria 2643221544 2643745749 397
322 iso_pu_bacteria 2643221585 2643936822 397
323 iso_pu_bacteria 2643221629 2644167751 397
324 iso_pu_bacteria 2643221639 2644221653 397
325 iso_pu_bacteria 2643221646 2644257582 397
326 iso_pu_bacteria 2643221656 2644318723 397
327 iso_pu_bacteria 2738541337 2739058568 397
328 3300003187 JGI25151J46595_10007994 JGI25151J46595_100079942 398
329 3300003316 rootH1_10006805 rootH1_100068052 398
330 3300003761 Ga0055535_1000198 Ga0055535_100019841 398
331 3300003763 Ga0055529_1000449 Ga0055529_100044910 398
332 3300003781 Ga0055536_1010072 Ga0055536_10100723 398
333 3300003792 Ga0055540_1007552 Ga0055540_10075523 398
334 3300006048 Ga0075363_100028475 Ga0075363_1000284752 398
335 3300006353 Ga0075370_10024655 Ga0075370_100246554 398
336 3300009148 Ga0105243_10009710 Ga0105243_100097105 398
337 3300025242 Ga0209258_100189 Ga0209258_10018984 398
338 3300025256 Ga0209759_1001304 Ga0209759_100130413 398
339 3300025272 Ga0209455_1000092 Ga0209455_100009282 398
340 3300025292 Ga0209676_1003004 Ga0209676_10030045 398
341 3300025294 Ga0209025_1004201 Ga0209025_10042012 398
342 3300025303 Ga0209051_1002578 Ga0209051_10025785 398
343 3300025304 Ga0209257_1007816 Ga0209257_10078164 398
344 3300025935 Ga0207709_10010549 Ga0207709_100105495 398
345 3300031730 Ga0307516_10087585 Ga0307516_100875855 398
346 3300046453 Ga0495627_006332 Ga0495627_006332_3145_4482 398
347 3300048926 Ga0496123_0018667 Ga0496123_0018667_945_2282 398
348 3300049571 Ga0501034_0171427 Ga0501034_0171427_135_1364 398
349 3300025297 Ga0209758_1004896 Ga0209758_10048968 399
350 3300025299 Ga0209256_1000071 Ga0209256_10000716 399
351 3300027395 Ga0209996_1000266 Ga0209996_10002664 399
352 3300027695 Ga0209966_1000003 Ga0209966_100000380 399
353 3300028786 Ga0307517_10069268 Ga0307517_100692682 399
354 3300031456 Ga0307513_10182362 Ga0307513_101823623 399
355 3300042876 Ga0451577_0003800 Ga0451577_0003800_2877_4091 399
356 3300046460 Ga0495638_0024239 Ga0495638_0024239_727_1956 399
357 3300053088 Ga0500644_0006796 Ga0500644_0006796_1213_2442 399
358 3300053093 Ga0500651_0011703 Ga0500651_0011703_423_1652 399
359 3300053108 Ga0500562_011167 Ga0500562_011167_965_2185 399
360 3300053109 Ga0500569_023293 Ga0500569_023293_199_1428 399
361 3300053129 Ga0500628_003445 Ga0500628_003445_883_2112 399
362 3300053131 Ga0500652_000044 Ga0500652_000044_31722_32951 399
363 3300053151 Ga0500604_0007709 Ga0500604_0007709_1310_2539 399
364 3300053724 Ga0500570_055631 Ga0500570_055631_703_1932 399
365 iso_pu_bacteria 2738543013 2739249853 399
366 iso_pu_bacteria 2928115317 2928119250 399
367 iso_pu_bacteria 2945945610 2945946854 399
368 3300003775 Ga0055524_1006922 Ga0055524_10069223 400
369 3300003794 Ga0055531_10000314 Ga0055531_1000031441 400
370 3300003794 Ga0055531_10004814 Ga0055531_100048146 400
371 3300005328 Ga0070676_10054914 Ga0070676_100549142 400
372 3300005329 Ga0070683_100010932 Ga0070683_1000109328 400
373 3300005331 Ga0070670_100120485 Ga0070670_1001204853 400
374 3300005331 Ga0070670_100250349 Ga0070670_1002503491 400
375 3300005331 Ga0070670_100277018 Ga0070670_1002770182 400
376 3300005354 Ga0070675_100070491 Ga0070675_1000704913 400
377 3300005354 Ga0070675_100079444 Ga0070675_1000794444 400
378 3300005354 Ga0070675_100103246 Ga0070675_1001032462 400
379 3300005356 Ga0070674_100023449 Ga0070674_1000234495 400
380 3300005366 Ga0070659_100011073 Ga0070659_1000110738 400
381 3300005456 Ga0070678_100166660 Ga0070678_1001666603 400
382 3300005456 Ga0070678_100248149 Ga0070678_1002481492 400
383 3300005535 Ga0070684_100138264 Ga0070684_1001382643 400
384 3300005539 Ga0068853_100010853 Ga0068853_1000108536 400
385 3300005547 Ga0070693_100024527 Ga0070693_1000245273 400
386 3300005548 Ga0070665_100343037 Ga0070665_1003430371 400
387 3300005563 Ga0068855_100063457 Ga0068855_1000634575 400
388 3300005564 Ga0070664_100011705 Ga0070664_1000117054 400
389 3300005577 Ga0068857_100025674 Ga0068857_1000256743 400
390 3300005578 Ga0068854_100007790 Ga0068854_1000077905 400
391 3300005614 Ga0068856_100011297 Ga0068856_10001129710 400
392 3300005614 Ga0068856_100286755 Ga0068856_1002867552 400
393 3300005616 Ga0068852_100008550 Ga0068852_1000085503 400
394 3300005618 Ga0068864_100012237 Ga0068864_1000122375 400
395 3300005834 Ga0068851_10006140 Ga0068851_100061403 400
396 3300005843 Ga0068860_100175865 Ga0068860_1001758652 400
397 3300005844 Ga0068862_100044660 Ga0068862_1000446605 400
398 3300006237 Ga0097621_100008020 Ga0097621_1000080202 400
399 3300006353 Ga0075370_10023080 Ga0075370_100230802 400
400 3300006358 Ga0068871_100053359 Ga0068871_1000533594 400
401 3300006944 Ga0099823_1006231 Ga0099823_100623113 400
402 3300009093 Ga0105240_10274345 Ga0105240_102743452 400
403 3300009177 Ga0105248_10366178 Ga0105248_103661782 400
404 3300009551 Ga0105238_10003844 Ga0105238_100038445 400
405 3300013105 Ga0157369_10012571 Ga0157369_100125716 400
406 3300013105 Ga0157369_10218354 Ga0157369_102183543 400
407 3300013296 Ga0157374_10082615 Ga0157374_100826153 400
408 3300013296 Ga0157374_10109813 Ga0157374_101098134 400
409 3300013306 Ga0163162_10041320 Ga0163162_100413203 400
410 3300013307 Ga0157372_10028646 Ga0157372_100286465 400
411 3300013307 Ga0157372_10033440 Ga0157372_100334403 400
412 3300013308 Ga0157375_10245080 Ga0157375_102450802 400
413 3300014745 Ga0157377_10003608 Ga0157377_100036085 400
414 3300014968 Ga0157379_10026435 Ga0157379_100264355 400
415 3300014969 Ga0157376_10125555 Ga0157376_101255552 400
416 3300014969 Ga0157376_10374786 Ga0157376_103747862 400
417 3300025273 Ga0209673_1006444 Ga0209673_10064443 400
418 3300025298 Ga0209050_1001494 Ga0209050_10014945 400
419 3300025298 Ga0209050_1021104 Ga0209050_10211042 400
420 3300025299 Ga0209256_1006944 Ga0209256_10069444 400
421 3300025303 Ga0209051_1006092 Ga0209051_10060922 400
422 3300025304 Ga0209257_1000017 Ga0209257_1000017532 400
423 3300025304 Ga0209257_1006088 Ga0209257_10060883 400
424 3300025304 Ga0209257_1019812 Ga0209257_10198122 400
425 3300025321 Ga0207656_10025101 Ga0207656_100251014 400
426 3300025893 Ga0207682_10042804 Ga0207682_100428043 400
427 3300025907 Ga0207645_10019697 Ga0207645_100196972 400
428 3300025907 Ga0207645_10112118 Ga0207645_101121182 400
429 3300025909 Ga0207705_10096464 Ga0207705_100964642 400
430 3300025913 Ga0207695_10136443 Ga0207695_101364433 400
431 3300025920 Ga0207649_10003480 Ga0207649_100034803 400
432 3300025924 Ga0207694_10253970 Ga0207694_102539703 400
433 3300025925 Ga0207650_10001268 Ga0207650_1000126815 400
434 3300025926 Ga0207659_10007870 Ga0207659_100078705 400
435 3300025927 Ga0207687_10030790 Ga0207687_100307904 400
436 3300025932 Ga0207690_10024614 Ga0207690_100246145 400
437 3300025933 Ga0207706_10065915 Ga0207706_100659152 400
438 3300025933 Ga0207706_10108219 Ga0207706_101082192 400
439 3300025941 Ga0207711_10205708 Ga0207711_102057083 400
440 3300025941 Ga0207711_10272333 Ga0207711_102723332 400
441 3300025942 Ga0207689_10000169 Ga0207689_1000016948 400
442 3300025944 Ga0207661_10008632 Ga0207661_100086322 400
443 3300025945 Ga0207679_10038726 Ga0207679_100387262 400
444 3300025949 Ga0207667_10025900 Ga0207667_100259005 400
445 3300026067 Ga0207678_10026579 Ga0207678_100265792 400
446 3300026078 Ga0207702_10003457 Ga0207702_100034573 400
447 3300026078 Ga0207702_10083180 Ga0207702_100831802 400
448 3300026095 Ga0207676_10019417 Ga0207676_100194176 400
449 3300026116 Ga0207674_10028197 Ga0207674_100281973 400
450 3300026118 Ga0207675_100002188 Ga0207675_10000218811 400
451 3300026142 Ga0207698_10102988 Ga0207698_101029883 400
452 3300027296 Ga0209389_1031428 Ga0209389_10314286 400
453 3300028794 Ga0307515_10002344 Ga0307515_1000234429 400
454 3300028794 Ga0307515_10095741 Ga0307515_100957411 400
455 3300032005 Ga0307411_10000263 Ga0307411_100002635 400
456 3300035114 Ga0373939_0000017 Ga0373939_0000017_26133_27350 400
457 3300035695 Ga0373927_0101333 Ga0373927_0101333_361_1569 400
458 3300036401 Ga0373937_0011642 Ga0373937_0011642_5684_6910 400
459 3300036401 Ga0373937_0049070 Ga0373937_0049070_1319_2527 400
460 3300036401 Ga0373937_0135862 Ga0373937_0135862_1060_2268 400
461 3300037068 Ga0373925_0048137 Ga0373925_0048137_1773_2981 400
462 3300037471 Ga0395905_0000733 Ga0395905_0000733_18773_19987 400
463 3300039437 Ga0436365_1804558 Ga0436365_1804558_1290_2495 400
464 3300045051 Ga0451576_0014283 Ga0451576_0014283_5981_7195 400
465 3300045051 Ga0451576_0140528 Ga0451576_0140528_413_1630 400
466 3300046472 Ga0495580_0123075 Ga0495580_0123075_561_1766 400
467 3300046683 Ga0495658_0058335 Ga0495658_0058335_29_1237 400
468 3300046683 Ga0495658_0068172 Ga0495658_0068172_300_1508 400
469 3300046809 Ga0495600_0146387 Ga0495600_0146387_93_1301 400
470 3300047322 Ga0495680_0086877 Ga0495680_0086877_989_2197 400
471 3300047471 Ga0495684_0062759 Ga0495684_0062759_998_2206 400
472 3300047471 Ga0495684_0111202 Ga0495684_0111202_601_1809 400
473 3300048915 Ga0496112_0042744 Ga0496112_0042744_128_1333 400
474 3300049654 Ga0501207_005005 Ga0501207_005005_377_1600 400
475 3300049682 Ga0501252_002568 Ga0501252_002568_14_1231 400
476 3300049704 Ga0501221_000660 Ga0501221_000660_2416_3639 400
477 3300050493 nmdc:mga0k408_1609_c1 nmdc:mga0k408_1609_c1_10041_11252 400
478 3300053077 Ga0495601_0015291 Ga0495601_0015291_1707_2915 400
479 3300053077 Ga0495601_0065074 Ga0495601_0065074_47_1255 400
480 3300053154 Ga0500619_000120 Ga0500619_000120_2256_3506 400
481 iso_pu_bacteria 2513020051 2513230261 400
482 iso_pu_bacteria 2643221544 2643742169 400
483 iso_pu_bacteria 2643221660 2644340717 400
484 iso_pu_bacteria 2643221672 2644398089 400
485 iso_pu_bacteria 2738541277 2738719990 400
486 iso_pu_bacteria 2738543019 2739279189 400
487 iso_pu_bacteria 2831864461 2831865667 400
488 iso_pu_bacteria 2842677519 2842682388 400
489 iso_pu_bacteria 2886848708 2886848849 400
490 iso_pu_bacteria 2904449895 2904454826 400
491 iso_pu_bacteria 2904456579 2904462601 400
492 iso_pu_bacteria 2919462493 2919464042 400
493 iso_pu_bacteria 2929520902 2929523861 400
494 iso_pu_bacteria 2945972063 2945976571 400
495 3300003791 Ga0055530_10002750 Ga0055530_100027502 401
496 3300003792 Ga0055540_1000086 Ga0055540_100008647 401
497 3300003794 Ga0055531_10004962 Ga0055531_100049621 401
498 3300005331 Ga0070670_100000948 Ga0070670_1000009483 401
499 3300005355 Ga0070671_100166654 Ga0070671_1001666543 401
500 3300005543 Ga0070672_100002690 Ga0070672_1000026903 401
501 3300005564 Ga0070664_100092362 Ga0070664_1000923622 401
502 3300006946 Ga0079104_1000100 Ga0079104_100010076 401
503 3300025298 Ga0209050_1010817 Ga0209050_10108172 401
504 3300025303 Ga0209051_1000210 Ga0209051_100021047 401
505 3300025304 Ga0209257_1000314 Ga0209257_100031447 401
506 3300025926 Ga0207659_10005032 Ga0207659_100050325 401
507 3300025940 Ga0207691_10007407 Ga0207691_100074073 401
508 3300025960 Ga0207651_10024218 Ga0207651_100242184 401
509 3300026023 Ga0207677_10224051 Ga0207677_102240512 401
510 3300026095 Ga0207676_10006001 Ga0207676_100060019 401
511 3300026121 Ga0207683_10005419 Ga0207683_1000541911 401
512 3300026121 Ga0207683_10129230 Ga0207683_101292303 401
513 3300027111 Ga0209281_1000084 Ga0209281_100008433 401
514 3300028794 Ga0307515_10000110 Ga0307515_1000011065 401
515 3300031456 Ga0307513_10125808 Ga0307513_101258082 401
516 3300037418 Ga0395900_0000025 Ga0395900_0000025_209347_210567 401
517 3300037471 Ga0395905_0227784 Ga0395905_0227784_393_1616 401
518 3300042012 Ga0439455_0010450 Ga0439455_0010450_207_1466 401
519 3300044656 Ga0466969_0000036 Ga0466969_0000036_65979_67205 401
520 3300044684 Ga0466966_0012015 Ga0466966_0012015_1623_2849 401
521 3300044684 Ga0466966_0048027 Ga0466966_0048027_803_2020 401
522 3300044693 Ga0466961_0098762 Ga0466961_0098762_423_1649 401
523 3300044694 Ga0466963_0042254 Ga0466963_0042254_631_1848 401
524 3300044706 Ga0466964_0016916 Ga0466964_0016916_488_1705 401
525 3300044719 Ga0466971_0056549 Ga0466971_0056549_139_1356 401
526 3300044842 Ga0466957_0005480 Ga0466957_0005480_5051_6268 401
527 3300045049 Ga0466959_0032070 Ga0466959_0032070_1356_2573 401
528 3300045049 Ga0466959_0040866 Ga0466959_0040866_597_1823 401
529 3300045976 Ga0466967_0041274 Ga0466967_0041274_303_1520 401
530 3300048911 Ga0496108_0031835 Ga0496108_0031835_1057_2271 401
531 3300049515 Ga0501292_002565 Ga0501292_002565_1092_2315 401
532 3300061719 Ga0466962_0015254 Ga0466962_0015254_1435_2652 401
533 iso_pu_bacteria 2599185214 2599624002 401
534 iso_pu_bacteria 2599185226 2599672013 401
535 iso_pu_bacteria 2599185227 2599681905 401
536 iso_pu_bacteria 2599185229 2599693918 401
537 iso_pu_bacteria 2643221683 2644469207 401
538 iso_pu_bacteria 2818991446 2819596454 401
539 iso_pu_bacteria 2831265667 2831270215 401
540 iso_pu_bacteria 2838054893 2838059980 401
541 iso_pu_bacteria 2885198086 2885199588 401
542 iso_pu_bacteria 2885211737 2885213139 401
543 iso_pu_bacteria 2899924645 2899931167 401
544 iso_pu_bacteria 2904541872 2904546808 401
545 iso_pu_bacteria 2928037797 2928038056 401
546 iso_pu_bacteria 2928044640 2928046338 401
547 iso_pu_bacteria 2928051484 2928054030 401
548 iso_pu_bacteria 2928064002 2928065783 401
549 iso_pu_bacteria 2928070936 2928077894 401
550 iso_pu_bacteria 2928084124 2928088676 401
551 iso_pu_bacteria 2929160207 2929164281 401
552 iso_pu_bacteria 2954767861 2954771604 401
553 3300003792 Ga0055540_1025041 Ga0055540_10250412 402
554 3300005354 Ga0070675_100035240 Ga0070675_1000352403 402
555 3300005364 Ga0070673_100038837 Ga0070673_1000388373 402
556 3300005456 Ga0070678_100036463 Ga0070678_1000364633 402
557 3300009177 Ga0105248_10014983 Ga0105248_100149836 402
558 3300025303 Ga0209051_1004580 Ga0209051_10045804 402
559 3300025940 Ga0207691_10324899 Ga0207691_103248992 402
560 3300025960 Ga0207651_10037938 Ga0207651_100379384 402
561 3300026121 Ga0207683_10053921 Ga0207683_100539214 402
562 3300031649 Ga0307514_10001506 Ga0307514_1000150625 402
563 3300031911 Ga0307412_10129725 Ga0307412_101297251 402
564 3300037471 Ga0395905_0004455 Ga0395905_0004455_11032_12255 402
565 3300048908 Ga0496105_0123977 Ga0496105_0123977_578_1828 402
566 3300048916 Ga0496113_0009957 Ga0496113_0009957_3950_5200 402
567 3300049568 Ga0501031_0001649 Ga0501031_0001649_3794_5086 402
568 iso_pu_bacteria 2643221585 2643933730 402
569 iso_pu_bacteria 2643221656 2644315223 402
570 iso_pu_bacteria 2643221660 2644341188 402
571 3300003316 rootH1_10001837 rootH1_1000183711 403
572 3300003320 rootH2_10007324 rootH2_100073244 403
573 3300003322 rootL2_10004836 rootL2_1000483620 403
574 3300003773 Ga0055537_1009910 Ga0055537_10099102 403
575 3300003781 Ga0055536_1003127 Ga0055536_10031274 403
576 3300003784 Ga0055534_1000722 Ga0055534_10007225 403
577 3300003790 Ga0055528_1021372 Ga0055528_10213722 403
578 3300003791 Ga0055530_10005842 Ga0055530_100058425 403
579 3300003792 Ga0055540_1003253 Ga0055540_10032533 403
580 3300003794 Ga0055531_10001855 Ga0055531_1000185511 403
581 3300005262 Ga0065165_1000239 Ga0065165_100023941 403
582 3300005334 Ga0068869_100160653 Ga0068869_1001606531 403
583 3300005366 Ga0070659_100123416 Ga0070659_1001234163 403
584 3300005457 Ga0070662_100015528 Ga0070662_1000155283 403
585 3300005539 Ga0068853_100273601 Ga0068853_1002736012 403
586 3300005564 Ga0070664_100084929 Ga0070664_1000849293 403
587 3300005616 Ga0068852_100010615 Ga0068852_1000106155 403
588 3300005616 Ga0068852_100138477 Ga0068852_1001384773 403
589 3300006353 Ga0075370_10012978 Ga0075370_100129782 403
590 3300009036 Ga0105244_10004693 Ga0105244_100046935 403
591 3300009148 Ga0105243_10020150 Ga0105243_100201503 403
592 3300009545 Ga0105237_10050257 Ga0105237_100502571 403
593 3300009551 Ga0105238_10243712 Ga0105238_102437122 403
594 3300012497 Ga0157319_1000031 Ga0157319_100003118 403
595 3300013104 Ga0157370_10102679 Ga0157370_101026793 403
596 3300013104 Ga0157370_10361301 Ga0157370_103613012 403
597 3300013105 Ga0157369_10013458 Ga0157369_100134587 403
598 3300013306 Ga0163162_10024877 Ga0163162_100248772 403
599 3300014497 Ga0182008_10000838 Ga0182008_100008384 403
600 3300014497 Ga0182008_10011535 Ga0182008_100115351 403
601 3300015261 Ga0182006_1002216 Ga0182006_10022161 403
602 3300015262 Ga0182007_10000601 Ga0182007_100006018 403
603 3300015265 Ga0182005_1014672 Ga0182005_10146723 403
604 3300025273 Ga0209673_1023559 Ga0209673_10235592 403
605 3300025284 Ga0209130_1002969 Ga0209130_10029694 403
606 3300025291 Ga0209675_1002859 Ga0209675_10028593 403
607 3300025292 Ga0209676_1001007 Ga0209676_10010075 403
608 3300025292 Ga0209676_1024270 Ga0209676_10242702 403
609 3300025298 Ga0209050_1001089 Ga0209050_10010895 403
610 3300025299 Ga0209256_1000637 Ga0209256_100063724 403
611 3300025303 Ga0209051_1000347 Ga0209051_100034757 403
612 3300025304 Ga0209257_1000449 Ga0209257_100044954 403
613 3300025304 Ga0209257_1005834 Ga0209257_10058346 403
614 3300025304 Ga0209257_1009230 Ga0209257_10092304 403
615 3300025728 Ga0207655_1001731 Ga0207655_100173117 403
616 3300025933 Ga0207706_10025344 Ga0207706_100253444 403
617 3300025935 Ga0207709_10001584 Ga0207709_1000158415 403
618 3300025945 Ga0207679_10042670 Ga0207679_100426703 403
619 3300025986 Ga0207658_10083045 Ga0207658_100830454 403
620 3300026121 Ga0207683_10090600 Ga0207683_100906003 403
621 3300026142 Ga0207698_10002643 Ga0207698_100026436 403
622 3300026142 Ga0207698_10103117 Ga0207698_101031174 403
623 3300031548 Ga0307408_100029808 Ga0307408_1000298085 403
624 3300042127 Ga0450890_000638 Ga0450890_000638_2687_3976 403
625 3300046674 Ga0495588_0017568 Ga0495588_0017568_957_2171 403
626 3300048903 Ga0496100_0165933 Ga0496100_0165933_338_1552 403
627 3300048904 Ga0496101_0001014 Ga0496101_0001014_13915_15129 403
628 3300048904 Ga0496101_0044216 Ga0496101_0044216_626_2047 403
629 3300048905 Ga0496102_0174882 Ga0496102_0174882_593_1807 403
630 3300048907 Ga0496104_0140458 Ga0496104_0140458_908_2122 403
631 3300048908 Ga0496105_0020999 Ga0496105_0020999_3495_4709 403
632 3300048909 Ga0496106_0060061 Ga0496106_0060061_330_1544 403
633 3300048917 Ga0496114_0059887 Ga0496114_0059887_886_2100 403
634 3300048919 Ga0496116_0023532 Ga0496116_0023532_627_1853 403
635 3300048920 Ga0496117_0040746 Ga0496117_0040746_330_1556 403
636 3300048921 Ga0496118_0026715 Ga0496118_0026715_1225_2451 403
637 3300048929 Ga0496126_0042569 Ga0496126_0042569_2759_3994 403
638 3300050496 nmdc:mga07m45_3112_c1 nmdc:mga07m45_3112_c1_1521_2810 403
639 3300053156 Ga0500622_0001231 Ga0500622_0001231_17717_18952 403
640 iso_pu_bacteria 2738541307 2738881491 403
641 3300003187 JGI25151J46595_10001314 JGI25151J46595_100013143 404
642 3300003578 Ga0006562J51391_1114750 Ga0006562J51391_11147502 404
643 3300003773 Ga0055537_1000490 Ga0055537_10004903 404
644 3300003784 Ga0055534_1000042 Ga0055534_100004294 404
645 3300003790 Ga0055528_1000242 Ga0055528_100024249 404
646 3300003791 Ga0055530_10000492 Ga0055530_1000049229 404
647 3300003792 Ga0055540_1006309 Ga0055540_10063093 404
648 3300006038 Ga0075365_10055119 Ga0075365_100551192 404
649 3300006051 Ga0075364_10053785 Ga0075364_100537851 404
650 3300006177 Ga0075362_10029707 Ga0075362_100297074 404
651 3300006353 Ga0075370_10002974 Ga0075370_100029749 404
652 3300006353 Ga0075370_10008542 Ga0075370_100085426 404
653 3300006353 Ga0075370_10046427 Ga0075370_100464272 404
654 3300006948 Ga0099826_10061797 Ga0099826_100617974 404
655 3300013100 Ga0157373_10027789 Ga0157373_100277894 404
656 3300013104 Ga0157370_10037489 Ga0157370_100374892 404
657 3300014497 Ga0182008_10021365 Ga0182008_100213654 404
658 3300015262 Ga0182007_10020840 Ga0182007_100208401 404
659 3300017792 Ga0163161_10011479 Ga0163161_100114796 404
660 3300017792 Ga0163161_10046138 Ga0163161_100461383 404
661 3300017792 Ga0163161_10051214 Ga0163161_100512142 404
662 3300025229 Ga0209147_101458 Ga0209147_1014587 404
663 3300025242 Ga0209258_100199 Ga0209258_10019910 404
664 3300025245 Ga0207425_1004716 Ga0207425_10047163 404
665 3300025254 Ga0209148_1000179 Ga0209148_100017910 404
666 3300025258 Ga0209129_1000071 Ga0209129_1000071123 404
667 3300025258 Ga0209129_1001902 Ga0209129_10019028 404
668 3300025263 Ga0209565_1000083 Ga0209565_100008395 404
669 3300025263 Ga0209565_1002195 Ga0209565_10021951 404
670 3300025273 Ga0209673_1000534 Ga0209673_100053452 404
671 3300025273 Ga0209673_1001906 Ga0209673_10019062 404
672 3300025284 Ga0209130_1000773 Ga0209130_100077323 404
673 3300025284 Ga0209130_1016985 Ga0209130_10169852 404
674 3300025291 Ga0209675_1000081 Ga0209675_100008195 404
675 3300025291 Ga0209675_1006924 Ga0209675_10069243 404
676 3300025291 Ga0209675_1009436 Ga0209675_10094362 404
677 3300025291 Ga0209675_1015228 Ga0209675_10152281 404
678 3300025292 Ga0209676_1000005 Ga0209676_100000560 404
679 3300025292 Ga0209676_1020636 Ga0209676_10206363 404
680 3300025294 Ga0209025_1000544 Ga0209025_100054414 404
681 3300025294 Ga0209025_1007365 Ga0209025_10073653 404
682 3300025294 Ga0209025_1017392 Ga0209025_10173922 404
683 3300025294 Ga0209025_1033991 Ga0209025_10339912 404
684 3300025295 Ga0209564_1000239 Ga0209564_100023946 404
685 3300025295 Ga0209564_1029136 Ga0209564_10291362 404
686 3300025297 Ga0209758_1000027 Ga0209758_1000027386 404
687 3300025297 Ga0209758_1003037 Ga0209758_10030373 404
688 3300025298 Ga0209050_1000007 Ga0209050_10000071038 404
689 3300025298 Ga0209050_1020188 Ga0209050_10201882 404
690 3300025299 Ga0209256_1000081 Ga0209256_1000081123 404
691 3300025299 Ga0209256_1025046 Ga0209256_10250462 404
692 3300025302 Ga0207426_1000027 Ga0207426_1000027351 404
693 3300025302 Ga0207426_1000614 Ga0207426_100061453 404
694 3300025303 Ga0209051_1000009 Ga0209051_100000960 404
695 3300025303 Ga0209051_1000373 Ga0209051_100037340 404
696 3300025303 Ga0209051_1000553 Ga0209051_100055335 404
697 3300025304 Ga0209257_1000011 Ga0209257_100001134 404
698 3300025909 Ga0207705_10084324 Ga0207705_100843242 404
699 3300025924 Ga0207694_10112687 Ga0207694_101126873 404
700 3300025935 Ga0207709_10048245 Ga0207709_100482454 404
701 3300027666 Ga0209282_1023309 Ga0209282_10233095 404
702 3300027907 Ga0207428_10156042 Ga0207428_101560421 404
703 3300030731 Ga0316177_1127556 Ga0316177_11275564 404
704 3300030734 Ga0316179_1097547 Ga0316179_10975471 404
705 3300030735 Ga0316178_1094039 Ga0316178_10940392 404
706 3300030742 Ga0316183_1057193 Ga0316183_10571933 404
707 3300030744 Ga0316181_1035278 Ga0316181_10352783 404
708 3300031548 Ga0307408_100205089 Ga0307408_1002050892 404
709 3300031649 Ga0307514_10085169 Ga0307514_100851694 404
710 3300031731 Ga0307405_10001308 Ga0307405_100013087 404
711 3300031731 Ga0307405_10057533 Ga0307405_100575332 404
712 3300031901 Ga0307406_10000749 Ga0307406_100007499 404
713 3300041411 Ga0439466_0035434 Ga0439466_0035434_120_1343 404
714 3300042002 Ga0439442_000506 Ga0439442_000506_397_1620 404
715 3300042145 Ga0450906_001292 Ga0450906_001292_2922_4145 404
716 3300042156 Ga0439446_0036223 Ga0439446_0036223_41_1264 404
717 3300042435 Ga0439434_0009598 Ga0439434_0009598_1434_2657 404
718 3300042531 Ga0450918_000592 Ga0450918_000592_2941_4164 404
719 3300046513 Ga0495616_0002637 Ga0495616_0002637_1444_2673 404
720 3300046515 Ga0495620_0086969 Ga0495620_0086969_13_1236 404
721 3300046520 Ga0495637_0004867 Ga0495637_0004867_2189_3412 404
722 3300046525 Ga0495663_0022314 Ga0495663_0022314_380_1609 404
723 3300046530 Ga0495654_0022343 Ga0495654_0022343_696_1925 404
724 3300046660 Ga0495625_0000637 Ga0495625_0000637_42696_43919 404
725 3300046665 Ga0495661_0081481 Ga0495661_0081481_128_1351 404
726 3300046674 Ga0495588_0005864 Ga0495588_0005864_3830_5053 404
727 3300046692 Ga0495671_0008248 Ga0495671_0008248_3183_4406 404
728 3300047673 Ga0495593_0032224 Ga0495593_0032224_974_2203 404
729 3300048920 Ga0496117_0096473 Ga0496117_0096473_352_1581 404
730 3300049705 Ga0501225_0013115 Ga0501225_0013115_448_1671 404
731 3300050489 nmdc:mga03683_19859_c1 nmdc:mga03683_19859_c1_1072_2295 404
732 3300050490 nmdc:mga03n38_75546_c1 nmdc:mga03n38_75546_c1_147_1370 404
733 3300050496 nmdc:mga07m45_7137_c1 nmdc:mga07m45_7137_c1_2534_3757 404
734 3300053079 Ga0500610_0046780 Ga0500610_0046780_201_1424 404
735 3300053079 Ga0500610_0046782 Ga0500610_0046782_201_1424 404
736 3300053087 Ga0500643_011857 Ga0500643_011857_192_1421 404
737 3300053093 Ga0500651_0000029 Ga0500651_0000029_70736_71965 404
738 3300053110 Ga0500571_001234 Ga0500571_001234_810_2039 404
739 3300053117 Ga0500593_022053 Ga0500593_022053_1321_2544 404
740 3300053118 Ga0500594_0006689 Ga0500594_0006689_728_1957 404
741 3300053121 Ga0500607_004123 Ga0500607_004123_1602_2825 404
742 3300053128 Ga0500626_051227 Ga0500626_051227_473_1702 404
743 3300053134 Ga0500658_0000243 Ga0500658_0000243_22794_24023 404
744 3300053134 Ga0500658_0000358 Ga0500658_0000358_17368_18597 404
745 3300053138 Ga0500564_020611 Ga0500564_020611_1496_2725 404
746 3300053139 Ga0500568_0014882 Ga0500568_0014882_900_2129 404
747 3300053158 Ga0500627_0001256 Ga0500627_0001256_2505_3728 404
748 3300053161 Ga0500634_0018405 Ga0500634_0018405_2403_3626 404
749 iso_pu_bacteria 2643221628 2644162818 404
750 iso_pu_bacteria 2904479285 2904482634 404
751 iso_pu_bacteria 2945909444 2945913043 404
752 iso_pu_bacteria 2945984333 2945984673 404
753 3300002704 JGI25155J39150_1000079 JGI25155J39150_100007924 405
754 3300002705 JGI25156J39149_1000125 JGI25156J39149_100012524 405
755 3300002738 JGI25154J39366_1000141 JGI25154J39366_100014130 405
756 3300002741 JGI25157J39369_1000159 JGI25157J39369_100015924 405
757 3300006195 Ga0075366_10004344 Ga0075366_100043443 405
758 3300025206 Ga0209435_100001 Ga0209435_10000129 405
759 3300025246 Ga0209646_1000001 Ga0209646_1000001398 405
760 3300025250 Ga0209026_1000003 Ga0209026_100000329 405
761 3300025256 Ga0209759_1000001 Ga0209759_100000129 405
762 3300028794 Ga0307515_10121365 Ga0307515_101213652 405
763 3300045051 Ga0451576_0134538 Ga0451576_0134538_1012_2238 405
764 3300050493 nmdc:mga0k408_1348_c1 nmdc:mga0k408_1348_c1_10368_11591 405

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

80

388

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hpk-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form 0.9256 9 391
6zgr-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution 0.9101 13 393
6hcl-assembly2.cif.gz_B crystal structure of a mfs transporter with ligand at 2.69 angstroem resolution 0.9078 13 393
7ckr-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate bay-8002 in the outward-open conformation. 0.9021 11 391
6zgr-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution 0.9008 13 393
ID Description Score Start End Superfamily
af_Q5NC32_11_193_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9439 10 189 1.20.1250.20
af_H2L0E6_75_299_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9351 11 189 1.20.1250.20
af_F1QFN0_14_227_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9229 9 195 1.20.1250.20
af_Q556Y5_341_577_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9215 216 394 1.20.1250.20
af_O15375_7_200_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9188 10 202 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7M2JH25-F1-model_v4 MFS transporter 0.9884 10 397 GO:0016020
GO:0022857
AF-A0A024EIE2-F1-model_v4 Putative transporter 0.9875 14 397 GO:0016020
GO:0022857
AF-A0A7Y8UWI0-F1-model_v4 MFS transporter 0.9866 10 397 GO:0016020
GO:0022857
AF-A0A5R9QNT0-F1-model_v4 MFS transporter 0.9866 10 399 GO:0016020
GO:0022857
AF-Q9I458-F1-model_v4 Probable major facilitator superfamily (MFS) transporter 0.9858 10 397 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
92.87 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map