F479749

General Info

Members Datasets Scaffolds Average Seq Length
764 515 569 211

Family's Representative Sequence

Representative Sequence 3300048916|Ga0496113_0318827|Ga0496113_0318827_378_1082
Length 234
Sequence VVDLTDSIRTSVEAARRRALDPHRIGHRPEHGERVHVEPTGHGEGGPASKRIVTAYGFWLFLLSDIVMFSAFFAAYAVLQNETAGGPSGHQVFELPRVAVETGVLLLSSFTCGLAAISTWNRNMMLAQGGLLITGILGAIFLGLEIQEFVGLVQQGAGPQRSAFLSSFFAVVGCHGLHVTAGLLWLGTMMAQIYVKGFTAPIMRRMLCFSLFWHTLDIIWVAIFTVVYLMGAAR

Samples

Sample ID Description Type Environment
1 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
2 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
3 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
4 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
5 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
6 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
7 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
8 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
9 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
10 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
11 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
12 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
13 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
14 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
15 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
16 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
17 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
18 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
19 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
20 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
21 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
22 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
23 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
24 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
25 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
26 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
27 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
28 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
29 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
30 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
31 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
32 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
33 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
34 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
35 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
36 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
37 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
38 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
39 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
40 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
41 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
42 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
43 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
44 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
45 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
46 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
47 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
48 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
49 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
50 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
51 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
52 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
53 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
54 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
55 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
56 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
57 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
58 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
59 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
60 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
61 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
62 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
63 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
64 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
65 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
66 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
67 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
68 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
69 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
70 2922368715
71 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
72 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
73 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
74 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
75 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
76 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
77 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
78 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
79 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
80 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
81 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
82 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
83 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
84 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
85 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
86 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
87 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
88 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
89 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
90 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
91 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
92 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
93 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
94 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
95 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
96 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
97 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
98 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
99 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
100 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
101 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
102 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
103 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
104 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
105 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
106 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
107 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
108 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
109 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
110 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
111 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
112 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
113 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
114 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
115 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
116 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
117 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
118 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
119 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
120 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
121 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
122 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
123 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
124 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
125 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
126 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
127 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
128 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
129 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
130 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
131 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
132 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
133 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
134 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
135 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
136 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
137 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
138 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
139 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
140 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
141 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
142 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
143 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
144 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
145 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
146 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
147 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
148 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
149 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
150 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
151 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
152 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
153 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
154 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
155 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
156 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
157 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
158 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
159 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
160 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
161 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
162 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
163 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
164 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
165 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
166 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
167 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
168 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
169 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
170 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
171 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
172 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
173 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
174 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
175 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
176 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
177 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
178 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
179 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
180 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
181 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
182 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
183 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
184 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
185 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
186 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
187 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
188 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
189 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
190 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
191 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
192 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
193 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
194 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
195 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
196 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
197 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
198 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
199 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
200 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
201 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
202 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
203 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
204 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
205 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
206 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
207 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
208 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
209 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
210 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
211 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
212 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
213 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
214 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
215 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
216 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
217 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
218 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
219 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
220 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
221 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
222 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
223 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
224 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
225 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
226 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
227 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
228 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
229 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
230 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
231 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
232 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
233 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
234 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
235 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
236 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
237 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
238 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
239 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
240 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
241 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
242 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
244 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
245 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
246 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
247 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
248 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
249 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
250 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
251 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
252 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
301 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
302 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
303 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
304 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
305 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
309 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
310 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
312 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
313 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
314 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
315 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
316 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
317 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
318 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
319 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
320 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
321 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
322 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
323 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
324 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
325 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
326 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
327 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
328 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
329 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
330 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
331 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
332 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
333 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
334 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
335 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
336 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
337 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
338 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
339 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
340 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
341 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
342 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
343 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
344 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
345 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
346 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
347 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
348 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
349 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
350 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
351 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
352 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
353 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
354 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
355 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
356 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
357 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
358 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
359 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
360 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
361 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
362 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
363 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
364 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
365 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
366 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
367 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
368 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
369 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
370 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
371 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
372 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
373 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
374 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
375 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
376 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
377 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
378 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
379 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
380 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
381 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
382 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
383 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
384 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
385 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
386 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
387 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
388 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
389 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
390 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
391 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
392 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
393 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
394 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
395 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
396 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
397 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
398 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
399 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
400 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
401 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
402 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
403 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
404 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
405 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
406 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
407 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
408 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
409 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
410 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
411 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
412 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
413 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
414 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
415 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
416 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
417 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
418 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
419 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
420 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
421 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
422 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
423 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
424 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
425 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
426 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
427 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
428 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
429 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
430 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
431 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
432 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
433 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
435 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
436 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
437 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
438 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
439 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
440 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
441 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
442 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
443 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
444 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
445 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
446 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
447 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
448 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
449 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
450 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
451 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
452 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
453 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
454 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
455 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
456 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
457 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
458 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
459 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
460 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
461 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
462 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
463 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
464 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
465 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
466 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
467 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
468 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
469 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
470 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
471 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
472 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
473 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
474 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
475 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
476 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
477 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
478 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
479 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
480 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
481 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
482 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
483 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
484 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
485 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
486 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
487 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
488 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
489 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
490 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
491 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
492 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
493 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
494 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
495 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
496 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
497 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
498 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
499 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
500 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
501 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
502 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
503 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
504 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
505 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
506 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
507 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
508 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
509 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
510 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
511 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
512 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
513 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
514 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
515 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74.31
Metatranscriptomes 0.26
Isolates 25.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.7
Nodule 20.42
Rhizoplane 5.1
Rhizosphere 51.57
Stem 0
Stem Tuber 0
Unclassified 10.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006778J45830_1034026 3300003162 Bacteria 1476
2 JGI25153J46596_10000382 3300003215 Bacteria 30334
3 JGI25153J46596_10000866 3300003215 Bacteria 18445
4 JGI25153J46596_10020786 3300003215 Bacteria 2469
5 JGI25160J50197_1008546 3300003354 Bacteria 3892
6 JGI25160J50197_1034463 3300003354 Bacteria 1256
7 JGI25404J52841_10005170 3300003659 Bacteria 2689
8 JGI25404J52841_10026591 3300003659 Bacteria 1245
9 Ga0055542_1011299 3300003762 Bacteria 1590
10 Ga0055531_10009703 3300003794 Bacteria 4890
11 Ga0065165_1007525 3300005262 Bacteria 5324
12 Ga0065165_1013398 3300005262 Bacteria 3262
13 Ga0065165_1021063 3300005262 Bacteria 2274
14 Ga0065165_1080168 3300005262 Bacteria 849
15 Ga0070658_10001212 3300005327 Bacteria 22108
16 Ga0070670_100207773 3300005331 Bacteria 1702
17 Ga0068869_100029200 3300005334 Bacteria 3862
18 Ga0070680_100005766 3300005336 Bacteria 9397
19 Ga0070680_100040498 3300005336 Bacteria 3773
20 Ga0068868_100297556 3300005338 Bacteria 1370
21 Ga0070660_100022424 3300005339 Bacteria 4669
22 Ga0070660_100392313 3300005339 Bacteria 1147
23 Ga0070689_100260260 3300005340 Bacteria 1434
24 Ga0070691_10001227 3300005341 Bacteria 10789
25 Ga0070691_10080946 3300005341 Bacteria 1590
26 Ga0070661_100327148 3300005344 Bacteria 1198
27 Ga0070692_10232327 3300005345 Bacteria 1095
28 Ga0070668_100008050 3300005347 Bacteria 7830
29 Ga0070668_100044763 3300005347 Bacteria 3395
30 Ga0070668_100933803 3300005347 Bacteria 777
31 Ga0070669_100207912 3300005353 Bacteria 1543
32 Ga0070669_100230897 3300005353 Bacteria 1467
33 Ga0070671_100027263 3300005355 Bacteria 4700
34 Ga0070659_100010946 3300005366 Bacteria 6695
35 Ga0070659_100721747 3300005366 Bacteria 863
36 Ga0070667_100145002 3300005367 Bacteria 2082
37 Ga0070667_100278456 3300005367 Bacteria 1502
38 Ga0070709_10005157 3300005434 Bacteria 7064
39 Ga0070714_100015761 3300005435 Bacteria 6089
40 Ga0070713_100058872 3300005436 Bacteria 3205
41 Ga0070710_10000365 3300005437 Bacteria 21212
42 Ga0070711_100026986 3300005439 Bacteria 3766
43 Ga0070700_100002024 3300005441 Bacteria 10300
44 Ga0070700_100626568 3300005441 Bacteria 846
45 Ga0070694_100209333 3300005444 Bacteria 1458
46 Ga0070694_100458294 3300005444 Bacteria 1008
47 Ga0070663_100197971 3300005455 Bacteria 1566
48 Ga0070681_10003277 3300005458 Bacteria 15111
49 Ga0068867_100247432 3300005459 Bacteria 1449
50 Ga0068867_100274054 3300005459 Bacteria 1381
51 Ga0068867_100588161 3300005459 Bacteria 969
52 Ga0070699_100180950 3300005518 Bacteria 1871
53 Ga0070679_100042350 3300005530 Bacteria 4534
54 Ga0070679_100046776 3300005530 Bacteria 4314
55 Ga0068853_100680305 3300005539 Bacteria 980
56 Ga0070672_100532313 3300005543 Bacteria 1019
57 Ga0070695_100028544 3300005545 Bacteria 3463
58 Ga0070695_100195299 3300005545 Bacteria 1443
59 Ga0070696_100318707 3300005546 Bacteria 1196
60 Ga0070693_100040292 3300005547 Bacteria 2622
61 Ga0070665_100206180 3300005548 Bacteria 1966
62 Ga0068855_100097304 3300005563 Bacteria 3390
63 Ga0070664_100056411 3300005564 Bacteria 3338
64 Ga0068857_100419995 3300005577 Bacteria 1247
65 Ga0068857_100436560 3300005577 Bacteria 1223
66 Ga0068854_100054453 3300005578 Bacteria 2877
67 Ga0068856_100232712 3300005614 Bacteria 1858
68 Ga0068852_100008125 3300005616 Bacteria 7703
69 Ga0068859_100759878 3300005617 Bacteria 1058
70 Ga0068864_100003579 3300005618 Bacteria 12843
71 Ga0068864_100121864 3300005618 Bacteria 2333
72 Ga0068861_100016921 3300005719 Bacteria 5169
73 Ga0068863_100014883 3300005841 Bacteria 7473
74 Ga0068863_100728340 3300005841 Bacteria 987
75 Ga0068858_100023729 3300005842 Bacteria 5714
76 Ga0068860_100393111 3300005843 Bacteria 1370
77 Ga0068862_100008858 3300005844 Bacteria 8328
78 Ga0068862_100084443 3300005844 Bacteria 2758
79 Ga0068862_100847467 3300005844 Bacteria 896
80 Ga0081455_10007030 3300005937 Bacteria 11953
81 Ga0081455_10009306 3300005937 Bacteria 10114
82 Ga0081540_1000017 3300005983 Bacteria 164991
83 Ga0081540_1000078 3300005983 Bacteria 105731
84 Ga0081540_1007853 3300005983 Bacteria 7543
85 Ga0081540_1012584 3300005983 Bacteria 5558
86 Ga0081540_1018670 3300005983 Bacteria 4245
87 Ga0081540_1066978 3300005983 Bacteria 1680
88 Ga0070717_10717149 3300006028 Bacteria 909
89 Ga0075365_10014773 3300006038 Bacteria 4704
90 Ga0075365_10069480 3300006038 Bacteria 2367
91 Ga0075365_10072477 3300006038 Bacteria 2320
92 Ga0075365_10123032 3300006038 Bacteria 1791
93 Ga0075365_10382220 3300006038 Bacteria 993
94 Ga0075368_10001778 3300006042 Bacteria 6934
95 Ga0075368_10012643 3300006042 Bacteria 3091
96 Ga0075368_10064874 3300006042 Bacteria 1467
97 Ga0075364_10049670 3300006051 Bacteria 2737
98 Ga0070715_10070744 3300006163 Bacteria 1558
99 Ga0070715_10191885 3300006163 Bacteria 1032
100 Ga0070716_100001478 3300006173 Bacteria 10491
101 Ga0070712_100085722 3300006175 Bacteria 2294
102 Ga0070712_100350781 3300006175 Bacteria 1208
103 Ga0070712_100539579 3300006175 Bacteria 982
104 Ga0075367_10017567 3300006178 Bacteria 3929
105 Ga0075367_10122301 3300006178 Bacteria 1604
106 Ga0075369_10090979 3300006186 Bacteria 1361
107 Ga0075366_10060210 3300006195 Bacteria 2255
108 Ga0075370_10178410 3300006353 Bacteria 1250
109 Ga0075428_100025674 3300006844 Bacteria 6524
110 Ga0075428_100229569 3300006844 Bacteria 2003
111 Ga0075431_100791770 3300006847 Bacteria 922
112 Ga0075433_10159111 3300006852 Bacteria 2010
113 Ga0075429_100064871 3300006880 Bacteria 3180
114 Ga0068865_100237362 3300006881 Bacteria 1433
115 Ga0068865_100900097 3300006881 Bacteria 769
116 Ga0075436_100145761 3300006914 Bacteria 1665
117 Ga0075436_100153831 3300006914 Bacteria 1619
118 Ga0097620_100759962 3300006931 Bacteria 1058
119 Ga0099824_1006549 3300006942 Bacteria 15916
120 Ga0099794_10005774 3300007265 Bacteria 4986
121 Ga0105250_10103767 3300009092 Bacteria 1161
122 Ga0105240_10003221 3300009093 Bacteria 25561
123 Ga0111539_10048435 3300009094 Bacteria 5074
124 Ga0111539_10720354 3300009094 Bacteria 1161
125 Ga0105245_10144738 3300009098 Bacteria 2242
126 Ga0105245_10160545 3300009098 Bacteria 2132
127 Ga0105245_10282591 3300009098 Bacteria 1622
128 Ga0105245_11224024 3300009098 Bacteria 799
129 Ga0105247_10073108 3300009101 Bacteria 2148
130 Ga0105247_10143578 3300009101 Bacteria 1566
131 Ga0105247_10379589 3300009101 Bacteria 1002
132 Ga0114129_10059664 3300009147 Bacteria 5334
133 Ga0114129_10623557 3300009147 Bacteria 1395
134 Ga0105243_10125489 3300009148 Bacteria 2170
135 Ga0105243_10793392 3300009148 Bacteria 933
136 Ga0105241_10010811 3300009174 Bacteria 6696
137 Ga0105241_10118598 3300009174 Bacteria 2128
138 Ga0105241_11050095 3300009174 Bacteria 765
139 Ga0105242_10325097 3300009176 Bacteria 1412
140 Ga0105242_10422237 3300009176 Bacteria 1250
141 Ga0105248_10132608 3300009177 Bacteria 2811
142 Ga0105237_10005500 3300009545 Bacteria 14281
143 Ga0105237_10075297 3300009545 Bacteria 3367
144 Ga0105237_10119799 3300009545 Bacteria 2625
145 Ga0105237_10119842 3300009545 Bacteria 2625
146 Ga0105237_10300958 3300009545 Bacteria 1607
147 Ga0105237_10557305 3300009545 Bacteria 1153
148 Ga0105238_10073624 3300009551 Bacteria 3410
149 Ga0105238_10181097 3300009551 Bacteria 2084
150 Ga0105238_10694498 3300009551 Bacteria 1029
151 Ga0105238_10845669 3300009551 Bacteria 932
152 Ga0105249_10067369 3300009553 Bacteria 3298
153 Ga0105249_10515424 3300009553 Bacteria 1242
154 Ga0105249_10534418 3300009553 Bacteria 1221
155 Ga0105239_10019071 3300010375 Bacteria 7580
156 Ga0105239_10087057 3300010375 Bacteria 3443
157 Ga0105239_10089922 3300010375 Bacteria 3387
158 Ga0105239_11318236 3300010375 Bacteria 833
159 Ga0105246_10007792 3300011119 Bacteria 6572
160 Ga0105246_10016096 3300011119 Bacteria 4733
161 Ga0157313_1008720 3300012503 Bacteria 823
162 Ga0157369_10798827 3300013105 Bacteria 969
163 Ga0157374_10074019 3300013296 Bacteria 3215
164 Ga0157374_10131828 3300013296 Bacteria 2419
165 Ga0157378_10452876 3300013297 Bacteria 1274
166 Ga0157378_10576021 3300013297 Bacteria 1134
167 Ga0163162_10612834 3300013306 Bacteria 1214
168 Ga0163162_10644725 3300013306 Bacteria 1183
169 Ga0163162_10810640 3300013306 Bacteria 1053
170 Ga0157375_10092375 3300013308 Bacteria 3090
171 Ga0157375_10266839 3300013308 Bacteria 1873
172 Ga0157375_10507607 3300013308 Bacteria 1370
173 Ga0157375_11121658 3300013308 Bacteria 921
174 Ga0163163_10137837 3300014325 Bacteria 2481
175 Ga0163163_10229157 3300014325 Bacteria 1907
176 Ga0157379_10084744 3300014968 Bacteria 2840
177 Ga0157376_10040795 3300014969 Bacteria 3796
178 Ga0157376_11046952 3300014969 Bacteria 840
179 Ga0213876_10327341 3300021384 Bacteria 815
180 Ga0213875_10032002 3300021388 Bacteria 2486
181 Ga0207425_1011313 3300025245 Bacteria 2135
182 Ga0209677_102259 3300025253 Bacteria 7447
183 Ga0209148_1000215 3300025254 Bacteria 99154
184 Ga0209148_1016708 3300025254 Bacteria 1259
185 Ga0209233_1003181 3300025261 Bacteria 5822
186 Ga0209455_1008636 3300025272 Bacteria 2751
187 Ga0209455_1013643 3300025272 Bacteria 1876
188 Ga0209564_1011412 3300025295 Bacteria 3983
189 Ga0209758_1000011 3300025297 Bacteria 1049685
190 Ga0209758_1001216 3300025297 Bacteria 32369
191 Ga0209758_1034165 3300025297 Bacteria 2029
192 Ga0209758_1037744 3300025297 Bacteria 1862
193 Ga0209256_1042801 3300025299 Bacteria 1141
194 Ga0207426_1000328 3300025302 Bacteria 90659
195 Ga0207426_1000401 3300025302 Bacteria 73412
196 Ga0207426_1003045 3300025302 Bacteria 9674
197 Ga0209051_1042126 3300025303 Bacteria 1616
198 Ga0209257_1001041 3300025304 Bacteria 36987
199 Ga0209257_1014048 3300025304 Bacteria 3485
200 Ga0207697_10038176 3300025315 Bacteria 1968
201 Ga0207696_1037975 3300025711 Bacteria 1423
202 Ga0207653_10025668 3300025885 Bacteria 1885
203 Ga0207692_10142245 3300025898 Bacteria 1365
204 Ga0207692_10281125 3300025898 Bacteria 1007
205 Ga0207692_10608970 3300025898 Bacteria 703
206 Ga0207710_10039883 3300025900 Bacteria 2079
207 Ga0207710_10070797 3300025900 Bacteria 1599
208 Ga0207710_10146203 3300025900 Bacteria 1144
209 Ga0207688_10332323 3300025901 Bacteria 934
210 Ga0207647_10065490 3300025904 Bacteria 2205
211 Ga0207685_10036515 3300025905 Bacteria 1802
212 Ga0207685_10219287 3300025905 Bacteria 904
213 Ga0207645_10032757 3300025907 Bacteria 3341
214 Ga0207705_10013570 3300025909 Bacteria 5881
215 Ga0207705_10467031 3300025909 Bacteria 979
216 Ga0207654_10015065 3300025911 Bacteria 4005
217 Ga0207654_10059922 3300025911 Bacteria 2222
218 Ga0207695_10000163 3300025913 Bacteria 197030
219 Ga0207695_10057168 3300025913 Bacteria 4054
220 Ga0207671_10014329 3300025914 Bacteria 6272
221 Ga0207693_10047440 3300025915 Bacteria 3375
222 Ga0207693_10057106 3300025915 Bacteria 3060
223 Ga0207663_10013373 3300025916 Bacteria 4459
224 Ga0207660_10163391 3300025917 Bacteria 1719
225 Ga0207660_10237016 3300025917 Bacteria 1436
226 Ga0207657_10032848 3300025919 Bacteria 4683
227 Ga0207657_10233010 3300025919 Bacteria 1472
228 Ga0207657_10401783 3300025919 Bacteria 1078
229 Ga0207649_10224843 3300025920 Bacteria 1339
230 Ga0207652_10040169 3300025921 Bacteria 3972
231 Ga0207681_10080928 3300025923 Bacteria 2292
232 Ga0207681_10103243 3300025923 Bacteria 2060
233 Ga0207681_10325051 3300025923 Bacteria 1224
234 Ga0207687_10732124 3300025927 Bacteria 841
235 Ga0207700_10171233 3300025928 Bacteria 1812
236 Ga0207700_10345699 3300025928 Bacteria 1294
237 Ga0207664_10064017 3300025929 Bacteria 2940
238 Ga0207644_10403010 3300025931 Bacteria 1118
239 Ga0207690_10132735 3300025932 Bacteria 1825
240 Ga0207706_10153487 3300025933 Bacteria 2026
241 Ga0207706_10574199 3300025933 Bacteria 970
242 Ga0207709_10704510 3300025935 Bacteria 808
243 Ga0207665_10045091 3300025939 Bacteria 2952
244 Ga0207711_10100127 3300025941 Bacteria 2563
245 Ga0207689_10027067 3300025942 Bacteria 4800
246 Ga0207689_10166533 3300025942 Bacteria 1816
247 Ga0207679_10585352 3300025945 Bacteria 1004
248 Ga0207667_10051440 3300025949 Bacteria 4343
249 Ga0207651_10416573 3300025960 Bacteria 1146
250 Ga0207712_10005237 3300025961 Bacteria 8203
251 Ga0207712_10107032 3300025961 Bacteria 2090
252 Ga0207668_10010796 3300025972 Bacteria 5531
253 Ga0207668_10109186 3300025972 Bacteria 2072
254 Ga0207668_10592215 3300025972 Bacteria 965
255 Ga0207668_10757214 3300025972 Bacteria 857
256 Ga0207668_10833140 3300025972 Bacteria 818
257 Ga0207640_10757380 3300025981 Bacteria 838
258 Ga0207658_10199073 3300025986 Bacteria 1671
259 Ga0207677_10977717 3300026023 Bacteria 766
260 Ga0207703_10383554 3300026035 Bacteria 1300
261 Ga0207703_10581924 3300026035 Bacteria 1058
262 Ga0207639_10040096 3300026041 Bacteria 3494
263 Ga0207678_10002535 3300026067 Bacteria 16646
264 Ga0207678_10051021 3300026067 Bacteria 3572
265 Ga0207678_10178394 3300026067 Bacteria 1814
266 Ga0207708_10053244 3300026075 Bacteria 3083
267 Ga0207702_10667428 3300026078 Bacteria 1023
268 Ga0207641_10232071 3300026088 Bacteria 1715
269 Ga0207641_10296263 3300026088 Bacteria 1526
270 Ga0207648_10098990 3300026089 Bacteria 2553
271 Ga0207676_10015881 3300026095 Bacteria 5445
272 Ga0207676_10188754 3300026095 Bacteria 1812
273 Ga0207674_10152501 3300026116 Bacteria 2267
274 Ga0207674_10296417 3300026116 Bacteria 1566
275 Ga0207674_10438554 3300026116 Bacteria 1262
276 Ga0207675_100022244 3300026118 Bacteria 5904
277 Ga0207675_100026604 3300026118 Bacteria 5386
278 Ga0207675_100090389 3300026118 Bacteria 2879
279 Ga0207675_101268520 3300026118 Bacteria 757
280 Ga0209389_1000043 3300027296 Bacteria 123224
281 Ga0209589_1000047 3300027357 Bacteria 118659
282 Ga0209489_100075 3300027361 Bacteria 136991
283 Ga0209813_10010109 3300027866 Bacteria 2432
284 Ga0209813_10037372 3300027866 Bacteria 1463
285 Ga0265356_1002401 3300028017 Bacteria 2521
286 Ga0268266_10074320 3300028379 Bacteria 2951
287 Ga0268266_10144418 3300028379 Bacteria 2138
288 Ga0268266_10179697 3300028379 Bacteria 1926
289 Ga0268266_10483692 3300028379 Bacteria 1180
290 Ga0268265_10004213 3300028380 Bacteria 10051
291 Ga0268265_10011792 3300028380 Bacteria 5909
292 Ga0268265_10753703 3300028380 Bacteria 945
293 Ga0268264_10152244 3300028381 Bacteria 2075
294 Ga0307517_10015766 3300028786 Bacteria 10008
295 Ga0265338_10518201 3300028800 Bacteria 838
296 Ga0265762_1010283 3300030760 Bacteria 1671
297 Ga0265340_10141046 3300031247 Bacteria 1102
298 Ga0307510_10013929 3300033180 Bacteria 9524
299 Ga0307510_10108851 3300033180 Bacteria 2523
300 Ga0307510_10110063 3300033180 Bacteria 2501
301 Ga0373958_0030821 3300034819 Bacteria 1051
302 Ga0373938_0047875 3300034957 Bacteria 968
303 Ga0373940_0123635 3300035088 Bacteria 805
304 Ga0373939_0002714 3300035114 Bacteria 4152
305 Ga0373939_0035806 3300035114 Bacteria 1465
306 Ga0373941_0009356 3300035115 Bacteria 2466
307 Ga0373960_0003056 3300035121 Bacteria 3778
308 Ga0373942_0120166 3300035207 Bacteria 820
309 Ga0373931_0001206 3300035691 Bacteria 11056
310 Ga0373931_0076583 3300035691 Bacteria 1838
311 Ga0373935_0221262 3300035692 Bacteria 1315
312 Ga0373935_0777394 3300035692 Bacteria 706
313 Ga0373927_0094432 3300035695 Bacteria 1943
314 Ga0373927_0205860 3300035695 Bacteria 1292
315 Ga0373933_0020776 3300035724 Bacteria 3723
316 Ga0373937_0133666 3300036401 Bacteria 2318
317 Ga0373925_0060216 3300037068 Bacteria 2851
318 Ga0373925_0372268 3300037068 Bacteria 1162
319 Ga0395899_0089761 3300037312 Bacteria 2229
320 Ga0395900_0529256 3300037418 Bacteria 1126
321 Ga0395898_0335243 3300037466 Bacteria 1442
322 Ga0395898_0542514 3300037466 Bacteria 1105
323 Ga0395905_0012507 3300037471 Bacteria 8168
324 Ga0395905_0018328 3300037471 Bacteria 6645
325 Ga0395905_0054352 3300037471 Bacteria 3748
326 Ga0395905_0155569 3300037471 Bacteria 2150
327 Ga0436364_0731834 3300037853 Bacteria 14258
328 Ga0436364_1166421 3300037853 Bacteria 4329
329 Ga0395901_0198551 3300038443 Bacteria 2103
330 Ga0436365_0458129 3300039437 Bacteria 2330
331 Ga0436365_1115190 3300039437 Bacteria 4366
332 Ga0436365_1828458 3300039437 Bacteria 1604
333 Ga0436360_0111883 3300039438 Bacteria 1546
334 Ga0436360_0595666 3300039438 Bacteria 7463
335 Ga0436360_0934711 3300039438 Bacteria 4193
336 Ga0436361_0122632 3300039447 Bacteria 5177
337 Ga0436361_0371970 3300039447 Bacteria 3745
338 Ga0436361_0420563 3300039447 Bacteria 1883
339 Ga0436361_0887352 3300039447 Bacteria 988
340 Ga0436361_1076341 3300039447 Bacteria 1930
341 Ga0436363_1321995 3300039450 Bacteria 2864
342 Ga0451793_0114728 3300041452 Bacteria 888
343 Ga0451802_0309198 3300041460 Bacteria 2262
344 Ga0451847_0585162 3300041503 Bacteria 994
345 Ga0466969_0017547 3300044656 Bacteria 3735
346 Ga0466972_0000079 3300044658 Bacteria 90348
347 Ga0466972_0009117 3300044658 Bacteria 4982
348 Ga0466965_0404835 3300044683 Bacteria 754
349 Ga0466966_0000191 3300044684 Bacteria 40906
350 Ga0466966_0038670 3300044684 Bacteria 3074
351 Ga0466961_0000005 3300044693 Bacteria 173105
352 Ga0466961_0264600 3300044693 Bacteria 1054
353 Ga0466963_0027201 3300044694 Bacteria 3661
354 Ga0466964_0013726 3300044706 Bacteria 3074
355 Ga0466968_0002291 3300044735 Bacteria 6991
356 Ga0466968_0013541 3300044735 Bacteria 3208
357 Ga0466968_0399680 3300044735 Bacteria 673
358 Ga0466960_0005971 3300044901 Bacteria 4860
359 Ga0466959_0000686 3300045049 Bacteria 19811
360 Ga0466959_0002371 3300045049 Bacteria 12012
361 Ga0466959_0008511 3300045049 Bacteria 7260
362 Ga0495592_0005617 3300046454 Bacteria 9270
363 Ga0495603_0109239 3300046455 Bacteria 1614
364 Ga0495590_0004144 3300046457 Bacteria 5874
365 Ga0495629_0068066 3300046459 Bacteria 2484
366 Ga0495638_0012188 3300046460 Bacteria 5904
367 Ga0495651_0075133 3300046462 Bacteria 2563
368 Ga0495653_0260767 3300046463 Bacteria 1146
369 Ga0495580_0335880 3300046472 Bacteria 1025
370 Ga0495605_0195907 3300046474 Bacteria 882
371 Ga0495664_0013587 3300046477 Bacteria 4617
372 Ga0495585_0086257 3300046492 Bacteria 1696
373 Ga0495594_0290599 3300046499 Bacteria 931
374 Ga0495583_0093324 3300046506 Bacteria 1293
375 Ga0495583_0133749 3300046506 Bacteria 1036
376 Ga0495606_0006512 3300046507 Bacteria 10745
377 Ga0495606_0037284 3300046507 Bacteria 3303
378 Ga0495608_0050003 3300046511 Bacteria 2774
379 Ga0495616_0117918 3300046513 Bacteria 1227
380 Ga0495616_0173136 3300046513 Bacteria 964
381 Ga0495618_0330247 3300046514 Bacteria 943
382 Ga0495630_0070906 3300046517 Bacteria 2622
383 Ga0495632_0042247 3300046519 Bacteria 2286
384 Ga0495637_0096336 3300046520 Bacteria 1161
385 Ga0495643_0113127 3300046522 Bacteria 1378
386 Ga0495648_0002859 3300046524 Bacteria 15545
387 Ga0495648_0004938 3300046524 Bacteria 11210
388 Ga0495648_0069214 3300046524 Bacteria 2055
389 Ga0495642_0122822 3300046528 Bacteria 1115
390 Ga0495652_0007795 3300046529 Bacteria 9835
391 Ga0495652_0090985 3300046529 Bacteria 2495
392 Ga0495640_0012370 3300046533 Bacteria 6523
393 Ga0495640_0018187 3300046533 Bacteria 5222
394 Ga0495640_0237112 3300046533 Bacteria 1146
395 Ga0495586_0023355 3300046535 Bacteria 3303
396 Ga0495587_0015262 3300046536 Bacteria 4799
397 Ga0495597_0085928 3300046542 Bacteria 1340
398 Ga0495622_0021822 3300046557 Bacteria 2982
399 Ga0495622_0147897 3300046557 Bacteria 1064
400 Ga0495667_0026653 3300046559 Bacteria 3895
401 Ga0495668_0202737 3300046616 Bacteria 1086
402 Ga0495611_0162669 3300046648 Bacteria 1043
403 Ga0495625_0005741 3300046660 Bacteria 11219
404 Ga0495625_0282974 3300046660 Bacteria 1066
405 Ga0495635_0016958 3300046663 Bacteria 5087
406 Ga0495635_0084299 3300046663 Bacteria 2175
407 Ga0495661_0246378 3300046665 Bacteria 914
408 Ga0495661_0289632 3300046665 Bacteria 823
409 Ga0495657_0002353 3300046675 Bacteria 15899
410 Ga0495657_0043382 3300046675 Bacteria 3067
411 Ga0495599_0040889 3300046678 Bacteria 2911
412 Ga0495623_0006848 3300046679 Bacteria 7415
413 Ga0495646_0026710 3300046680 Bacteria 3624
414 Ga0495646_0077445 3300046680 Bacteria 1945
415 Ga0495613_0033602 3300046689 Bacteria 3811
416 Ga0495624_0014326 3300046690 Bacteria 5384
417 Ga0495671_0251568 3300046692 Bacteria 853
418 Ga0495671_0319339 3300046692 Bacteria 746
419 Ga0495649_0055252 3300046694 Bacteria 2146
420 Ga0495600_0022782 3300046809 Bacteria 4025
421 Ga0495600_0047266 3300046809 Bacteria 2807
422 Ga0495660_0192882 3300046810 Bacteria 978
423 Ga0495581_0161739 3300047315 Bacteria 1309
424 Ga0495604_0000880 3300047317 Bacteria 24979
425 Ga0495604_0003285 3300047317 Bacteria 12908
426 Ga0495604_0336389 3300047317 Bacteria 1006
427 Ga0495674_0006001 3300047319 Bacteria 11663
428 Ga0495674_0360623 3300047319 Bacteria 1179
429 Ga0495674_0381103 3300047319 Bacteria 1141
430 Ga0495674_0527679 3300047319 Bacteria 942
431 Ga0495672_0060474 3300047320 Bacteria 2188
432 Ga0495676_0025204 3300047321 Bacteria 5138
433 Ga0495683_0193043 3300047323 Bacteria 923
434 Ga0495687_009990 3300047443 Bacteria 5246
435 Ga0495673_0056592 3300047469 Bacteria 1696
436 Ga0495684_0039841 3300047471 Bacteria 3602
437 Ga0495684_0120104 3300047471 Bacteria 1980
438 Ga0495686_0247308 3300047472 Bacteria 1003
439 Ga0495593_0127306 3300047673 Bacteria 1294
440 Ga0495602_0015087 3300048088 Bacteria 7814
441 Ga0495602_0159031 3300048088 Bacteria 1766
442 Ga0496100_0047811 3300048903 Bacteria 2759
443 Ga0496100_0351290 3300048903 Bacteria 1114
444 Ga0496101_0056192 3300048904 Bacteria 2845
445 Ga0496102_0233059 3300048905 Bacteria 1736
446 Ga0496103_0009908 3300048906 Bacteria 5635
447 Ga0496103_0073435 3300048906 Bacteria 2143
448 Ga0496103_0078961 3300048906 Bacteria 2067
449 Ga0496104_0016046 3300048907 Bacteria 6799
450 Ga0496104_0063133 3300048907 Bacteria 3512
451 Ga0496104_0141062 3300048907 Bacteria 2315
452 Ga0496105_0029226 3300048908 Bacteria 4511
453 Ga0496105_0066282 3300048908 Bacteria 2980
454 Ga0496105_0114413 3300048908 Bacteria 2225
455 Ga0496105_0218689 3300048908 Bacteria 1551
456 Ga0496105_0266788 3300048908 Bacteria 1383
457 Ga0496105_0445441 3300048908 Bacteria 1023
458 Ga0496106_0083480 3300048909 Bacteria 2457
459 Ga0496106_0182894 3300048909 Bacteria 1664
460 Ga0496106_0438869 3300048909 Bacteria 1049
461 Ga0496107_0021613 3300048910 Bacteria 4548
462 Ga0496107_0077875 3300048910 Bacteria 2415
463 Ga0496108_0036540 3300048911 Bacteria 4087
464 Ga0496108_0247411 3300048911 Bacteria 1551
465 Ga0496109_0086032 3300048912 Bacteria 2903
466 Ga0496110_0397006 3300048913 Bacteria 1257
467 Ga0496111_0226472 3300048914 Bacteria 1389
468 Ga0496112_0080942 3300048915 Bacteria 3211
469 Ga0496112_0484864 3300048915 Bacteria 1172
470 Ga0496113_0265711 3300048916 Bacteria 1371
471 Ga0496113_0318827 3300048916 Bacteria 1246
472 Ga0496113_0376540 3300048916 Bacteria 1139
473 Ga0496114_0105195 3300048917 Bacteria 2414
474 Ga0496115_0012837 3300048918 Bacteria 6317
475 Ga0496115_0035582 3300048918 Bacteria 3940
476 Ga0496115_0473385 3300048918 Bacteria 1009
477 Ga0496115_0591971 3300048918 Bacteria 883
478 Ga0496116_0285380 3300048919 Bacteria 796
479 Ga0496117_0104996 3300048920 Bacteria 1777
480 Ga0496117_0109006 3300048920 Bacteria 1730
481 Ga0496118_0055077 3300048921 Bacteria 3005
482 Ga0496118_0105880 3300048921 Bacteria 1883
483 Ga0496118_0129484 3300048921 Bacteria 1624
484 Ga0496118_0191564 3300048921 Bacteria 1222
485 Ga0496119_0016898 3300048922 Bacteria 5521
486 Ga0496120_0014560 3300048923 Bacteria 5236
487 Ga0496120_0103535 3300048923 Bacteria 1499
488 Ga0496121_0000578 3300048924 Bacteria 68826
489 Ga0496121_0023197 3300048924 Bacteria 5987
490 Ga0496121_0054532 3300048924 Bacteria 3339
491 Ga0496121_0130855 3300048924 Bacteria 1878
492 Ga0496121_0133133 3300048924 Bacteria 1857
493 Ga0496121_0412282 3300048924 Bacteria 881
494 Ga0496122_0099059 3300048925 Bacteria 1956
495 Ga0496124_0052546 3300048927 Bacteria 3461
496 Ga0496124_0367582 3300048927 Bacteria 1011
497 Ga0496125_0058502 3300048928 Bacteria 3113
498 Ga0496125_0067015 3300048928 Bacteria 2832
499 Ga0496126_0000602 3300048929 Bacteria 67975
500 Ga0496126_0189002 3300048929 Bacteria 1745
501 Ga0496126_0221248 3300048929 Bacteria 1590
502 Ga0495682_0003878 3300049460 Bacteria 6544
503 Ga0495682_0064290 3300049460 Bacteria 1323
504 Ga0501040_0702627 3300049576 Bacteria 731
505 Ga0501072_0535080 3300049588 Bacteria 926
506 nmdc:mga03683_130253_c1 3300050489 Bacteria 1125
507 nmdc:mga03683_71562_c1 3300050489 Bacteria 1483
508 nmdc:mga00v17_358641_c1 3300050491 Bacteria 948
509 nmdc:mga0yw44_12388_c1 3300050492 Bacteria 4443
510 nmdc:mga0yw44_16942_c1 3300050492 Bacteria 3950
511 nmdc:mga0yw44_234702_c1 3300050492 Bacteria 1218
512 nmdc:mga0yw44_40131_c1 3300050492 Bacteria 2779
513 nmdc:mga06z11_252731_c1 3300050494 Bacteria 1038
514 nmdc:mga07m45_127364_c1 3300050496 Bacteria 1473
515 nmdc:mga05p37_50930_c1 3300050507 Bacteria 5092
516 nmdc:mga09592_100731_c1 3300050508 Bacteria 2474
517 nmdc:mga0qj67_91233_c1 3300050509 Bacteria 2448
518 nmdc:mga06r32_339688_c1 3300050510 Bacteria 1486
519 nmdc:mga06r32_485502_c1 3300050510 Bacteria 1213
520 nmdc:mga08y16_435805_c1 3300050511 Bacteria 1338
521 nmdc:mga08y16_665035_c1 3300050511 Bacteria 1044
522 nmdc:mga0n895_966492_c1 3300050512 Bacteria 834
523 nmdc:mga0sz30_104776_c1 3300050516 Bacteria 1237
524 nmdc:mga0sz30_77414_c1 3300050516 Bacteria 1437
525 Ga0495601_0334338 3300053077 Bacteria 986
526 Ga0495612_0117178 3300053078 Bacteria 1144
527 Ga0495595_0105664 3300053084 Bacteria 1362
528 Ga0495619_0496058 3300053085 Bacteria 840
529 Ga0500578_0081890 3300053086 Bacteria 2052
530 Ga0500643_013742 3300053087 Bacteria 2844
531 Ga0500646_0066429 3300053090 Bacteria 1073
532 Ga0500646_0066853 3300053090 Bacteria 1070
533 Ga0500583_0054842 3300053092 Bacteria 1862
534 Ga0500651_0057494 3300053093 Bacteria 2434
535 Ga0500566_0000750 3300053094 Bacteria 18266
536 Ga0500650_0253236 3300053098 Bacteria 789
537 Ga0500555_001349 3300053103 Bacteria 7685
538 Ga0500555_002647 3300053103 Bacteria 5154
539 Ga0500556_0073286 3300053104 Bacteria 1282
540 Ga0500556_0096857 3300053104 Bacteria 1132
541 Ga0500562_003675 3300053108 Bacteria 3853
542 Ga0500562_005493 3300053108 Bacteria 3181
543 Ga0500569_050120 3300053109 Bacteria 1257
544 Ga0500572_028763 3300053111 Bacteria 1532
545 Ga0500592_013180 3300053116 Bacteria 1324
546 Ga0500595_025573 3300053119 Bacteria 2044
547 Ga0500607_055531 3300053121 Bacteria 2093
548 Ga0500626_039862 3300053128 Bacteria 2125
549 Ga0500655_033916 3300053133 Bacteria 989
550 Ga0500658_0176213 3300053134 Bacteria 972
551 Ga0500559_0017034 3300053136 Bacteria 3069
552 Ga0500559_0021721 3300053136 Bacteria 2721
553 Ga0500561_0061702 3300053137 Bacteria 1052
554 Ga0500564_038903 3300053138 Bacteria 2192
555 Ga0500568_0006097 3300053139 Bacteria 6111
556 Ga0500568_0052991 3300053139 Bacteria 1591
557 Ga0500604_0020158 3300053151 Bacteria 1874
558 Ga0500616_0043940 3300053153 Bacteria 2386
559 Ga0500619_065754 3300053154 Bacteria 1199
560 Ga0500622_0004648 3300053156 Bacteria 8504
561 Ga0500638_099660 3300053162 Bacteria 1357
562 Ga0500636_0000041 3300053177 Bacteria 69687
563 Ga0500636_0125146 3300053177 Bacteria 1438
564 Ga0500636_0160528 3300053177 Bacteria 1226
565 Ga0500611_037853 3300053727 Bacteria 1041
566 Ga0500599_013677 3300053736 Bacteria 1099
567 Ga0500601_000017 3300053737 Bacteria 40649
568 Ga0500661_002403 3300055283 Bacteria 3536
569 Ga0530510_0621961 3300061734 Bacteria 822

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300030760 Ga0265762_1010283 Ga0265762_10102832 187
2 3300013308 Ga0157375_11121658 Ga0157375_111216582 189
3 iso_pu_bacteria 8006926726 8006930086 191
4 3300005618 Ga0068864_100003579 Ga0068864_1000035794 194
5 3300005841 Ga0068863_100014883 Ga0068863_1000148835 194
6 3300026088 Ga0207641_10232071 Ga0207641_102320713 194
7 3300026095 Ga0207676_10015881 Ga0207676_100158813 194
8 3300028786 Ga0307517_10015766 Ga0307517_100157665 194
9 iso_pu_bacteria 2508501042 2508692900 194
10 iso_pu_bacteria 2513237092 2513621634 194
11 iso_pu_bacteria 2513237094 2513636924 194
12 iso_pu_bacteria 2513237095 2513651132 194
13 iso_pu_bacteria 2513237102 2513700664 194
14 iso_pu_bacteria 2513237139 2513878374 194
15 iso_pu_bacteria 2513237161 2514011696 194
16 iso_pu_bacteria 2515154112 2515626289 194
17 iso_pu_bacteria 2517093001 2517107834 194
18 iso_pu_bacteria 2528768022 2528852894 194
19 iso_pu_bacteria 2617270735 2617351829 194
20 iso_pu_bacteria 2791355196 2793061098 194
21 iso_pu_bacteria 2802429603 2805920597 194
22 iso_pu_bacteria 2816332527 2818236788 194
23 iso_pu_bacteria 2824600985 2824605675 194
24 iso_pu_bacteria 2824609381 2824611763 194
25 iso_pu_bacteria 2824617872 2824622019 194
26 iso_pu_bacteria 2824626560 2824629283 194
27 iso_pu_bacteria 2824635225 2824639184 194
28 iso_pu_bacteria 2824644064 2824650374 194
29 iso_pu_bacteria 2824653114 2824654999 194
30 iso_pu_bacteria 2824661429 2824664051 194
31 iso_pu_bacteria 2824671348 2824675221 194
32 iso_pu_bacteria 2824679649 2824681557 194
33 iso_pu_bacteria 2824687955 2824690031 194
34 iso_pu_bacteria 2824696289 2824701166 194
35 iso_pu_bacteria 2824704595 2824711137 194
36 iso_pu_bacteria 2824714736 2824720915 194
37 iso_pu_bacteria 2824723954 2824729793 194
38 iso_pu_bacteria 2824753945 2824760435 194
39 iso_pu_bacteria 2824763712 2824766576 194
40 iso_pu_bacteria 2824773399 2824776697 194
41 iso_pu_bacteria 2838122688 2838127354 194
42 iso_pu_bacteria 2841941048 2841946373 194
43 iso_pu_bacteria 2841949485 2841957092 194
44 iso_pu_bacteria 2841957949 2841965612 194
45 iso_pu_bacteria 2841966195 2841972883 194
46 iso_pu_bacteria 2841974524 2841978445 194
47 iso_pu_bacteria 2841983080 2841987453 194
48 iso_pu_bacteria 2844315083 2844320231 194
49 iso_pu_bacteria 2847939898 2847947978 194
50 iso_pu_bacteria 2849076700 2849078174 194
51 iso_pu_bacteria 2874590934 2874598560 194
52 iso_pu_bacteria 2874612657 2874616747 194
53 iso_pu_bacteria 2874620515 2874628305 194
54 iso_pu_bacteria 2874628541 2874630099 194
55 iso_pu_bacteria 2874645413 2874652013 194
56 iso_pu_bacteria 2876761206 2876768311 194
57 iso_pu_bacteria 2876771140 2876778598 194
58 iso_pu_bacteria 2876818435 2876823403 194
59 iso_pu_bacteria 2879074833 2879082391 194
60 iso_pu_bacteria 2879099564 2879107949 194
61 iso_pu_bacteria 2879127579 2879131828 194
62 iso_pu_bacteria 2879142872 2879150164 194
63 iso_pu_bacteria 2881364244 2881370130 194
64 iso_pu_bacteria 2881665667 2881669087 194
65 iso_pu_bacteria 2885409591 2885414391 194
66 iso_pu_bacteria 2888378607 2888385711 194
67 iso_pu_bacteria 2888388044 2888392562 194
68 iso_pu_bacteria 2888419890 2888425828 194
69 iso_pu_bacteria 2903727486 2903731179 194
70 iso_pu_bacteria 2904666416 2904674076 194
71 iso_pu_bacteria 2904711408 2904711726 194
72 iso_pu_bacteria 2906602504 2906610054 194
73 iso_pu_bacteria 2906643746 2906648434 194
74 iso_pu_bacteria 2922368715 2922375959 194
75 iso_pu_bacteria 2922393267 2922396842 194
76 iso_pu_bacteria 2929615660 2929621269 194
77 iso_pu_bacteria 2929624759 2929625900 194
78 iso_pu_bacteria 2932784394 2932785216 194
79 iso_pu_bacteria 2932794094 2932799668 194
80 iso_pu_bacteria 2932801729 2932808744 194
81 iso_pu_bacteria 2932809354 2932810249 194
82 iso_pu_bacteria 2932818245 2932821821 194
83 iso_pu_bacteria 2932828146 2932829052 194
84 iso_pu_bacteria 2933577622 2933582862 194
85 iso_pu_bacteria 2935608549 2935610054 194
86 iso_pu_bacteria 2935616580 2935619528 194
87 iso_pu_bacteria 2935638405 2935638508 194
88 iso_pu_bacteria 2935648319 2935656339 194
89 iso_pu_bacteria 2935656913 2935660105 194
90 iso_pu_bacteria 2935665750 2935666640 194
91 iso_pu_bacteria 2935675223 2935682171 194
92 iso_pu_bacteria 2935684952 2935691175 194
93 iso_pu_bacteria 2935694250 2935694401 194
94 iso_pu_bacteria 2935703347 2935703514 194
95 iso_pu_bacteria 2935713505 2935718556 194
96 iso_pu_bacteria 2935722832 2935727464 194
97 iso_pu_bacteria 2935732158 2935736167 194
98 iso_pu_bacteria 2935741537 2935745547 194
99 iso_pu_bacteria 2935750917 2935755928 194
100 iso_pu_bacteria 2935760218 2935760808 194
101 iso_pu_bacteria 2935769743 2935776462 194
102 iso_pu_bacteria 2935777560 2935780857 194
103 iso_pu_bacteria 2935785616 2935792313 194
104 iso_pu_bacteria 2935793552 2935800512 194
105 iso_pu_bacteria 2935801545 2935801651 194
106 iso_pu_bacteria 2935810662 2935814939 194
107 iso_pu_bacteria 2935819856 2935823214 194
108 iso_pu_bacteria 2935827899 2935828002 194
109 iso_pu_bacteria 2935837841 2935842207 194
110 iso_pu_bacteria 2935847175 2935848796 194
111 iso_pu_bacteria 2935855204 2935858156 194
112 iso_pu_bacteria 2935864058 2935868061 194
113 iso_pu_bacteria 2935873716 2935873916 194
114 iso_pu_bacteria 2935883170 2935885673 194
115 iso_pu_bacteria 2935908558 2935909404 194
116 iso_pu_bacteria 2935916978 2935917126 194
117 iso_pu_bacteria 2935926038 2935926885 194
118 iso_pu_bacteria 2935934488 2935937271 194
119 iso_pu_bacteria 2935942939 2935944426 194
120 iso_pu_bacteria 2935951376 2935952863 194
121 iso_pu_bacteria 2935959822 2935962927 194
122 iso_pu_bacteria 2935967501 2935969703 194
123 iso_pu_bacteria 2935975950 2935976313 194
124 iso_pu_bacteria 2935984226 2935991844 194
125 iso_pu_bacteria 2935992306 2935993160 194
126 iso_pu_bacteria 2936002035 2936003097 194
127 iso_pu_bacteria 2936011229 2936014521 194
128 iso_pu_bacteria 2936019824 2936027812 194
129 iso_pu_bacteria 2936028420 2936031282 194
130 iso_pu_bacteria 2936037263 2936040418 194
131 iso_pu_bacteria 2936046547 2936049627 194
132 iso_pu_bacteria 2936055302 2936061157 194
133 iso_pu_bacteria 2940556831 2940562097 194
134 iso_pu_bacteria 2941531003 2941531420 194
135 iso_pu_bacteria 2941538514 2941542256 194
136 iso_pu_bacteria 3005483717 3005488462 194
137 iso_pu_bacteria 3005718088 3005723367 194
138 iso_pu_bacteria 8016511872 8016520408 194
139 iso_pu_bacteria 8016522445 8016528482 194
140 iso_pu_bacteria 8016530956 8016533638 194
141 iso_pu_bacteria 8016539877 8016546862 194
142 iso_pu_bacteria 8016548790 8016555255 194
143 iso_pu_bacteria 8016557553 8016563617 194
144 iso_pu_bacteria 8016575299 8016576177 194
145 iso_pu_bacteria 8016595262 8016601352 194
146 iso_pu_bacteria 8016603502 8016609076 194
147 iso_pu_bacteria 8016613128 8016615829 194
148 iso_pu_bacteria 8016622563 8016625407 194
149 iso_pu_bacteria 8016630954 8016638929 194
150 iso_pu_bacteria 8017057580 8017065166 194
151 iso_pu_bacteria 8019530166 8019533422 194
152 iso_pu_bacteria 8019538911 8019546254 194
153 iso_pu_bacteria 8019547302 8019552452 194
154 iso_pu_bacteria 8019576017 8019584558 194
155 iso_pu_bacteria 8019586578 8019592331 194
156 iso_pu_bacteria 8019619141 8019620043 194
157 iso_pu_bacteria 8019629233 8019633063 194
158 iso_pu_bacteria 8019638758 8019646845 194
159 iso_pu_bacteria 8019648815 8019649613 194
160 iso_pu_bacteria 8019659431 8019660943 194
161 iso_pu_bacteria 8019668869 8019670502 194
162 iso_pu_bacteria 8019678201 8019685731 194
163 iso_pu_bacteria 8019687851 8019691303 194
164 iso_pu_bacteria 8055742211 8055744870 194
165 iso_pu_bacteria 8056967851 8056974836 194
166 3300005459 Ga0068867_100247432 Ga0068867_1002474322 195
167 3300025907 Ga0207645_10032757 Ga0207645_100327574 195
168 3300009101 Ga0105247_10143578 Ga0105247_101435782 196
169 3300009551 Ga0105238_10845669 Ga0105238_108456691 196
170 3300013308 Ga0157375_10266839 Ga0157375_102668391 196
171 3300028800 Ga0265338_10518201 Ga0265338_105182011 196
172 3300035692 Ga0373935_0221262 Ga0373935_0221262_584_1207 196
173 3300035724 Ga0373933_0020776 Ga0373933_0020776_2063_2686 196
174 3300036401 Ga0373937_0133666 Ga0373937_0133666_535_1158 196
175 3300037068 Ga0373925_0060216 Ga0373925_0060216_1104_1727 196
176 3300039447 Ga0436361_0122632 Ga0436361_0122632_3234_3881 196
177 3300041452 Ga0451793_0114728 Ga0451793_0114728_85_720 196
178 3300041460 Ga0451802_0309198 Ga0451802_0309198_738_1373 196
179 3300041503 Ga0451847_0585162 Ga0451847_0585162_319_954 196
180 3300044694 Ga0466963_0027201 Ga0466963_0027201_2939_3574 196
181 3300046462 Ga0495651_0075133 Ga0495651_0075133_1628_2251 196
182 3300046507 Ga0495606_0037284 Ga0495606_0037284_1697_2332 196
183 3300046533 Ga0495640_0237112 Ga0495640_0237112_65_688 196
184 3300046663 Ga0495635_0084299 Ga0495635_0084299_359_982 196
185 3300046678 Ga0495599_0040889 Ga0495599_0040889_1722_2345 196
186 3300047317 Ga0495604_0336389 Ga0495604_0336389_58_693 196
187 3300047319 Ga0495674_0381103 Ga0495674_0381103_52_675 196
188 3300047471 Ga0495684_0120104 Ga0495684_0120104_614_1237 196
189 3300048906 Ga0496103_0009908 Ga0496103_0009908_4457_5113 196
190 3300048907 Ga0496104_0141062 Ga0496104_0141062_859_1515 196
191 3300048908 Ga0496105_0445441 Ga0496105_0445441_111_767 196
192 3300048909 Ga0496106_0083480 Ga0496106_0083480_1093_1749 196
193 3300048910 Ga0496107_0021613 Ga0496107_0021613_1453_2109 196
194 3300048911 Ga0496108_0247411 Ga0496108_0247411_477_1112 196
195 3300048918 Ga0496115_0473385 Ga0496115_0473385_114_770 196
196 3300048921 Ga0496118_0105880 Ga0496118_0105880_906_1541 196
197 3300048929 Ga0496126_0189002 Ga0496126_0189002_653_1285 196
198 3300050492 nmdc:mga0yw44_12388_c1 nmdc:mga0yw44_12388_c1_1399_2034 196
199 3300050516 nmdc:mga0sz30_104776_c1 nmdc:mga0sz30_104776_c1_326_961 196
200 3300053078 Ga0495612_0117178 Ga0495612_0117178_40_663 196
201 3300053104 Ga0500556_0096857 Ga0500556_0096857_156_791 196
202 3300053119 Ga0500595_025573 Ga0500595_025573_523_1158 196
203 3300053151 Ga0500604_0020158 Ga0500604_0020158_148_783 196
204 3300053153 Ga0500616_0043940 Ga0500616_0043940_242_877 196
205 3300053156 Ga0500622_0004648 Ga0500622_0004648_4590_5225 196
206 3300005577 Ga0068857_100419995 Ga0068857_1004199951 197
207 3300010375 Ga0105239_10019071 Ga0105239_100190713 197
208 3300026116 Ga0207674_10438554 Ga0207674_104385542 197
209 3300039447 Ga0436361_0371970 Ga0436361_0371970_1114_1800 197
210 3300039447 Ga0436361_1076341 Ga0436361_1076341_212_898 197
211 3300045049 Ga0466959_0008511 Ga0466959_0008511_6254_6892 197
212 iso_pu_bacteria 2824661429 2824662249 197
213 iso_pu_bacteria 2874628541 2874632555 197
214 iso_pu_bacteria 2879099564 2879107397 197
215 iso_pu_bacteria 2906626472 2906631839 197
216 iso_pu_bacteria 2932794094 2932797108 197
217 iso_pu_bacteria 2932801729 2932807456 197
218 iso_pu_bacteria 2932809354 2932816190 197
219 iso_pu_bacteria 2932818245 2932819592 197
220 iso_pu_bacteria 2932828146 2932836219 197
221 iso_pu_bacteria 2935616580 2935616964 197
222 iso_pu_bacteria 2935630451 2935636326 197
223 iso_pu_bacteria 2935675223 2935675277 197
224 iso_pu_bacteria 2935703347 2935711715 197
225 iso_pu_bacteria 2935801545 2935810139 197
226 iso_pu_bacteria 2935810662 2935813738 197
227 iso_pu_bacteria 2935855204 2935855588 197
228 iso_pu_bacteria 2935864058 2935867167 197
229 iso_pu_bacteria 2935864058 2935870063 197
230 iso_pu_bacteria 2935873716 2935876013 197
231 iso_pu_bacteria 2936002035 2936003954 197
232 iso_pu_bacteria 2936037263 2936042910 197
233 iso_pu_bacteria 2941507105 2941512957 197
234 iso_pu_bacteria 2941515067 2941520741 197
235 iso_pu_bacteria 2941523033 2941528756 197
236 iso_pu_bacteria 3005710791 3005712811 197
237 iso_pu_bacteria 8016511872 8016521610 197
238 iso_pu_bacteria 8016630954 8016631164 197
239 iso_pu_bacteria 8017057580 8017064030 197
240 iso_pu_bacteria 8019565922 8019565953 197
241 iso_pu_bacteria 8019576017 8019583351 197
242 iso_pu_bacteria 8019586578 8019591163 197
243 iso_pu_bacteria 8019597564 8019600175 197
244 iso_pu_bacteria 8019608314 8019618366 197
245 3300003215 JGI25153J46596_10000382 JGI25153J46596_1000038221 198
246 3300003215 JGI25153J46596_10000866 JGI25153J46596_1000086617 198
247 3300003215 JGI25153J46596_10020786 JGI25153J46596_100207862 198
248 3300003354 JGI25160J50197_1008546 JGI25160J50197_10085464 198
249 3300003354 JGI25160J50197_1034463 JGI25160J50197_10344632 198
250 3300003659 JGI25404J52841_10026591 JGI25404J52841_100265912 198
251 3300003762 Ga0055542_1011299 Ga0055542_10112992 198
252 3300003794 Ga0055531_10009703 Ga0055531_100097032 198
253 3300005262 Ga0065165_1007525 Ga0065165_10075254 198
254 3300005262 Ga0065165_1013398 Ga0065165_10133981 198
255 3300005262 Ga0065165_1021063 Ga0065165_10210632 198
256 3300005262 Ga0065165_1080168 Ga0065165_10801681 198
257 3300005331 Ga0070670_100207773 Ga0070670_1002077733 198
258 3300005338 Ga0068868_100297556 Ga0068868_1002975562 198
259 3300005339 Ga0070660_100392313 Ga0070660_1003923131 198
260 3300005347 Ga0070668_100933803 Ga0070668_1009338031 198
261 3300005353 Ga0070669_100207912 Ga0070669_1002079123 198
262 3300005355 Ga0070671_100027263 Ga0070671_1000272633 198
263 3300005366 Ga0070659_100721747 Ga0070659_1007217471 198
264 3300005367 Ga0070667_100145002 Ga0070667_1001450022 198
265 3300005434 Ga0070709_10005157 Ga0070709_100051571 198
266 3300005435 Ga0070714_100015761 Ga0070714_1000157612 198
267 3300005436 Ga0070713_100058872 Ga0070713_1000588726 198
268 3300005437 Ga0070710_10000365 Ga0070710_1000036523 198
269 3300005439 Ga0070711_100026986 Ga0070711_1000269862 198
270 3300005444 Ga0070694_100458294 Ga0070694_1004582941 198
271 3300005459 Ga0068867_100588161 Ga0068867_1005881612 198
272 3300005539 Ga0068853_100680305 Ga0068853_1006803052 198
273 3300005543 Ga0070672_100532313 Ga0070672_1005323132 198
274 3300005545 Ga0070695_100028544 Ga0070695_1000285443 198
275 3300005548 Ga0070665_100206180 Ga0070665_1002061802 198
276 3300005577 Ga0068857_100436560 Ga0068857_1004365602 198
277 3300005616 Ga0068852_100008125 Ga0068852_1000081257 198
278 3300005844 Ga0068862_100847467 Ga0068862_1008474672 198
279 3300005937 Ga0081455_10007030 Ga0081455_100070306 198
280 3300005983 Ga0081540_1000017 Ga0081540_10000175 198
281 3300005983 Ga0081540_1018670 Ga0081540_10186704 198
282 3300006028 Ga0070717_10717149 Ga0070717_107171492 198
283 3300006038 Ga0075365_10014773 Ga0075365_100147733 198
284 3300006038 Ga0075365_10069480 Ga0075365_100694802 198
285 3300006038 Ga0075365_10123032 Ga0075365_101230323 198
286 3300006038 Ga0075365_10382220 Ga0075365_103822202 198
287 3300006042 Ga0075368_10012643 Ga0075368_100126433 198
288 3300006042 Ga0075368_10064874 Ga0075368_100648743 198
289 3300006163 Ga0070715_10070744 Ga0070715_100707442 198
290 3300006163 Ga0070715_10191885 Ga0070715_101918852 198
291 3300006173 Ga0070716_100001478 Ga0070716_10000147814 198
292 3300006175 Ga0070712_100085722 Ga0070712_1000857223 198
293 3300006175 Ga0070712_100539579 Ga0070712_1005395792 198
294 3300006178 Ga0075367_10122301 Ga0075367_101223012 198
295 3300006186 Ga0075369_10090979 Ga0075369_100909792 198
296 3300006195 Ga0075366_10060210 Ga0075366_100602103 198
297 3300006844 Ga0075428_100025674 Ga0075428_1000256744 198
298 3300006847 Ga0075431_100791770 Ga0075431_1007917702 198
299 3300006852 Ga0075433_10159111 Ga0075433_101591113 198
300 3300006942 Ga0099824_1006549 Ga0099824_100654914 198
301 3300009094 Ga0111539_10048435 Ga0111539_100484353 198
302 3300009094 Ga0111539_10720354 Ga0111539_107203542 198
303 3300009098 Ga0105245_10160545 Ga0105245_101605452 198
304 3300009098 Ga0105245_10282591 Ga0105245_102825912 198
305 3300009101 Ga0105247_10379589 Ga0105247_103795892 198
306 3300009147 Ga0114129_10059664 Ga0114129_100596646 198
307 3300009148 Ga0105243_10125489 Ga0105243_101254893 198
308 3300009174 Ga0105241_10118598 Ga0105241_101185982 198
309 3300009176 Ga0105242_10325097 Ga0105242_103250972 198
310 3300009176 Ga0105242_10422237 Ga0105242_104222371 198
311 3300009545 Ga0105237_10005500 Ga0105237_100055009 198
312 3300009545 Ga0105237_10119799 Ga0105237_101197993 198
313 3300009545 Ga0105237_10119842 Ga0105237_101198424 198
314 3300009545 Ga0105237_10300958 Ga0105237_103009581 198
315 3300009551 Ga0105238_10181097 Ga0105238_101810972 198
316 3300009551 Ga0105238_10694498 Ga0105238_106944982 198
317 3300010375 Ga0105239_10089922 Ga0105239_100899223 198
318 3300012503 Ga0157313_1008720 Ga0157313_10087201 198
319 3300013105 Ga0157369_10798827 Ga0157369_107988272 198
320 3300013296 Ga0157374_10131828 Ga0157374_101318283 198
321 3300013297 Ga0157378_10452876 Ga0157378_104528762 198
322 3300013306 Ga0163162_10644725 Ga0163162_106447252 198
323 3300014325 Ga0163163_10229157 Ga0163163_102291572 198
324 3300025245 Ga0207425_1011313 Ga0207425_10113132 198
325 3300025253 Ga0209677_102259 Ga0209677_1022591 198
326 3300025254 Ga0209148_1000215 Ga0209148_10002155 198
327 3300025254 Ga0209148_1016708 Ga0209148_10167082 198
328 3300025261 Ga0209233_1003181 Ga0209233_10031811 198
329 3300025272 Ga0209455_1008636 Ga0209455_10086364 198
330 3300025272 Ga0209455_1013643 Ga0209455_10136432 198
331 3300025295 Ga0209564_1011412 Ga0209564_10114124 198
332 3300025297 Ga0209758_1000011 Ga0209758_1000011550 198
333 3300025297 Ga0209758_1001216 Ga0209758_100121619 198
334 3300025297 Ga0209758_1034165 Ga0209758_10341653 198
335 3300025299 Ga0209256_1042801 Ga0209256_10428012 198
336 3300025302 Ga0207426_1000328 Ga0207426_100032820 198
337 3300025302 Ga0207426_1000401 Ga0207426_10004013 198
338 3300025302 Ga0207426_1003045 Ga0207426_10030456 198
339 3300025303 Ga0209051_1042126 Ga0209051_10421263 198
340 3300025304 Ga0209257_1001041 Ga0209257_100104135 198
341 3300025304 Ga0209257_1014048 Ga0209257_10140484 198
342 3300025315 Ga0207697_10038176 Ga0207697_100381763 198
343 3300025898 Ga0207692_10142245 Ga0207692_101422452 198
344 3300025898 Ga0207692_10608970 Ga0207692_106089701 198
345 3300025900 Ga0207710_10070797 Ga0207710_100707972 198
346 3300025904 Ga0207647_10065490 Ga0207647_100654903 198
347 3300025905 Ga0207685_10036515 Ga0207685_100365152 198
348 3300025909 Ga0207705_10467031 Ga0207705_104670311 198
349 3300025911 Ga0207654_10015065 Ga0207654_100150654 198
350 3300025911 Ga0207654_10059922 Ga0207654_100599222 198
351 3300025913 Ga0207695_10000163 Ga0207695_1000016325 198
352 3300025914 Ga0207671_10014329 Ga0207671_100143293 198
353 3300025915 Ga0207693_10047440 Ga0207693_100474402 198
354 3300025916 Ga0207663_10013373 Ga0207663_100133732 198
355 3300025919 Ga0207657_10233010 Ga0207657_102330102 198
356 3300025919 Ga0207657_10401783 Ga0207657_104017832 198
357 3300025928 Ga0207700_10171233 Ga0207700_101712332 198
358 3300025928 Ga0207700_10345699 Ga0207700_103456993 198
359 3300025929 Ga0207664_10064017 Ga0207664_100640172 198
360 3300025931 Ga0207644_10403010 Ga0207644_104030102 198
361 3300025939 Ga0207665_10045091 Ga0207665_100450912 198
362 3300025945 Ga0207679_10585352 Ga0207679_105853522 198
363 3300025960 Ga0207651_10416573 Ga0207651_104165732 198
364 3300025972 Ga0207668_10109186 Ga0207668_101091862 198
365 3300025972 Ga0207668_10833140 Ga0207668_108331402 198
366 3300025986 Ga0207658_10199073 Ga0207658_101990732 198
367 3300026035 Ga0207703_10581924 Ga0207703_105819242 198
368 3300026067 Ga0207678_10051021 Ga0207678_100510213 198
369 3300026075 Ga0207708_10053244 Ga0207708_100532442 198
370 3300026089 Ga0207648_10098990 Ga0207648_100989903 198
371 3300026116 Ga0207674_10296417 Ga0207674_102964172 198
372 3300026118 Ga0207675_100090389 Ga0207675_1000903893 198
373 3300026118 Ga0207675_101268520 Ga0207675_1012685202 198
374 3300027296 Ga0209389_1000043 Ga0209389_100004330 198
375 3300027357 Ga0209589_1000047 Ga0209589_100004781 198
376 3300027361 Ga0209489_100075 Ga0209489_100075113 198
377 3300027866 Ga0209813_10037372 Ga0209813_100373722 198
378 3300028379 Ga0268266_10074320 Ga0268266_100743202 198
379 3300028379 Ga0268266_10144418 Ga0268266_101444182 198
380 3300028379 Ga0268266_10483692 Ga0268266_104836921 198
381 3300028380 Ga0268265_10753703 Ga0268265_107537032 198
382 3300028381 Ga0268264_10152244 Ga0268264_101522442 198
383 3300031247 Ga0265340_10141046 Ga0265340_101410462 198
384 3300033180 Ga0307510_10013929 Ga0307510_100139298 198
385 3300033180 Ga0307510_10108851 Ga0307510_101088513 198
386 3300035088 Ga0373940_0123635 Ga0373940_0123635_16_654 198
387 3300035691 Ga0373931_0076583 Ga0373931_0076583_601_1233 198
388 3300035692 Ga0373935_0777394 Ga0373935_0777394_44_676 198
389 3300035695 Ga0373927_0205860 Ga0373927_0205860_426_1058 198
390 3300037471 Ga0395905_0155569 Ga0395905_0155569_102_743 198
391 3300038443 Ga0395901_0198551 Ga0395901_0198551_481_1122 198
392 3300039437 Ga0436365_0458129 Ga0436365_0458129_1049_1690 198
393 3300039447 Ga0436361_0887352 Ga0436361_0887352_300_917 198
394 3300044656 Ga0466969_0017547 Ga0466969_0017547_2955_3596 198
395 3300044658 Ga0466972_0000079 Ga0466972_0000079_50969_51610 198
396 3300044658 Ga0466972_0009117 Ga0466972_0009117_2105_2746 198
397 3300044683 Ga0466965_0404835 Ga0466965_0404835_87_728 198
398 3300044684 Ga0466966_0000191 Ga0466966_0000191_38953_39594 198
399 3300044693 Ga0466961_0000005 Ga0466961_0000005_78979_79620 198
400 3300044693 Ga0466961_0264600 Ga0466961_0264600_286_927 198
401 3300044706 Ga0466964_0013726 Ga0466964_0013726_1989_2630 198
402 3300044735 Ga0466968_0002291 Ga0466968_0002291_3908_4549 198
403 3300044735 Ga0466968_0013541 Ga0466968_0013541_431_1072 198
404 3300044735 Ga0466968_0399680 Ga0466968_0399680_10_651 198
405 3300044901 Ga0466960_0005971 Ga0466960_0005971_3565_4206 198
406 3300045049 Ga0466959_0002371 Ga0466959_0002371_6106_6747 198
407 3300046454 Ga0495592_0005617 Ga0495592_0005617_2265_2906 198
408 3300046455 Ga0495603_0109239 Ga0495603_0109239_311_952 198
409 3300046459 Ga0495629_0068066 Ga0495629_0068066_878_1519 198
410 3300046460 Ga0495638_0012188 Ga0495638_0012188_2995_3636 198
411 3300046463 Ga0495653_0260767 Ga0495653_0260767_332_973 198
412 3300046474 Ga0495605_0195907 Ga0495605_0195907_106_747 198
413 3300046477 Ga0495664_0013587 Ga0495664_0013587_3746_4387 198
414 3300046506 Ga0495583_0093324 Ga0495583_0093324_10_651 198
415 3300046506 Ga0495583_0133749 Ga0495583_0133749_236_877 198
416 3300046507 Ga0495606_0006512 Ga0495606_0006512_4001_4642 198
417 3300046511 Ga0495608_0050003 Ga0495608_0050003_1238_1879 198
418 3300046513 Ga0495616_0117918 Ga0495616_0117918_523_1164 198
419 3300046513 Ga0495616_0173136 Ga0495616_0173136_270_911 198
420 3300046514 Ga0495618_0330247 Ga0495618_0330247_38_679 198
421 3300046517 Ga0495630_0070906 Ga0495630_0070906_1559_2200 198
422 3300046519 Ga0495632_0042247 Ga0495632_0042247_1247_1888 198
423 3300046522 Ga0495643_0113127 Ga0495643_0113127_312_953 198
424 3300046524 Ga0495648_0002859 Ga0495648_0002859_791_1432 198
425 3300046524 Ga0495648_0069214 Ga0495648_0069214_920_1561 198
426 3300046529 Ga0495652_0007795 Ga0495652_0007795_7164_7805 198
427 3300046529 Ga0495652_0090985 Ga0495652_0090985_852_1493 198
428 3300046533 Ga0495640_0012370 Ga0495640_0012370_207_848 198
429 3300046533 Ga0495640_0018187 Ga0495640_0018187_1147_1788 198
430 3300046536 Ga0495587_0015262 Ga0495587_0015262_3226_3867 198
431 3300046542 Ga0495597_0085928 Ga0495597_0085928_459_1100 198
432 3300046557 Ga0495622_0021822 Ga0495622_0021822_423_1064 198
433 3300046559 Ga0495667_0026653 Ga0495667_0026653_44_685 198
434 3300046648 Ga0495611_0162669 Ga0495611_0162669_54_695 198
435 3300046660 Ga0495625_0005741 Ga0495625_0005741_1884_2525 198
436 3300046663 Ga0495635_0016958 Ga0495635_0016958_2789_3430 198
437 3300046665 Ga0495661_0246378 Ga0495661_0246378_75_716 198
438 3300046675 Ga0495657_0002353 Ga0495657_0002353_6931_7572 198
439 3300046675 Ga0495657_0043382 Ga0495657_0043382_2240_2881 198
440 3300046679 Ga0495623_0006848 Ga0495623_0006848_1581_2222 198
441 3300046680 Ga0495646_0026710 Ga0495646_0026710_2174_2815 198
442 3300046680 Ga0495646_0077445 Ga0495646_0077445_949_1590 198
443 3300046689 Ga0495613_0033602 Ga0495613_0033602_2884_3525 198
444 3300046690 Ga0495624_0014326 Ga0495624_0014326_3801_4442 198
445 3300046694 Ga0495649_0055252 Ga0495649_0055252_1012_1653 198
446 3300046809 Ga0495600_0022782 Ga0495600_0022782_1134_1775 198
447 3300046809 Ga0495600_0047266 Ga0495600_0047266_318_959 198
448 3300047315 Ga0495581_0161739 Ga0495581_0161739_158_799 198
449 3300047317 Ga0495604_0000880 Ga0495604_0000880_6948_7589 198
450 3300047317 Ga0495604_0003285 Ga0495604_0003285_3273_3914 198
451 3300047319 Ga0495674_0006001 Ga0495674_0006001_4406_5047 198
452 3300047319 Ga0495674_0527679 Ga0495674_0527679_22_672 198
453 3300047321 Ga0495676_0025204 Ga0495676_0025204_3220_3861 198
454 3300047323 Ga0495683_0193043 Ga0495683_0193043_42_683 198
455 3300047443 Ga0495687_009990 Ga0495687_009990_1201_1842 198
456 3300047469 Ga0495673_0056592 Ga0495673_0056592_182_823 198
457 3300047471 Ga0495684_0039841 Ga0495684_0039841_1288_1929 198
458 3300047472 Ga0495686_0247308 Ga0495686_0247308_24_665 198
459 3300047673 Ga0495593_0127306 Ga0495593_0127306_208_849 198
460 3300048088 Ga0495602_0015087 Ga0495602_0015087_3788_4429 198
461 3300048088 Ga0495602_0159031 Ga0495602_0159031_628_1269 198
462 3300048903 Ga0496100_0047811 Ga0496100_0047811_1497_2138 198
463 3300048903 Ga0496100_0351290 Ga0496100_0351290_163_804 198
464 3300048907 Ga0496104_0016046 Ga0496104_0016046_2219_2860 198
465 3300048907 Ga0496104_0063133 Ga0496104_0063133_1207_1848 198
466 3300048908 Ga0496105_0029226 Ga0496105_0029226_1713_2354 198
467 3300048908 Ga0496105_0114413 Ga0496105_0114413_75_716 198
468 3300048908 Ga0496105_0218689 Ga0496105_0218689_623_1264 198
469 3300048908 Ga0496105_0266788 Ga0496105_0266788_473_1114 198
470 3300048910 Ga0496107_0077875 Ga0496107_0077875_386_1027 198
471 3300048911 Ga0496108_0036540 Ga0496108_0036540_2555_3196 198
472 3300048912 Ga0496109_0086032 Ga0496109_0086032_2057_2698 198
473 3300048913 Ga0496110_0397006 Ga0496110_0397006_323_964 198
474 3300048914 Ga0496111_0226472 Ga0496111_0226472_436_1077 198
475 3300048915 Ga0496112_0080942 Ga0496112_0080942_1343_1984 198
476 3300048916 Ga0496113_0265711 Ga0496113_0265711_55_696 198
477 3300048916 Ga0496113_0376540 Ga0496113_0376540_203_844 198
478 3300048918 Ga0496115_0012837 Ga0496115_0012837_3666_4307 198
479 3300048920 Ga0496117_0109006 Ga0496117_0109006_918_1559 198
480 3300048921 Ga0496118_0055077 Ga0496118_0055077_1942_2583 198
481 3300048922 Ga0496119_0016898 Ga0496119_0016898_2252_2893 198
482 3300048923 Ga0496120_0014560 Ga0496120_0014560_228_869 198
483 3300048923 Ga0496120_0103535 Ga0496120_0103535_247_888 198
484 3300048924 Ga0496121_0023197 Ga0496121_0023197_30_671 198
485 3300048924 Ga0496121_0054532 Ga0496121_0054532_471_1112 198
486 3300048924 Ga0496121_0412282 Ga0496121_0412282_30_671 198
487 3300048925 Ga0496122_0099059 Ga0496122_0099059_510_1151 198
488 3300048927 Ga0496124_0052546 Ga0496124_0052546_136_777 198
489 3300048928 Ga0496125_0058502 Ga0496125_0058502_788_1429 198
490 3300048928 Ga0496125_0067015 Ga0496125_0067015_2022_2663 198
491 3300048929 Ga0496126_0221248 Ga0496126_0221248_254_895 198
492 3300049460 Ga0495682_0003878 Ga0495682_0003878_280_921 198
493 3300049460 Ga0495682_0064290 Ga0495682_0064290_223_864 198
494 3300049576 Ga0501040_0702627 Ga0501040_0702627_66_689 198
495 3300049588 Ga0501072_0535080 Ga0501072_0535080_225_848 198
496 3300050489 nmdc:mga03683_130253_c1 nmdc:mga03683_130253_c1_161_802 198
497 3300050492 nmdc:mga0yw44_16942_c1 nmdc:mga0yw44_16942_c1_1775_2416 198
498 3300050492 nmdc:mga0yw44_234702_c1 nmdc:mga0yw44_234702_c1_255_896 198
499 3300050496 nmdc:mga07m45_127364_c1 nmdc:mga07m45_127364_c1_814_1455 198
500 3300050507 nmdc:mga05p37_50930_c1 nmdc:mga05p37_50930_c1_3309_3932 198
501 3300050510 nmdc:mga06r32_339688_c1 nmdc:mga06r32_339688_c1_772_1395 198
502 3300050510 nmdc:mga06r32_485502_c1 nmdc:mga06r32_485502_c1_537_1160 198
503 3300050511 nmdc:mga08y16_665035_c1 nmdc:mga08y16_665035_c1_388_1011 198
504 3300050516 nmdc:mga0sz30_77414_c1 nmdc:mga0sz30_77414_c1_549_1190 198
505 3300053077 Ga0495601_0334338 Ga0495601_0334338_59_700 198
506 3300053084 Ga0495595_0105664 Ga0495595_0105664_24_665 198
507 3300053085 Ga0495619_0496058 Ga0495619_0496058_85_708 198
508 3300053086 Ga0500578_0081890 Ga0500578_0081890_1277_1918 198
509 3300053090 Ga0500646_0066429 Ga0500646_0066429_25_666 198
510 3300053092 Ga0500583_0054842 Ga0500583_0054842_435_1076 198
511 3300053093 Ga0500651_0057494 Ga0500651_0057494_1144_1785 198
512 3300053094 Ga0500566_0000750 Ga0500566_0000750_9382_10023 198
513 3300053103 Ga0500555_001349 Ga0500555_001349_4014_4655 198
514 3300053108 Ga0500562_003675 Ga0500562_003675_191_832 198
515 3300053109 Ga0500569_050120 Ga0500569_050120_504_1145 198
516 3300053111 Ga0500572_028763 Ga0500572_028763_306_947 198
517 3300053121 Ga0500607_055531 Ga0500607_055531_672_1313 198
518 3300053128 Ga0500626_039862 Ga0500626_039862_611_1252 198
519 3300053136 Ga0500559_0017034 Ga0500559_0017034_1313_1954 198
520 3300053136 Ga0500559_0021721 Ga0500559_0021721_936_1577 198
521 3300053138 Ga0500564_038903 Ga0500564_038903_777_1418 198
522 3300053139 Ga0500568_0052991 Ga0500568_0052991_926_1567 198
523 3300053154 Ga0500619_065754 Ga0500619_065754_524_1165 198
524 3300053162 Ga0500638_099660 Ga0500638_099660_165_806 198
525 3300053177 Ga0500636_0000041 Ga0500636_0000041_44395_45036 198
526 3300053177 Ga0500636_0125146 Ga0500636_0125146_569_1219 198
527 3300053177 Ga0500636_0160528 Ga0500636_0160528_552_1193 198
528 3300053737 Ga0500601_000017 Ga0500601_000017_8785_9426 198
529 3300055283 Ga0500661_002403 Ga0500661_002403_418_1059 198
530 3300061734 Ga0530510_0621961 Ga0530510_0621961_10_633 198
531 3300005441 Ga0070700_100002024 Ga0070700_10000202411 199
532 3300037312 Ga0395899_0089761 Ga0395899_0089761_1316_1969 199
533 3300037466 Ga0395898_0335243 Ga0395898_0335243_176_829 199
534 3300050511 nmdc:mga08y16_435805_c1 nmdc:mga08y16_435805_c1_197_847 199
535 3300053137 Ga0500561_0061702 Ga0500561_0061702_105_731 199
536 3300005327 Ga0070658_10001212 Ga0070658_100012126 200
537 3300005336 Ga0070680_100005766 Ga0070680_10000576610 200
538 3300005341 Ga0070691_10001227 Ga0070691_100012275 200
539 3300005458 Ga0070681_10003277 Ga0070681_100032773 200
540 3300005530 Ga0070679_100042350 Ga0070679_1000423502 200
541 3300005563 Ga0068855_100097304 Ga0068855_1000973042 200
542 3300005614 Ga0068856_100232712 Ga0068856_1002327122 200
543 3300005983 Ga0081540_1012584 Ga0081540_10125844 200
544 3300009093 Ga0105240_10003221 Ga0105240_1000322121 200
545 3300009551 Ga0105238_10073624 Ga0105238_100736243 200
546 3300025909 Ga0207705_10013570 Ga0207705_100135703 200
547 3300025913 Ga0207695_10057168 Ga0207695_100571682 200
548 3300025917 Ga0207660_10237016 Ga0207660_102370161 200
549 3300025921 Ga0207652_10040169 Ga0207652_100401693 200
550 3300025949 Ga0207667_10051440 Ga0207667_100514404 200
551 3300026078 Ga0207702_10667428 Ga0207702_106674282 200
552 3300039438 Ga0436360_0111883 Ga0436360_0111883_550_1182 200
553 3300003659 JGI25404J52841_10005170 JGI25404J52841_100051704 201
554 3300005334 Ga0068869_100029200 Ga0068869_1000292005 201
555 3300005340 Ga0070689_100260260 Ga0070689_1002602602 201
556 3300005347 Ga0070668_100008050 Ga0070668_1000080507 201
557 3300005347 Ga0070668_100044763 Ga0070668_1000447632 201
558 3300005353 Ga0070669_100230897 Ga0070669_1002308972 201
559 3300005367 Ga0070667_100278456 Ga0070667_1002784562 201
560 3300005444 Ga0070694_100209333 Ga0070694_1002093331 201
561 3300005459 Ga0068867_100274054 Ga0068867_1002740542 201
562 3300005518 Ga0070699_100180950 Ga0070699_1001809502 201
563 3300005545 Ga0070695_100195299 Ga0070695_1001952991 201
564 3300005617 Ga0068859_100759878 Ga0068859_1007598782 201
565 3300005618 Ga0068864_100121864 Ga0068864_1001218642 201
566 3300005719 Ga0068861_100016921 Ga0068861_1000169215 201
567 3300005841 Ga0068863_100728340 Ga0068863_1007283402 201
568 3300005843 Ga0068860_100393111 Ga0068860_1003931112 201
569 3300005844 Ga0068862_100008858 Ga0068862_1000088584 201
570 3300005844 Ga0068862_100084443 Ga0068862_1000844432 201
571 3300005937 Ga0081455_10009306 Ga0081455_1000930610 201
572 3300005983 Ga0081540_1000078 Ga0081540_1000078116 201
573 3300005983 Ga0081540_1007853 Ga0081540_10078533 201
574 3300005983 Ga0081540_1066978 Ga0081540_10669783 201
575 3300006038 Ga0075365_10072477 Ga0075365_100724772 201
576 3300006042 Ga0075368_10001778 Ga0075368_100017782 201
577 3300006051 Ga0075364_10049670 Ga0075364_100496702 201
578 3300006175 Ga0070712_100350781 Ga0070712_1003507811 201
579 3300006178 Ga0075367_10017567 Ga0075367_100175678 201
580 3300006353 Ga0075370_10178410 Ga0075370_101784101 201
581 3300006881 Ga0068865_100237362 Ga0068865_1002373622 201
582 3300006881 Ga0068865_100900097 Ga0068865_1009000972 201
583 3300006914 Ga0075436_100145761 Ga0075436_1001457612 201
584 3300006914 Ga0075436_100153831 Ga0075436_1001538314 201
585 3300006931 Ga0097620_100759962 Ga0097620_1007599622 201
586 3300007265 Ga0099794_10005774 Ga0099794_100057744 201
587 3300009092 Ga0105250_10103767 Ga0105250_101037672 201
588 3300009098 Ga0105245_10144738 Ga0105245_101447383 201
589 3300009098 Ga0105245_11224024 Ga0105245_112240242 201
590 3300009101 Ga0105247_10073108 Ga0105247_100731082 201
591 3300009147 Ga0114129_10623557 Ga0114129_106235572 201
592 3300009148 Ga0105243_10793392 Ga0105243_107933922 201
593 3300009174 Ga0105241_11050095 Ga0105241_110500952 201
594 3300009177 Ga0105248_10132608 Ga0105248_101326082 201
595 3300009545 Ga0105237_10557305 Ga0105237_105573052 201
596 3300009553 Ga0105249_10067369 Ga0105249_100673692 201
597 3300009553 Ga0105249_10515424 Ga0105249_105154242 201
598 3300009553 Ga0105249_10534418 Ga0105249_105344182 201
599 3300010375 Ga0105239_11318236 Ga0105239_113182361 201
600 3300011119 Ga0105246_10016096 Ga0105246_100160963 201
601 3300013296 Ga0157374_10074019 Ga0157374_100740192 201
602 3300013297 Ga0157378_10576021 Ga0157378_105760212 201
603 3300013306 Ga0163162_10612834 Ga0163162_106128342 201
604 3300013306 Ga0163162_10810640 Ga0163162_108106402 201
605 3300013308 Ga0157375_10092375 Ga0157375_100923752 201
606 3300013308 Ga0157375_10507607 Ga0157375_105076072 201
607 3300014325 Ga0163163_10137837 Ga0163163_101378372 201
608 3300014968 Ga0157379_10084744 Ga0157379_100847441 201
609 3300014969 Ga0157376_10040795 Ga0157376_100407953 201
610 3300014969 Ga0157376_11046952 Ga0157376_110469521 201
611 3300021384 Ga0213876_10327341 Ga0213876_103273412 201
612 3300025297 Ga0209758_1037744 Ga0209758_10377442 201
613 3300025711 Ga0207696_1037975 Ga0207696_10379752 201
614 3300025885 Ga0207653_10025668 Ga0207653_100256683 201
615 3300025898 Ga0207692_10281125 Ga0207692_102811252 201
616 3300025900 Ga0207710_10039883 Ga0207710_100398832 201
617 3300025905 Ga0207685_10219287 Ga0207685_102192872 201
618 3300025915 Ga0207693_10057106 Ga0207693_100571062 201
619 3300025923 Ga0207681_10080928 Ga0207681_100809283 201
620 3300025923 Ga0207681_10103243 Ga0207681_101032432 201
621 3300025923 Ga0207681_10325051 Ga0207681_103250512 201
622 3300025927 Ga0207687_10732124 Ga0207687_107321242 201
623 3300025933 Ga0207706_10153487 Ga0207706_101534873 201
624 3300025933 Ga0207706_10574199 Ga0207706_105741992 201
625 3300025941 Ga0207711_10100127 Ga0207711_101001273 201
626 3300025942 Ga0207689_10027067 Ga0207689_100270673 201
627 3300025942 Ga0207689_10166533 Ga0207689_101665332 201
628 3300025961 Ga0207712_10005237 Ga0207712_100052376 201
629 3300025961 Ga0207712_10107032 Ga0207712_101070323 201
630 3300025972 Ga0207668_10010796 Ga0207668_100107962 201
631 3300025972 Ga0207668_10592215 Ga0207668_105922151 201
632 3300026023 Ga0207677_10977717 Ga0207677_109777171 201
633 3300026067 Ga0207678_10178394 Ga0207678_101783943 201
634 3300026088 Ga0207641_10296263 Ga0207641_102962633 201
635 3300026095 Ga0207676_10188754 Ga0207676_101887541 201
636 3300026118 Ga0207675_100022244 Ga0207675_1000222449 201
637 3300026118 Ga0207675_100026604 Ga0207675_1000266042 201
638 3300027866 Ga0209813_10010109 Ga0209813_100101092 201
639 3300028379 Ga0268266_10179697 Ga0268266_101796973 201
640 3300028380 Ga0268265_10004213 Ga0268265_100042136 201
641 3300028380 Ga0268265_10011792 Ga0268265_100117923 201
642 3300033180 Ga0307510_10110063 Ga0307510_101100632 201
643 3300034819 Ga0373958_0030821 Ga0373958_0030821_68_700 201
644 3300034957 Ga0373938_0047875 Ga0373938_0047875_98_730 201
645 3300035114 Ga0373939_0002714 Ga0373939_0002714_2116_2748 201
646 3300035114 Ga0373939_0035806 Ga0373939_0035806_142_774 201
647 3300035115 Ga0373941_0009356 Ga0373941_0009356_989_1621 201
648 3300035121 Ga0373960_0003056 Ga0373960_0003056_1975_2607 201
649 3300035207 Ga0373942_0120166 Ga0373942_0120166_171_803 201
650 3300035691 Ga0373931_0001206 Ga0373931_0001206_3225_3857 201
651 3300035695 Ga0373927_0094432 Ga0373927_0094432_630_1262 201
652 3300037068 Ga0373925_0372268 Ga0373925_0372268_341_973 201
653 3300037471 Ga0395905_0018328 Ga0395905_0018328_2332_2964 201
654 3300037471 Ga0395905_0054352 Ga0395905_0054352_2077_2709 201
655 3300039438 Ga0436360_0595666 Ga0436360_0595666_6543_7175 201
656 3300039447 Ga0436361_0420563 Ga0436361_0420563_1217_1849 201
657 3300039450 Ga0436363_1321995 Ga0436363_1321995_1000_1632 201
658 3300046457 Ga0495590_0004144 Ga0495590_0004144_3830_4462 201
659 3300046472 Ga0495580_0335880 Ga0495580_0335880_269_901 201
660 3300046492 Ga0495585_0086257 Ga0495585_0086257_829_1461 201
661 3300046499 Ga0495594_0290599 Ga0495594_0290599_250_882 201
662 3300046520 Ga0495637_0096336 Ga0495637_0096336_514_1146 201
663 3300046528 Ga0495642_0122822 Ga0495642_0122822_446_1078 201
664 3300046535 Ga0495586_0023355 Ga0495586_0023355_1924_2556 201
665 3300046557 Ga0495622_0147897 Ga0495622_0147897_343_975 201
666 3300046616 Ga0495668_0202737 Ga0495668_0202737_197_829 201
667 3300046660 Ga0495625_0282974 Ga0495625_0282974_55_687 201
668 3300046665 Ga0495661_0289632 Ga0495661_0289632_32_664 201
669 3300046692 Ga0495671_0251568 Ga0495671_0251568_100_732 201
670 3300046692 Ga0495671_0319339 Ga0495671_0319339_32_664 201
671 3300046810 Ga0495660_0192882 Ga0495660_0192882_162_794 201
672 3300047319 Ga0495674_0360623 Ga0495674_0360623_10_642 201
673 3300047320 Ga0495672_0060474 Ga0495672_0060474_292_924 201
674 3300048904 Ga0496101_0056192 Ga0496101_0056192_292_924 201
675 3300048905 Ga0496102_0233059 Ga0496102_0233059_150_782 201
676 3300048906 Ga0496103_0073435 Ga0496103_0073435_1251_1883 201
677 3300048906 Ga0496103_0078961 Ga0496103_0078961_745_1377 201
678 3300048908 Ga0496105_0066282 Ga0496105_0066282_1938_2570 201
679 3300048909 Ga0496106_0182894 Ga0496106_0182894_412_1044 201
680 3300048909 Ga0496106_0438869 Ga0496106_0438869_142_774 201
681 3300048915 Ga0496112_0484864 Ga0496112_0484864_503_1135 201
682 3300048917 Ga0496114_0105195 Ga0496114_0105195_1195_1827 201
683 3300048918 Ga0496115_0035582 Ga0496115_0035582_478_1110 201
684 3300048918 Ga0496115_0591971 Ga0496115_0591971_228_860 201
685 3300048919 Ga0496116_0285380 Ga0496116_0285380_128_760 201
686 3300048920 Ga0496117_0104996 Ga0496117_0104996_419_1051 201
687 3300048921 Ga0496118_0129484 Ga0496118_0129484_291_923 201
688 3300048921 Ga0496118_0191564 Ga0496118_0191564_437_1069 201
689 3300048924 Ga0496121_0000578 Ga0496121_0000578_37140_37772 201
690 3300048924 Ga0496121_0130855 Ga0496121_0130855_422_1054 201
691 3300048927 Ga0496124_0367582 Ga0496124_0367582_337_969 201
692 3300048929 Ga0496126_0000602 Ga0496126_0000602_38279_38911 201
693 3300050489 nmdc:mga03683_71562_c1 nmdc:mga03683_71562_c1_592_1224 201
694 3300050491 nmdc:mga00v17_358641_c1 nmdc:mga00v17_358641_c1_146_778 201
695 3300050492 nmdc:mga0yw44_40131_c1 nmdc:mga0yw44_40131_c1_1656_2288 201
696 3300050494 nmdc:mga06z11_252731_c1 nmdc:mga06z11_252731_c1_28_660 201
697 3300050512 nmdc:mga0n895_966492_c1 nmdc:mga0n895_966492_c1_128_760 201
698 3300053087 Ga0500643_013742 Ga0500643_013742_1561_2193 201
699 3300053090 Ga0500646_0066853 Ga0500646_0066853_418_1050 201
700 3300053098 Ga0500650_0253236 Ga0500650_0253236_33_665 201
701 3300053103 Ga0500555_002647 Ga0500555_002647_408_1040 201
702 3300053104 Ga0500556_0073286 Ga0500556_0073286_165_797 201
703 3300053108 Ga0500562_005493 Ga0500562_005493_423_1055 201
704 3300053116 Ga0500592_013180 Ga0500592_013180_625_1257 201
705 3300053133 Ga0500655_033916 Ga0500655_033916_120_752 201
706 3300053134 Ga0500658_0176213 Ga0500658_0176213_306_938 201
707 3300053139 Ga0500568_0006097 Ga0500568_0006097_1146_1778 201
708 3300053727 Ga0500611_037853 Ga0500611_037853_219_851 201
709 3300053736 Ga0500599_013677 Ga0500599_013677_292_924 201
710 3300028017 Ga0265356_1002401 Ga0265356_10024014 202
711 3300046524 Ga0495648_0004938 Ga0495648_0004938_4243_4878 202
712 3300037471 Ga0395905_0012507 Ga0395905_0012507_7178_7822 203
713 3300048916 Ga0496113_0318827 Ga0496113_0318827_378_1082 203
714 iso_pu_bacteria 2599185354 2600204154 203
715 3300006844 Ga0075428_100229569 Ga0075428_1002295692 204
716 3300006880 Ga0075429_100064871 Ga0075429_1000648713 204
717 3300050508 nmdc:mga09592_100731_c1 nmdc:mga09592_100731_c1_228_872 204
718 3300005336 Ga0070680_100040498 Ga0070680_1000404983 205
719 3300005339 Ga0070660_100022424 Ga0070660_1000224244 205
720 3300005341 Ga0070691_10080946 Ga0070691_100809462 205
721 3300005344 Ga0070661_100327148 Ga0070661_1003271482 205
722 3300005345 Ga0070692_10232327 Ga0070692_102323272 205
723 3300005366 Ga0070659_100010946 Ga0070659_1000109462 205
724 3300005441 Ga0070700_100626568 Ga0070700_1006265681 205
725 3300005455 Ga0070663_100197971 Ga0070663_1001979712 205
726 3300005530 Ga0070679_100046776 Ga0070679_1000467763 205
727 3300005546 Ga0070696_100318707 Ga0070696_1003187072 205
728 3300005547 Ga0070693_100040292 Ga0070693_1000402921 205
729 3300005564 Ga0070664_100056411 Ga0070664_1000564112 205
730 3300005578 Ga0068854_100054453 Ga0068854_1000544533 205
731 3300005842 Ga0068858_100023729 Ga0068858_1000237292 205
732 3300009174 Ga0105241_10010811 Ga0105241_100108116 205
733 3300009545 Ga0105237_10075297 Ga0105237_100752972 205
734 3300010375 Ga0105239_10087057 Ga0105239_100870573 205
735 3300011119 Ga0105246_10007792 Ga0105246_100077922 205
736 3300025900 Ga0207710_10146203 Ga0207710_101462032 205
737 3300025901 Ga0207688_10332323 Ga0207688_103323232 205
738 3300025917 Ga0207660_10163391 Ga0207660_101633912 205
739 3300025919 Ga0207657_10032848 Ga0207657_100328483 205
740 3300025920 Ga0207649_10224843 Ga0207649_102248432 205
741 3300025932 Ga0207690_10132735 Ga0207690_101327352 205
742 3300025935 Ga0207709_10704510 Ga0207709_107045101 205
743 3300026035 Ga0207703_10383554 Ga0207703_103835542 205
744 3300026041 Ga0207639_10040096 Ga0207639_100400962 205
745 3300026067 Ga0207678_10002535 Ga0207678_1000253512 205
746 3300026116 Ga0207674_10152501 Ga0207674_101525012 205
747 3300048924 Ga0496121_0133133 Ga0496121_0133133_686_1324 205
748 iso_pu_bacteria 3000017691 3000019049 205
749 3300044684 Ga0466966_0038670 Ga0466966_0038670_329_1006 206
750 3300045049 Ga0466959_0000686 Ga0466959_0000686_10241_10918 206
751 iso_pu_bacteria 2751185897 2753767083 206
752 3300025981 Ga0207640_10757380 Ga0207640_107573802 207
753 3300037418 Ga0395900_0529256 Ga0395900_0529256_355_1023 207
754 3300037466 Ga0395898_0542514 Ga0395898_0542514_163_831 207
755 iso_pu_bacteria 2842333319 2842336381 208
756 3300021388 Ga0213875_10032002 Ga0213875_100320023 211
757 3300025972 Ga0207668_10757214 Ga0207668_107572141 211
758 3300037853 Ga0436364_0731834 Ga0436364_0731834_6533_7168 211
759 3300037853 Ga0436364_1166421 Ga0436364_1166421_2739_3374 211
760 3300039437 Ga0436365_1115190 Ga0436365_1115190_2722_3357 211
761 3300039437 Ga0436365_1828458 Ga0436365_1828458_602_1237 211
762 3300039438 Ga0436360_0934711 Ga0436360_0934711_1267_1926 213
763 3300050509 nmdc:mga0qj67_91233_c1 nmdc:mga0qj67_91233_c1_1151_1837 214
764 3300003162 Ga0006778J45830_1034026 Ga0006778J45830_10340262 218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00510

COX3

Cytochrome c oxidase subunit III

31

232

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.8738 35 214
2yev-assembly2.cif.gz_A structure of caa3-type cytochrome oxidase 0.8524 52 208
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.8518 35 214
6x8n-assembly2.cif.gz_B crystal structure of h49a able mutant 0.8379 78 208
8hcr-assembly1.cif.gz_S cryo-em structure of the mycobacterium tuberculosis cytochrome bcc:aa3 supercomplex and a novel inhibitor targeting subunit cytochrome ci 0.8314 39 211
ID Description Score Start End Superfamily
af_P9WP67_20_203_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8382 39 211 1.20.120.80
af_Q2FZK1_13_198_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8378 32 215 1.20.120.80
af_Q2FZK1_13_198_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8254 32 215 1.20.120.80
3u8vA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);IL-4 antagonist (De novo design) like domain 0.7987 84 197 1.20.120.660
2yevD03 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.7966 25 208 1.20.120.80
ID Description Score Start End GO Terms
AF-A0A316WCB9-F1-model_v4 Cytochrome o ubiquinol oxidase subunit III 0.9655 65 211 GO:0004129
GO:0005886
GO:0019646
AF-A0A5U6TQ07-F1-model_v4 Cytochrome bo(3) ubiquinol oxidase subunit 3 (Cytochrome o ubiquinol oxidase subunit 3) (Oxidase bo(3) subunit 3) (Ubiquinol oxidase polypeptide III) (Ubiquinol oxidase subunit 3) 0.9577 71 214 GO:0004129
GO:0005886
GO:0009486
GO:0019646
AF-X8DTB9-F1-model_v4 Probable cytochrome c oxidase subunit 3 (EC 7.1.1.9) (Cytochrome aa3 subunit 3) (Cytochrome c oxidase polypeptide III) 0.9516 85 211 GO:0004129
GO:0005886
GO:0019646
AF-A0A5U6TQ07-F1-model_v4 Cytochrome bo(3) ubiquinol oxidase subunit 3 (Cytochrome o ubiquinol oxidase subunit 3) (Oxidase bo(3) subunit 3) (Ubiquinol oxidase polypeptide III) (Ubiquinol oxidase subunit 3) 0.9387 71 214 GO:0004129
GO:0005886
GO:0009486
GO:0019646
AF-A0A828R4C7-F1-model_v4 deleted 0.9373 56 214

Feature Viewer

pLDDT pTM Quality
70.01 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map