F479784

General Info

Members Datasets Scaffolds Average Seq Length
765 342 1530 210

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10347566|Ga0105248_103475662
Length 251
Sequence VRPCEPGSSIARYETKRFPSANKVPEHRARCTPFTFEELDMSMTRRTIGCLAATLLSFAALGVQAQAKAPEALIKEVSTDVLEAVKADKTIQAGDLRKVIALVDQKVLPYVNFQRMTASAVGRYWKQATPDQQKRLQDEFKLLLVRTYSGALSQVSAEQTVELRPTRSAPTDNEVVVRTEIKGKGDPIQLDYRLEKAGDSWKIYDVNVLGVWLVENYRNSFAQEIGANGIDGLIAKMAERNKSAAAGGAKS

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
103 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
166 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
167 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
168 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
169 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
170 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
171 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
172 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
173 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
178 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
193 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
194 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
195 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
196 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
197 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
198 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
199 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
201 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
202 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
203 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
204 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
205 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
217 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
218 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
219 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
220 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
221 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
222 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
223 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
224 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
225 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
226 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
227 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
228 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
229 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
230 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
231 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
232 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
237 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
238 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
239 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
240 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
241 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
242 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
243 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
244 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
245 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
246 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
247 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
248 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
249 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
250 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
251 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
252 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
253 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
258 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
259 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
260 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
269 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
270 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
271 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
272 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
273 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
274 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
275 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
281 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
282 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
283 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
293 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
294 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
295 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
296 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
297 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
298 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
299 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
300 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
301 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
302 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
303 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
304 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
305 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
306 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
307 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
308 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
309 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
310 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
311 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
312 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
313 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
314 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
315 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
316 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
317 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
318 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
319 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
320 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
321 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
322 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
323 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
324 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
325 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
326 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
327 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
328 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
329 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
330 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
331 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
332 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
333 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
334 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
335 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
336 2643221585 Pelomonas sp. Root662 Isolate Unclassified
337 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
338 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
339 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
340 2643221656 Pelomonas sp. Root405 Isolate Unclassified
341 2738541337 Pelomonas sp. BT06 Isolate Unclassified
342 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.12
Metatranscriptomes 1.83
Isolates 1.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.54
Nodule 0
Rhizoplane 2.22
Rhizosphere 84.44
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10347566 3300009177 Bacteria 1670
2 Ga0006778J45830_1077259 3300003162 Bacteria 1394
3 rootH1_10004194 3300003316 Bacteria 11979
4 rootL2_10098807 3300003322 Bacteria 2900
5 rootH1_10008114 3300003323 Bacteria 13430
6 rootH1_10022168 3300003323 Bacteria 2015
7 Ga0055525_1000004 3300003759 Bacteria 888039
8 Ga0065712_10084099 3300005290 Bacteria 2790
9 Ga0065715_10049568 3300005293 Bacteria 1024
10 Ga0065715_10104338 3300005293 Bacteria 2969
11 Ga0070658_10016712 3300005327 Bacteria 5873
12 Ga0070658_10386475 3300005327 Bacteria 1201
13 Ga0070676_10010818 3300005328 Bacteria 4951
14 Ga0070676_10017134 3300005328 Bacteria 4008
15 Ga0070676_10033533 3300005328 Bacteria 2946
16 Ga0070676_10034601 3300005328 Bacteria 2901
17 Ga0070676_10108413 3300005328 Bacteria 1726
18 Ga0070676_10157798 3300005328 Bacteria 1457
19 Ga0070683_100016923 3300005329 Bacteria 6433
20 Ga0070683_100377504 3300005329 Bacteria 1351
21 Ga0070690_100319948 3300005330 Bacteria 1117
22 Ga0070690_100647468 3300005330 Bacteria 807
23 Ga0070670_100005993 3300005331 Bacteria 10284
24 Ga0070670_100013611 3300005331 Bacteria 6971
25 Ga0070670_100021917 3300005331 Bacteria 5496
26 Ga0070670_100026210 3300005331 Bacteria 5018
27 Ga0070670_100034305 3300005331 Bacteria 4367
28 Ga0070670_100080193 3300005331 Bacteria 2805
29 Ga0070670_100099934 3300005331 Bacteria 2497
30 Ga0070670_100178991 3300005331 Bacteria 1840
31 Ga0070670_100201654 3300005331 Bacteria 1729
32 Ga0070670_100225662 3300005331 Bacteria 1630
33 Ga0070670_100287372 3300005331 Bacteria 1436
34 Ga0070670_100319287 3300005331 Bacteria 1360
35 Ga0070670_100868375 3300005331 Bacteria 817
36 Ga0070677_10018747 3300005333 Bacteria 2496
37 Ga0070677_10042845 3300005333 Bacteria 1795
38 Ga0068869_100003409 3300005334 Bacteria 9707
39 Ga0068869_100003488 3300005334 Bacteria 9627
40 Ga0070666_10055778 3300005335 Bacteria 2667
41 Ga0070666_10200545 3300005335 Bacteria 1404
42 Ga0070680_100007060 3300005336 Bacteria 8563
43 Ga0068868_100003534 3300005338 Bacteria 10890
44 Ga0068868_100242372 3300005338 Bacteria 1515
45 Ga0068868_100712822 3300005338 Bacteria 898
46 Ga0070660_100383928 3300005339 Bacteria 1160
47 Ga0070687_100100759 3300005343 Bacteria 1616
48 Ga0070661_100084282 3300005344 Bacteria 2348
49 Ga0070661_100108494 3300005344 Bacteria 2071
50 Ga0070661_100159403 3300005344 Bacteria 1708
51 Ga0070661_100504569 3300005344 Bacteria 969
52 Ga0070668_100082979 3300005347 Bacteria 2515
53 Ga0070668_100338802 3300005347 Bacteria 1270
54 Ga0070668_100658652 3300005347 Bacteria 920
55 Ga0070669_100044294 3300005353 Bacteria 3242
56 Ga0070669_100050718 3300005353 Bacteria 3031
57 Ga0070669_100508065 3300005353 Bacteria 1000
58 Ga0070675_100003929 3300005354 Bacteria 11264
59 Ga0070675_100010402 3300005354 Bacteria 7268
60 Ga0070675_100011240 3300005354 Bacteria 7009
61 Ga0070675_100231294 3300005354 Bacteria 1613
62 Ga0070675_100281933 3300005354 Bacteria 1460
63 Ga0070671_100008407 3300005355 Bacteria 8273
64 Ga0070671_100020098 3300005355 Bacteria 5442
65 Ga0070671_100181160 3300005355 Bacteria 1783
66 Ga0070671_100211408 3300005355 Bacteria 1645
67 Ga0070671_100624712 3300005355 Bacteria 932
68 Ga0070674_100020881 3300005356 Bacteria 4194
69 Ga0070674_100028306 3300005356 Bacteria 3680
70 Ga0070674_100088341 3300005356 Bacteria 2231
71 Ga0070674_100319315 3300005356 Bacteria 1244
72 Ga0070673_100002371 3300005364 Bacteria 11464
73 Ga0070673_100011725 3300005364 Bacteria 5994
74 Ga0070673_100273123 3300005364 Bacteria 1480
75 Ga0070673_101018487 3300005364 Bacteria 771
76 Ga0070688_100099803 3300005365 Bacteria 1912
77 Ga0070659_100011449 3300005366 Bacteria 6562
78 Ga0070659_100178140 3300005366 Bacteria 1744
79 Ga0070659_100481927 3300005366 Bacteria 1055
80 Ga0070667_100032917 3300005367 Bacteria 4327
81 Ga0070667_100135496 3300005367 Bacteria 2153
82 Ga0070667_100222831 3300005367 Bacteria 1679
83 Ga0070667_100673472 3300005367 Bacteria 956
84 Ga0070667_100714862 3300005367 Bacteria 927
85 Ga0070700_100067380 3300005441 Bacteria 2274
86 Ga0070694_100492507 3300005444 Bacteria 974
87 Ga0070663_100019470 3300005455 Bacteria 4474
88 Ga0070663_100624401 3300005455 Bacteria 909
89 Ga0070678_100006062 3300005456 Bacteria 7052
90 Ga0070678_100079865 3300005456 Bacteria 2475
91 Ga0070678_100081202 3300005456 Bacteria 2457
92 Ga0070678_100139871 3300005456 Bacteria 1936
93 Ga0070678_100161592 3300005456 Bacteria 1815
94 Ga0070678_100224568 3300005456 Bacteria 1562
95 Ga0070662_100005695 3300005457 Bacteria 7972
96 Ga0070662_100031932 3300005457 Bacteria 3699
97 Ga0070662_100066091 3300005457 Bacteria 2653
98 Ga0070662_100096975 3300005457 Bacteria 2225
99 Ga0070662_100317970 3300005457 Bacteria 1269
100 Ga0070681_10017630 3300005458 Bacteria 7135
101 Ga0068867_100000039 3300005459 Bacteria 80301
102 Ga0068867_100005426 3300005459 Bacteria 9022
103 Ga0068867_100011577 3300005459 Bacteria 6228
104 Ga0068867_100011992 3300005459 Bacteria 6123
105 Ga0068867_100030867 3300005459 Bacteria 3867
106 Ga0068867_100064789 3300005459 Bacteria 2717
107 Ga0068867_100071487 3300005459 Bacteria 2595
108 Ga0068867_100088852 3300005459 Bacteria 2342
109 Ga0070706_100032108 3300005467 Bacteria 4843
110 Ga0070707_100527591 3300005468 Bacteria 1143
111 Ga0070679_100000726 3300005530 Bacteria 28453
112 Ga0070684_100005261 3300005535 Bacteria 9903
113 Ga0070684_100296305 3300005535 Bacteria 1484
114 Ga0068853_100006811 3300005539 Bacteria 9111
115 Ga0068853_100016160 3300005539 Bacteria 6138
116 Ga0068853_100018149 3300005539 Bacteria 5819
117 Ga0068853_100631394 3300005539 Bacteria 1018
118 Ga0068853_100727613 3300005539 Bacteria 947
119 Ga0070672_100004529 3300005543 Bacteria 9099
120 Ga0070672_100017872 3300005543 Bacteria 5113
121 Ga0070672_100026382 3300005543 Bacteria 4322
122 Ga0070672_100086298 3300005543 Bacteria 2524
123 Ga0070672_100585351 3300005543 Bacteria 971
124 Ga0070693_100041764 3300005547 Bacteria 2582
125 Ga0070693_100044620 3300005547 Bacteria 2508
126 Ga0070665_100007443 3300005548 Bacteria 11136
127 Ga0070665_100104794 3300005548 Bacteria 2830
128 Ga0070665_100183680 3300005548 Bacteria 2092
129 Ga0070665_100331876 3300005548 Bacteria 1525
130 Ga0068855_100018761 3300005563 Bacteria 8316
131 Ga0070664_100015313 3300005564 Bacteria 6270
132 Ga0070664_100031340 3300005564 Bacteria 4441
133 Ga0070664_100082566 3300005564 Bacteria 2772
134 Ga0070664_100226738 3300005564 Bacteria 1673
135 Ga0070664_100484406 3300005564 Bacteria 1139
136 Ga0070664_100499843 3300005564 Bacteria 1120
137 Ga0068857_100010507 3300005577 Bacteria 8046
138 Ga0068857_100058624 3300005577 Bacteria 3419
139 Ga0068857_100916614 3300005577 Bacteria 841
140 Ga0068857_101003583 3300005577 Bacteria 803
141 Ga0068854_100093842 3300005578 Bacteria 2237
142 Ga0068854_100137085 3300005578 Bacteria 1874
143 Ga0068854_100815238 3300005578 Bacteria 814
144 Ga0068856_100013192 3300005614 Bacteria 8003
145 Ga0068856_100074496 3300005614 Bacteria 3361
146 Ga0068856_100154716 3300005614 Bacteria 2303
147 Ga0068856_100247911 3300005614 Bacteria 1796
148 Ga0068856_100531048 3300005614 Bacteria 1198
149 Ga0070702_100479630 3300005615 Bacteria 909
150 Ga0068852_100009092 3300005616 Bacteria 7356
151 Ga0068852_100013380 3300005616 Bacteria 6280
152 Ga0068852_100066202 3300005616 Bacteria 3155
153 Ga0068852_100076990 3300005616 Bacteria 2947
154 Ga0068852_100114694 3300005616 Bacteria 2455
155 Ga0068852_100145938 3300005616 Bacteria 2195
156 Ga0068852_100566609 3300005616 Bacteria 1137
157 Ga0068859_100051040 3300005617 Bacteria 4156
158 Ga0068859_100175354 3300005617 Bacteria 2226
159 Ga0068864_100003169 3300005618 Bacteria 13604
160 Ga0068864_100009398 3300005618 Bacteria 8066
161 Ga0068864_100027497 3300005618 Bacteria 4805
162 Ga0068864_100030416 3300005618 Bacteria 4576
163 Ga0068864_100245098 3300005618 Bacteria 1661
164 Ga0068864_100382206 3300005618 Bacteria 1334
165 Ga0068864_100609456 3300005618 Unclassified 1060
166 Ga0068866_10019689 3300005718 Bacteria 3078
167 Ga0068861_100005459 3300005719 Bacteria 8611
168 Ga0068861_100013781 3300005719 Bacteria 5662
169 Ga0068861_100145774 3300005719 Bacteria 1937
170 Ga0068861_100448370 3300005719 Bacteria 1156
171 Ga0068861_101123611 3300005719 Bacteria 756
172 Ga0068851_10008150 3300005834 Bacteria 4838
173 Ga0068851_10036705 3300005834 Bacteria 2454
174 Ga0068851_10044727 3300005834 Bacteria 2236
175 Ga0068851_10095413 3300005834 Bacteria 1572
176 Ga0068851_10361589 3300005834 Bacteria 846
177 Ga0068870_10076234 3300005840 Bacteria 1841
178 Ga0068870_10107103 3300005840 Bacteria 1590
179 Ga0068870_10142605 3300005840 Bacteria 1403
180 Ga0068870_10203098 3300005840 Bacteria 1203
181 Ga0068863_100018287 3300005841 Bacteria 6711
182 Ga0068863_100297048 3300005841 Bacteria 1566
183 Ga0068863_100704941 3300005841 Bacteria 1003
184 Ga0068858_100010630 3300005842 Bacteria 8712
185 Ga0068860_100039824 3300005843 Bacteria 4494
186 Ga0068860_100090075 3300005843 Bacteria 2921
187 Ga0068860_100126165 3300005843 Bacteria 2453
188 Ga0068860_100182469 3300005843 Bacteria 2029
189 Ga0068862_100042040 3300005844 Bacteria 3891
190 Ga0068862_100086453 3300005844 Bacteria 2726
191 Ga0068862_100441293 3300005844 Bacteria 1225
192 Ga0070716_100136193 3300006173 Bacteria 1560
193 Ga0075362_10185197 3300006177 Bacteria 1010
194 Ga0075367_10142236 3300006178 Bacteria 1486
195 Ga0075366_10000910 3300006195 Bacteria 14335
196 Ga0075366_10003844 3300006195 Bacteria 7999
197 Ga0075366_10008552 3300006195 Bacteria 5695
198 Ga0075366_10016010 3300006195 Bacteria 4305
199 Ga0075366_10021753 3300006195 Bacteria 3729
200 Ga0075366_10042018 3300006195 Bacteria 2707
201 Ga0075366_10100776 3300006195 Bacteria 1733
202 Ga0097621_100009144 3300006237 Bacteria 7182
203 Ga0097621_100044849 3300006237 Bacteria 3569
204 Ga0097621_100127529 3300006237 Bacteria 2162
205 Ga0075370_10000354 3300006353 Bacteria 16716
206 Ga0075370_10007324 3300006353 Bacteria 5618
207 Ga0075370_10029066 3300006353 Bacteria 3076
208 Ga0075370_10038737 3300006353 Bacteria 2683
209 Ga0075370_10049991 3300006353 Bacteria 2371
210 Ga0068871_100006200 3300006358 Bacteria 8431
211 Ga0068871_100008132 3300006358 Bacteria 7530
212 Ga0068871_100016972 3300006358 Bacteria 5497
213 Ga0068871_100021762 3300006358 Bacteria 4935
214 Ga0075430_100024549 3300006846 Bacteria 5127
215 Ga0068865_100041024 3300006881 Bacteria 3148
216 Ga0068865_100080474 3300006881 Bacteria 2336
217 Ga0068865_100112571 3300006881 Bacteria 2010
218 Ga0068865_100408227 3300006881 Bacteria 1114
219 Ga0068865_101203528 3300006881 Bacteria 671
220 Ga0097620_100051038 3300006931 Bacteria 4156
221 Ga0097620_100175351 3300006931 Bacteria 2226
222 Ga0075435_100811210 3300007076 Bacteria 815
223 Ga0105240_10002152 3300009093 Bacteria 32168
224 Ga0105240_10750669 3300009093 Bacteria 1061
225 Ga0111539_10668624 3300009094 Bacteria 1209
226 Ga0111539_11322043 3300009094 Bacteria 836
227 Ga0105245_10308565 3300009098 Bacteria 1555
228 Ga0105245_10371842 3300009098 Bacteria 1421
229 Ga0114129_10080001 3300009147 Bacteria 4544
230 Ga0114129_11755964 3300009147 Bacteria 756
231 Ga0105243_10004160 3300009148 Bacteria 11482
232 Ga0105243_10079876 3300009148 Bacteria 2666
233 Ga0105243_10178693 3300009148 Bacteria 1844
234 Ga0105243_10429104 3300009148 Bacteria 1235
235 Ga0105241_10050051 3300009174 Bacteria 3184
236 Ga0105242_10084716 3300009176 Bacteria 2657
237 Ga0105248_10011079 3300009177 Bacteria 9946
238 Ga0105248_10018942 3300009177 Bacteria 7611
239 Ga0105248_10074691 3300009177 Bacteria 3810
240 Ga0105248_10415963 3300009177 Bacteria 1514
241 Ga0105248_10451657 3300009177 Bacteria 1448
242 Ga0105248_10956328 3300009177 Bacteria 967
243 Ga0105237_10003209 3300009545 Bacteria 19583
244 Ga0105237_10035404 3300009545 Bacteria 5052
245 Ga0105238_10009054 3300009551 Bacteria 9960
246 Ga0105238_10016299 3300009551 Bacteria 7521
247 Ga0105238_10152230 3300009551 Bacteria 2288
248 Ga0105238_10334890 3300009551 Bacteria 1501
249 Ga0105249_10074684 3300009553 Bacteria 3139
250 Ga0105249_10148826 3300009553 Bacteria 2252
251 Ga0105249_11515953 3300009553 Bacteria 743
252 Ga0105239_10001461 3300010375 Bacteria 31458
253 Ga0105239_10305478 3300010375 Bacteria 1792
254 Ga0105246_10061627 3300011119 Bacteria 2611
255 Ga0105246_10097110 3300011119 Bacteria 2137
256 Ga0105246_10983222 3300011119 Bacteria 763
257 Ga0157373_10053653 3300013100 Bacteria 2866
258 Ga0157371_10109439 3300013102 Bacteria 1961
259 Ga0157371_10196215 3300013102 Bacteria 1446
260 Ga0157370_10576582 3300013104 Bacteria 1031
261 Ga0157369_10058720 3300013105 Bacteria 4149
262 Ga0157369_10182335 3300013105 Bacteria 2209
263 Ga0157374_10031054 3300013296 Bacteria 4851
264 Ga0157374_10052887 3300013296 Bacteria 3784
265 Ga0157374_10064219 3300013296 Bacteria 3444
266 Ga0157374_10344983 3300013296 Bacteria 1479
267 Ga0157378_10389624 3300013297 Bacteria 1370
268 Ga0157378_10480928 3300013297 Bacteria 1237
269 Ga0157378_10689578 3300013297 Bacteria 1040
270 Ga0163162_10047853 3300013306 Bacteria 4284
271 Ga0163162_10262578 3300013306 Bacteria 1858
272 Ga0163162_10335040 3300013306 Bacteria 1645
273 Ga0163162_10585832 3300013306 Bacteria 1242
274 Ga0157372_10013740 3300013307 Bacteria 8651
275 Ga0157372_10163891 3300013307 Bacteria 2570
276 Ga0157375_10005174 3300013308 Bacteria 11316
277 Ga0157375_10012252 3300013308 Bacteria 7602
278 Ga0157375_10014262 3300013308 Bacteria 7084
279 Ga0157375_10018621 3300013308 Bacteria 6300
280 Ga0157375_10043978 3300013308 Bacteria 4334
281 Ga0163163_10170197 3300014325 Bacteria 2225
282 Ga0163163_10527962 3300014325 Bacteria 1243
283 Ga0163163_10558172 3300014325 Bacteria 1208
284 Ga0163163_10868387 3300014325 Bacteria 965
285 Ga0157380_10088041 3300014326 Bacteria 2554
286 Ga0157380_10173230 3300014326 Bacteria 1888
287 Ga0157380_10471894 3300014326 Bacteria 1211
288 Ga0157380_10744582 3300014326 Bacteria 991
289 Ga0157377_10000044 3300014745 Bacteria 100420
290 Ga0157377_10001565 3300014745 Bacteria 9949
291 Ga0157377_10278963 3300014745 Bacteria 1094
292 Ga0157379_10004002 3300014968 Bacteria 12563
293 Ga0157379_10010130 3300014968 Bacteria 8218
294 Ga0157379_10020334 3300014968 Bacteria 5869
295 Ga0157379_10026436 3300014968 Bacteria 5166
296 Ga0157379_10589571 3300014968 Bacteria 1037
297 Ga0157379_10697595 3300014968 Bacteria 953
298 Ga0157376_10003307 3300014969 Bacteria 11099
299 Ga0157376_10007305 3300014969 Bacteria 7869
300 Ga0157376_10077851 3300014969 Bacteria 2837
301 Ga0157376_10418916 3300014969 Bacteria 1299
302 Ga0157376_10625128 3300014969 Bacteria 1075
303 Ga0157376_10713108 3300014969 Bacteria 1009
304 Ga0182006_1108030 3300015261 Bacteria 979
305 Ga0163161_10006298 3300017792 Bacteria 8215
306 Ga0163161_10009331 3300017792 Bacteria 6789
307 Ga0163161_10086351 3300017792 Bacteria 2316
308 Ga0163161_10102709 3300017792 Bacteria 2129
309 Ga0163161_10376810 3300017792 Bacteria 1133
310 Ga0163161_10539629 3300017792 Bacteria 955
311 Ga0213872_10000067 3300021361 Bacteria 92410
312 Ga0209674_109982 3300025226 Bacteria 1033
313 Ga0209563_100013 3300025230 Bacteria 941463
314 Ga0209051_1016706 3300025303 Bacteria 3305
315 Ga0209051_1041082 3300025303 Bacteria 1650
316 Ga0209257_1000033 3300025304 Bacteria 671006
317 Ga0207697_10003064 3300025315 Bacteria 8383
318 Ga0207697_10027011 3300025315 Bacteria 2347
319 Ga0207656_10024202 3300025321 Bacteria 2453
320 Ga0207656_10086056 3300025321 Bacteria 1420
321 Ga0207656_10128452 3300025321 Unclassified 1185
322 Ga0207656_10244438 3300025321 Bacteria 878
323 Ga0207682_10002801 3300025893 Bacteria 7710
324 Ga0207682_10011716 3300025893 Bacteria 3427
325 Ga0207682_10050682 3300025893 Bacteria 1717
326 Ga0207642_10010828 3300025899 Bacteria 3231
327 Ga0207688_10041571 3300025901 Bacteria 2558
328 Ga0207680_10058549 3300025903 Bacteria 2336
329 Ga0207680_10123684 3300025903 Bacteria 1695
330 Ga0207645_10004979 3300025907 Bacteria 9736
331 Ga0207645_10023445 3300025907 Bacteria 4012
332 Ga0207645_10024932 3300025907 Bacteria 3874
333 Ga0207645_10049830 3300025907 Bacteria 2674
334 Ga0207645_10192813 3300025907 Bacteria 1339
335 Ga0207645_10421549 3300025907 Bacteria 899
336 Ga0207643_10042410 3300025908 Bacteria 2566
337 Ga0207643_10084950 3300025908 Bacteria 1838
338 Ga0207643_10131827 3300025908 Bacteria 1488
339 Ga0207643_10397455 3300025908 Bacteria 871
340 Ga0207705_10033024 3300025909 Bacteria 3698
341 Ga0207684_10132563 3300025910 Bacteria 2139
342 Ga0207654_10052847 3300025911 Bacteria 2343
343 Ga0207695_10107276 3300025913 Bacteria 2778
344 Ga0207671_10010388 3300025914 Bacteria 7685
345 Ga0207671_10048096 3300025914 Bacteria 3156
346 Ga0207660_10056055 3300025917 Bacteria 2819
347 Ga0207662_10006607 3300025918 Bacteria 6264
348 Ga0207662_10181995 3300025918 Bacteria 1353
349 Ga0207657_10057700 3300025919 Bacteria 3345
350 Ga0207657_10094391 3300025919 Bacteria 2491
351 Ga0207649_10063732 3300025920 Bacteria 2328
352 Ga0207649_10081985 3300025920 Bacteria 2090
353 Ga0207649_10167067 3300025920 Bacteria 1529
354 Ga0207649_10417669 3300025920 Bacteria 1007
355 Ga0207652_10009072 3300025921 Bacteria 8011
356 Ga0207681_10003514 3300025923 Bacteria 9755
357 Ga0207681_10018156 3300025923 Bacteria 4429
358 Ga0207681_10025216 3300025923 Bacteria 3822
359 Ga0207681_10037074 3300025923 Bacteria 3220
360 Ga0207694_10145491 3300025924 Bacteria 1907
361 Ga0207694_10171384 3300025924 Bacteria 1757
362 Ga0207650_10001276 3300025925 Bacteria 18258
363 Ga0207650_10004871 3300025925 Bacteria 9172
364 Ga0207650_10007499 3300025925 Bacteria 7439
365 Ga0207650_10023626 3300025925 Bacteria 4362
366 Ga0207650_10048255 3300025925 Bacteria 3140
367 Ga0207650_10132661 3300025925 Bacteria 1951
368 Ga0207650_10150940 3300025925 Bacteria 1834
369 Ga0207650_10255958 3300025925 Bacteria 1419
370 Ga0207659_10011834 3300025926 Bacteria 5526
371 Ga0207659_10014054 3300025926 Bacteria 5153
372 Ga0207659_10016592 3300025926 Bacteria 4796
373 Ga0207659_10057723 3300025926 Bacteria 2785
374 Ga0207659_10058923 3300025926 Bacteria 2758
375 Ga0207659_10087452 3300025926 Bacteria 2320
376 Ga0207644_10000523 3300025931 Bacteria 24867
377 Ga0207644_10001757 3300025931 Bacteria 14039
378 Ga0207644_10057199 3300025931 Bacteria 2815
379 Ga0207644_10139116 3300025931 Bacteria 1868
380 Ga0207690_10042222 3300025932 Bacteria 2994
381 Ga0207690_10241351 3300025932 Bacteria 1392
382 Ga0207690_10332564 3300025932 Bacteria 1197
383 Ga0207690_10462444 3300025932 Bacteria 1021
384 Ga0207706_10006211 3300025933 Bacteria 11101
385 Ga0207706_10019872 3300025933 Bacteria 6038
386 Ga0207706_10107644 3300025933 Bacteria 2453
387 Ga0207706_10205697 3300025933 Bacteria 1726
388 Ga0207706_10419226 3300025933 Bacteria 1160
389 Ga0207686_10406895 3300025934 Bacteria 1038
390 Ga0207709_10001856 3300025935 Bacteria 14068
391 Ga0207709_10035063 3300025935 Bacteria 2963
392 Ga0207709_10070679 3300025935 Bacteria 2214
393 Ga0207709_10083040 3300025935 Bacteria 2070
394 Ga0207669_10016372 3300025937 Bacteria 3765
395 Ga0207669_10045476 3300025937 Bacteria 2587
396 Ga0207669_10058535 3300025937 Bacteria 2351
397 Ga0207704_10032069 3300025938 Bacteria 2968
398 Ga0207704_10070145 3300025938 Bacteria 2218
399 Ga0207704_10107692 3300025938 Bacteria 1875
400 Ga0207704_10171053 3300025938 Bacteria 1558
401 Ga0207665_10025637 3300025939 Bacteria 3890
402 Ga0207691_10003381 3300025940 Bacteria 15525
403 Ga0207691_10010897 3300025940 Bacteria 8724
404 Ga0207691_10020835 3300025940 Bacteria 6195
405 Ga0207691_10101973 3300025940 Bacteria 2560
406 Ga0207691_10109769 3300025940 Bacteria 2454
407 Ga0207691_10175300 3300025940 Bacteria 1876
408 Ga0207711_10004582 3300025941 Bacteria 11755
409 Ga0207711_10008794 3300025941 Bacteria 8444
410 Ga0207711_10048247 3300025941 Bacteria 3643
411 Ga0207711_10126427 3300025941 Bacteria 2287
412 Ga0207711_10191886 3300025941 Bacteria 1862
413 Ga0207711_10923208 3300025941 Bacteria 811
414 Ga0207689_10003664 3300025942 Bacteria 14006
415 Ga0207689_10020357 3300025942 Bacteria 5586
416 Ga0207689_10035048 3300025942 Bacteria 4169
417 Ga0207661_10037727 3300025944 Bacteria 3782
418 Ga0207661_10466442 3300025944 Bacteria 1151
419 Ga0207679_10008387 3300025945 Bacteria 6580
420 Ga0207679_10030713 3300025945 Bacteria 3754
421 Ga0207679_10178370 3300025945 Bacteria 1755
422 Ga0207679_10226789 3300025945 Bacteria 1575
423 Ga0207679_10333958 3300025945 Bacteria 1316
424 Ga0207667_10251901 3300025949 Bacteria 1806
425 Ga0207651_10013666 3300025960 Bacteria 4655
426 Ga0207651_10014368 3300025960 Bacteria 4568
427 Ga0207651_10128790 3300025960 Bacteria 1933
428 Ga0207668_10033710 3300025972 Bacteria 3394
429 Ga0207668_10188473 3300025972 Bacteria 1632
430 Ga0207668_10490701 3300025972 Bacteria 1055
431 Ga0207668_10654983 3300025972 Bacteria 919
432 Ga0207640_10049149 3300025981 Bacteria 2729
433 Ga0207640_10447656 3300025981 Bacteria 1063
434 Ga0207658_10016179 3300025986 Bacteria 5125
435 Ga0207658_10066551 3300025986 Bacteria 2710
436 Ga0207658_10530481 3300025986 Unclassified 1051
437 Ga0207677_10028700 3300026023 Bacteria 3524
438 Ga0207677_10062293 3300026023 Bacteria 2587
439 Ga0207677_10223449 3300026023 Bacteria 1512
440 Ga0207677_10809071 3300026023 Bacteria 839
441 Ga0207703_10018898 3300026035 Bacteria 5384
442 Ga0207703_10266864 3300026035 Bacteria 1549
443 Ga0207703_10373875 3300026035 Bacteria 1317
444 Ga0207639_10040103 3300026041 Bacteria 3493
445 Ga0207639_10064583 3300026041 Bacteria 2838
446 Ga0207639_10117864 3300026041 Bacteria 2176
447 Ga0207639_10494890 3300026041 Bacteria 1116
448 Ga0207639_11044310 3300026041 Bacteria 766
449 Ga0207678_10015684 3300026067 Bacteria 6659
450 Ga0207678_10040687 3300026067 Bacteria 4030
451 Ga0207678_10082065 3300026067 Bacteria 2759
452 Ga0207678_10154674 3300026067 Bacteria 1958
453 Ga0207708_10012477 3300026075 Bacteria 6333
454 Ga0207702_10099445 3300026078 Bacteria 2564
455 Ga0207702_10121229 3300026078 Bacteria 2341
456 Ga0207702_10386077 3300026078 Bacteria 1347
457 Ga0207641_10009103 3300026088 Bacteria 8202
458 Ga0207641_10019205 3300026088 Bacteria 5608
459 Ga0207641_10021621 3300026088 Bacteria 5285
460 Ga0207641_10059586 3300026088 Bacteria 3251
461 Ga0207648_10000109 3300026089 Bacteria 80648
462 Ga0207648_10004239 3300026089 Bacteria 14817
463 Ga0207648_10009368 3300026089 Bacteria 9379
464 Ga0207648_10010311 3300026089 Bacteria 8871
465 Ga0207648_10441379 3300026089 Bacteria 1184
466 Ga0207676_10011582 3300026095 Bacteria 6306
467 Ga0207676_10045595 3300026095 Bacteria 3388
468 Ga0207676_10079068 3300026095 Bacteria 2666
469 Ga0207676_10426881 3300026095 Unclassified 1244
470 Ga0207676_10714046 3300026095 Bacteria 972
471 Ga0207674_10031922 3300026116 Bacteria 5528
472 Ga0207674_10557935 3300026116 Bacteria 1106
473 Ga0207675_100008151 3300026118 Bacteria 9875
474 Ga0207675_100023191 3300026118 Bacteria 5771
475 Ga0207675_100161335 3300026118 Bacteria 2138
476 Ga0207683_10025450 3300026121 Bacteria 5106
477 Ga0207683_10059454 3300026121 Bacteria 3357
478 Ga0207683_10080603 3300026121 Bacteria 2888
479 Ga0207683_10083536 3300026121 Bacteria 2838
480 Ga0207698_10016587 3300026142 Bacteria 4970
481 Ga0207698_10044118 3300026142 Bacteria 3347
482 Ga0207698_10046575 3300026142 Bacteria 3276
483 Ga0207698_10202437 3300026142 Bacteria 1779
484 Ga0207698_10338146 3300026142 Bacteria 1417
485 Ga0207698_10679887 3300026142 Bacteria 1022
486 Ga0207698_10711409 3300026142 Bacteria 1000
487 Ga0209973_1002610 3300027252 Bacteria 1705
488 Ga0209974_10001641 3300027876 Bacteria 8098
489 Ga0268266_10060195 3300028379 Bacteria 3273
490 Ga0268266_10072607 3300028379 Bacteria 2985
491 Ga0268266_10166821 3300028379 Bacteria 1996
492 Ga0268266_10219514 3300028379 Bacteria 1747
493 Ga0268266_10581397 3300028379 Bacteria 1075
494 Ga0268266_10590786 3300028379 Bacteria 1066
495 Ga0268265_10106367 3300028380 Bacteria 2279
496 Ga0268265_10302459 3300028380 Bacteria 1441
497 Ga0268265_10392985 3300028380 Bacteria 1279
498 Ga0268264_10003375 3300028381 Bacteria 13788
499 Ga0268264_10117505 3300028381 Bacteria 2339
500 Ga0307517_10001980 3300028786 Bacteria 33373
501 Ga0307515_10010956 3300028794 Bacteria 17284
502 Ga0307515_10017116 3300028794 Bacteria 13232
503 Ga0307515_10028743 3300028794 Bacteria 9433
504 Ga0307515_10065408 3300028794 Bacteria 5061
505 Ga0307515_10175282 3300028794 Bacteria 2118
506 Ga0307515_10299171 3300028794 Bacteria 1296
507 Ga0307512_10097071 3300030522 Bacteria 2018
508 Ga0307512_10109888 3300030522 Bacteria 1822
509 Ga0307512_10182862 3300030522 Bacteria 1174
510 Ga0265330_10003025 3300031235 Bacteria 8928
511 Ga0265332_10030405 3300031238 Bacteria 2359
512 Ga0265328_10111836 3300031239 Bacteria 1015
513 Ga0265329_10132407 3300031242 Bacteria 803
514 Ga0265331_10008795 3300031250 Bacteria 5719
515 Ga0265316_10487021 3300031344 Bacteria 882
516 Ga0307513_10017125 3300031456 Bacteria 8704
517 Ga0307513_10195204 3300031456 Bacteria 1871
518 Ga0307509_10000249 3300031507 Bacteria 87094
519 Ga0307509_10003703 3300031507 Bacteria 22876
520 Ga0307509_10012634 3300031507 Bacteria 10086
521 Ga0307509_10074077 3300031507 Bacteria 3543
522 Ga0307509_10108879 3300031507 Bacteria 2783
523 Ga0307509_10375294 3300031507 Bacteria 1137
524 Ga0307408_100000023 3300031548 Bacteria 295931
525 Ga0307408_100015636 3300031548 Bacteria 5056
526 Ga0307408_100196020 3300031548 Bacteria 1631
527 Ga0307508_10004816 3300031616 Bacteria 13012
528 Ga0307508_10006698 3300031616 Bacteria 10804
529 Ga0307508_10216955 3300031616 Bacteria 1513
530 Ga0307514_10001392 3300031649 Bacteria 30115
531 Ga0307514_10075735 3300031649 Bacteria 2508
532 Ga0307514_10089643 3300031649 Bacteria 2246
533 Ga0307514_10141807 3300031649 Bacteria 1632
534 Ga0265314_10017068 3300031711 Bacteria 5707
535 Ga0265342_10049206 3300031712 Bacteria 2523
536 Ga0307516_10000237 3300031730 Bacteria 70929
537 Ga0307516_10000303 3300031730 Bacteria 63898
538 Ga0307516_10285416 3300031730 Bacteria 1331
539 Ga0307516_10332005 3300031730 Bacteria 1189
540 Ga0307516_10339784 3300031730 Bacteria 1169
541 Ga0307516_10433851 3300031730 Bacteria 971
542 Ga0307413_10057428 3300031824 Bacteria 2380
543 Ga0307413_10168485 3300031824 Bacteria 1547
544 Ga0307413_10318493 3300031824 Bacteria 1187
545 Ga0307413_10423715 3300031824 Bacteria 1049
546 Ga0307410_10234165 3300031852 Bacteria 1420
547 Ga0307410_10439420 3300031852 Bacteria 1062
548 Ga0307406_10023123 3300031901 Bacteria 3696
549 Ga0307406_10984675 3300031901 Bacteria 723
550 Ga0307407_10468201 3300031903 Bacteria 918
551 Ga0307412_10027498 3300031911 Bacteria 3547
552 Ga0307412_10034896 3300031911 Bacteria 3209
553 Ga0307412_10100837 3300031911 Bacteria 2042
554 Ga0307409_100383629 3300031995 Bacteria 1337
555 Ga0307416_100014114 3300032002 Bacteria 5457
556 Ga0307416_100061065 3300032002 Bacteria 3074
557 Ga0307414_10240025 3300032004 Bacteria 1500
558 Ga0307411_10012282 3300032005 Bacteria 4665
559 Ga0307411_10016314 3300032005 Bacteria 4202
560 Ga0307411_10018187 3300032005 Bacteria 4026
561 Ga0307411_10026501 3300032005 Bacteria 3492
562 Ga0307415_100068180 3300032126 Bacteria 2489
563 Ga0307415_100116794 3300032126 Bacteria 1991
564 Ga0307510_10043278 3300033180 Bacteria 4896
565 Ga0307510_10072075 3300033180 Bacteria 3434
566 Ga0373930_0026541 3300034816 Bacteria 1168
567 Ga0373959_0010617 3300034820 Bacteria 1612
568 Ga0373949_0089859 3300035090 Bacteria 829
569 Ga0373951_0064691 3300035091 Bacteria 921
570 Ga0373952_0012226 3300035092 Bacteria 1685
571 Ga0373932_0018150 3300035112 Bacteria 1815
572 Ga0373936_0095384 3300035113 Bacteria 1251
573 Ga0373939_0000184 3300035114 Bacteria 17389
574 Ga0373945_0165722 3300035116 Bacteria 903
575 Ga0373960_0069961 3300035121 Bacteria 1083
576 Ga0373943_0109578 3300035170 Bacteria 1455
577 Ga0373943_0416011 3300035170 Bacteria 778
578 Ga0373946_0011338 3300035171 Bacteria 3323
579 Ga0373946_0068600 3300035171 Bacteria 1526
580 Ga0373955_0065797 3300035172 Bacteria 2013
581 Ga0373931_0000092 3300035691 Bacteria 41580
582 Ga0373931_0002695 3300035691 Bacteria 7904
583 Ga0373931_0009750 3300035691 Bacteria 4598
584 Ga0373927_0265998 3300035695 Bacteria 1128
585 Ga0373927_0678656 3300035695 Bacteria 681
586 Ga0373933_0097619 3300035724 Bacteria 1820
587 Ga0373947_0230131 3300035725 Bacteria 1221
588 Ga0373937_0171306 3300036401 Bacteria 2037
589 Ga0373937_0180302 3300036401 Bacteria 1983
590 Ga0373937_0622301 3300036401 Bacteria 1024
591 Ga0373925_0050008 3300037068 Bacteria 3117
592 Ga0373925_0221711 3300037068 Bacteria 1509
593 Ga0373925_0263414 3300037068 Bacteria 1385
594 Ga0373925_0392936 3300037068 Bacteria 1130
595 Ga0395900_0245950 3300037418 Bacteria 1792
596 Ga0395900_0646875 3300037418 Bacteria 994
597 Ga0395905_0000027 3300037471 Bacteria 297239
598 Ga0395905_0000151 3300037471 Bacteria 115485
599 Ga0395905_0014823 3300037471 Bacteria 7432
600 Ga0395905_0074018 3300037471 Bacteria 3192
601 Ga0395905_0417523 3300037471 Bacteria 1237
602 Ga0395901_0164028 3300038443 Bacteria 2333
603 Ga0436365_0757688 3300039437 Bacteria 1199
604 Ga0436361_0750298 3300039447 Bacteria 51036
605 Ga0451798_0362761 3300041458 Bacteria 2178
606 Ga0451802_0227373 3300041460 Bacteria 853
607 Ga0451853_0566426 3300041512 Bacteria 926
608 Ga0451853_1375847 3300041512 Bacteria 786
609 Ga0451853_1931705 3300041512 Bacteria 944
610 Ga0439437_000095 3300042000 Bacteria 6474
611 Ga0439455_0003524 3300042012 Bacteria 3002
612 Ga0450911_000507 3300042115 Bacteria 12353
613 Ga0450888_000691 3300042126 Bacteria 3194
614 Ga0450891_000206 3300042129 Bacteria 5846
615 Ga0450901_004084 3300042533 Bacteria 1513
616 Ga0451577_0004735 3300042876 Bacteria 14256
617 Ga0451577_0155936 3300042876 Bacteria 2055
618 Ga0451577_0273095 3300042876 Bacteria 1531
619 Ga0451577_0404222 3300042876 Bacteria 1240
620 Ga0453683_0459440 3300044673 Bacteria 824
621 Ga0466965_0295094 3300044683 Bacteria 878
622 Ga0466964_0218482 3300044706 Bacteria 924
623 Ga0453684_0020128 3300044712 Bacteria 10096
624 Ga0453684_0086122 3300044712 Bacteria 3900
625 Ga0453684_0134244 3300044712 Bacteria 2966
626 Ga0453684_0286196 3300044712 Bacteria 1878
627 Ga0453684_0314661 3300044712 Bacteria 1775
628 Ga0453684_0412870 3300044712 Bacteria 1509
629 Ga0451576_0004667 3300045051 Bacteria 17660
630 Ga0451576_0005708 3300045051 Bacteria 15524
631 Ga0451576_0212037 3300045051 Bacteria 2022
632 Ga0451576_0315333 3300045051 Bacteria 1636
633 Ga0495592_0001883 3300046454 Bacteria 14765
634 Ga0495638_0279367 3300046460 Bacteria 908
635 Ga0495650_0060731 3300046471 Bacteria 1517
636 Ga0495639_0111302 3300046475 Bacteria 1300
637 Ga0495610_0038724 3300046512 Bacteria 2418
638 Ga0495628_0238440 3300046516 Bacteria 1361
639 Ga0495630_0448757 3300046517 Bacteria 988
640 Ga0495666_0098757 3300046526 Bacteria 1376
641 Ga0495642_0065027 3300046528 Bacteria 1518
642 Ga0495598_0016283 3300046537 Bacteria 1894
643 Ga0495621_0112088 3300046539 Bacteria 1047
644 Ga0495597_0198210 3300046542 Bacteria 805
645 Ga0495633_0156073 3300046558 Bacteria 1053
646 Ga0495656_0003963 3300046615 Bacteria 5031
647 Ga0495656_0328626 3300046615 Bacteria 789
648 Ga0495661_0369699 3300046665 Bacteria 702
649 Ga0495599_0135816 3300046678 Bacteria 1527
650 Ga0495647_0073605 3300046681 Bacteria 1372
651 Ga0495658_0052347 3300046683 Bacteria 2315
652 Ga0495658_0154088 3300046683 Bacteria 1413
653 Ga0495658_0269335 3300046683 Bacteria 1073
654 Ga0495658_0433225 3300046683 Bacteria 839
655 Ga0495669_0026101 3300046684 Bacteria 2552
656 Ga0495669_0210553 3300046684 Bacteria 931
657 Ga0495624_0207403 3300046690 Bacteria 1189
658 Ga0495670_0272753 3300046691 Bacteria 904
659 Ga0495671_0129216 3300046692 Bacteria 1232
660 Ga0495604_0523462 3300047317 Bacteria 767
661 Ga0495636_0110523 3300047318 Bacteria 1209
662 Ga0495676_0052751 3300047321 Bacteria 3244
663 Ga0495675_0308281 3300047444 Bacteria 939
664 Ga0495677_0017847 3300047445 Bacteria 2572
665 Ga0495685_050054 3300047447 Bacteria 1418
666 Ga0495684_0260937 3300047471 Bacteria 1257
667 Ga0496100_0004969 3300048903 Bacteria 7109
668 Ga0496101_0020005 3300048904 Bacteria 4577
669 Ga0496102_0050949 3300048905 Bacteria 3771
670 Ga0496104_0207849 3300048907 Bacteria 1869
671 Ga0496104_0382744 3300048907 Bacteria 1320
672 Ga0496105_0152969 3300048908 Bacteria 1896
673 Ga0496105_0343379 3300048908 Bacteria 1193
674 Ga0496107_0003649 3300048910 Bacteria 10348
675 Ga0496108_0163203 3300048911 Bacteria 1926
676 Ga0496108_0256556 3300048911 Bacteria 1521
677 Ga0496110_0072750 3300048913 Bacteria 3051
678 Ga0496114_0168105 3300048917 Bacteria 1910
679 Ga0496114_0266760 3300048917 Bacteria 1508
680 Ga0496114_0322005 3300048917 Bacteria 1366
681 Ga0496115_0160232 3300048918 Bacteria 1859
682 Ga0496121_0494783 3300048924 Bacteria 778
683 Ga0496122_0000612 3300048925 Bacteria 73307
684 Ga0496123_0000274 3300048926 Bacteria 101783
685 Ga0496124_0109171 3300048927 Bacteria 2230
686 Ga0501306_027319 3300049127 Bacteria 830
687 Ga0501309_000235 3300049129 Bacteria 3925
688 Ga0501310_000547 3300049130 Bacteria 3324
689 Ga0501304_005516 3300049160 Bacteria 994
690 Ga0501307_007500 3300049162 Bacteria 1205
691 Ga0501294_004193 3300049517 Bacteria 1360
692 Ga0501300_023207 3300049523 Bacteria 908
693 Ga0501301_003010 3300049524 Bacteria 1143
694 Ga0501311_010619 3300049527 Bacteria 1121
695 Ga0501312_018143 3300049528 Bacteria 1022
696 Ga0501314_001724 3300049530 Bacteria 1617
697 Ga0501315_002842 3300049531 Bacteria 1676
698 Ga0501317_023975 3300049533 Bacteria 846
699 Ga0501318_016293 3300049534 Bacteria 897
700 Ga0501322_004543 3300049538 Bacteria 937
701 Ga0501323_010154 3300049539 Bacteria 1119
702 Ga0501042_0775042 3300049578 Bacteria 698
703 Ga0501198_000024 3300049649 Bacteria 67171
704 Ga0501199_011061 3300049650 Bacteria 972
705 Ga0501206_002409 3300049653 Bacteria 2359
706 Ga0501207_053800 3300049654 Bacteria 724
707 Ga0501211_002221 3300049658 Bacteria 2061
708 Ga0501222_000020 3300049662 Bacteria 67164
709 Ga0501222_001970 3300049662 Bacteria 2846
710 Ga0501227_018678 3300049665 Bacteria 1576
711 Ga0501235_004234 3300049669 Bacteria 3109
712 Ga0501236_016828 3300049670 Bacteria 1039
713 Ga0501252_009169 3300049682 Bacteria 1149
714 Ga0501258_000428 3300049687 Bacteria 2805
715 Ga0501221_000262 3300049704 Bacteria 7763
716 Ga0501229_000047 3300049706 Bacteria 11920
717 Ga0501232_002169 3300049757 Bacteria 1676
718 Ga0501262_005168 3300049759 Bacteria 1535
719 Ga0501262_009579 3300049759 Bacteria 1200
720 Ga0501267_000585 3300049764 Bacteria 2887
721 nmdc:mga03683_281610_c1 3300050489 Bacteria 777
722 nmdc:mga03n38_539126_c1 3300050490 Bacteria 659
723 nmdc:mga00v17_200339_c1 3300050491 Bacteria 1290
724 nmdc:mga0yw44_690162_c1 3300050492 Bacteria 694
725 nmdc:mga0k408_100269_c1 3300050493 Bacteria 1707
726 nmdc:mga0k408_132241_c1 3300050493 Bacteria 1481
727 nmdc:mga0k408_302_c1 3300050493 Bacteria 26707
728 nmdc:mga0k408_35485_c1 3300050493 Bacteria 2860
729 nmdc:mga0k408_4061_c1 3300050493 Bacteria 7765
730 nmdc:mga0k408_57744_c1 3300050493 Bacteria 2253
731 nmdc:mga0k408_67442_c1 3300050493 Bacteria 2085
732 nmdc:mga0k408_7292_c1 3300050493 Bacteria 5907
733 nmdc:mga0k408_830_c1 3300050493 Bacteria 17018
734 nmdc:mga07m45_23681_c1 3300050496 Bacteria 3358
735 nmdc:mga07m45_5925_c1 3300050496 Bacteria 6133
736 nmdc:mga05p37_291899_c1 3300050507 Bacteria 1941
737 nmdc:mga09592_1397_c1 3300050508 Bacteria 19296
738 nmdc:mga0qj67_17079_c1 3300050509 Bacteria 5514
739 nmdc:mga0n895_650250_c1 3300050512 Bacteria 1053
740 nmdc:mga0rr50_727903_c1 3300050513 Bacteria 847
741 Ga0495601_0032063 3300053077 Bacteria 3269
742 Ga0495595_0058158 3300053084 Bacteria 1805
743 Ga0500578_0037319 3300053086 Bacteria 3121
744 Ga0500644_0004099 3300053088 Bacteria 3626
745 Ga0500651_0030909 3300053093 Bacteria 3371
746 Ga0500594_0000665 3300053118 Bacteria 7310
747 Ga0500652_080915 3300053131 Bacteria 1352
748 Ga0500655_029846 3300053133 Bacteria 1047
749 Ga0500559_0000032 3300053136 Bacteria 113579
750 Ga0500564_056359 3300053138 Bacteria 1790
751 Ga0500619_000006 3300053154 Bacteria 77270
752 Ga0500619_009997 3300053154 Bacteria 2379
753 Ga0500622_0001884 3300053156 Bacteria 15840
754 Ga0500634_0010236 3300053161 Bacteria 4784
755 Ga0500636_0173770 3300053177 Bacteria 1163
756 Ga0500645_002942 3300053730 Bacteria 7241
757 Ga0500587_012117 3300053739 Bacteria 1087
758 2643743076 2643221544 Bacteria 5886209
759 2643932898 2643221585 Bacteria 5812563
760 2644218507 2643221639 Bacteria 6649903
761 2644260402 2643221646 Bacteria 6433402
762 2644301238 2643221654 Bacteria 5273570
763 2644314148 2643221656 Bacteria 5809961
764 2739055937 2738541337 Bacteria 6183410
765 2881103397 2881101125 Bacteria 4590519
766 Ga0105248_10347566
767 Ga0006778J45830_1077259
768 rootH1_10004194
769 rootL2_10098807
770 rootH1_10008114
771 rootH1_10022168
772 Ga0055525_1000004
773 Ga0065712_10084099
774 Ga0065715_10049568
775 Ga0065715_10104338
776 Ga0070658_10016712
777 Ga0070658_10386475
778 Ga0070676_10010818
779 Ga0070676_10017134
780 Ga0070676_10033533
781 Ga0070676_10034601
782 Ga0070676_10108413
783 Ga0070676_10157798
784 Ga0070683_100016923
785 Ga0070683_100377504
786 Ga0070690_100319948
787 Ga0070690_100647468
788 Ga0070670_100005993
789 Ga0070670_100013611
790 Ga0070670_100021917
791 Ga0070670_100026210
792 Ga0070670_100034305
793 Ga0070670_100080193
794 Ga0070670_100099934
795 Ga0070670_100178991
796 Ga0070670_100201654
797 Ga0070670_100225662
798 Ga0070670_100287372
799 Ga0070670_100319287
800 Ga0070670_100868375
801 Ga0070677_10018747
802 Ga0070677_10042845
803 Ga0068869_100003409
804 Ga0068869_100003488
805 Ga0070666_10055778
806 Ga0070666_10200545
807 Ga0070680_100007060
808 Ga0068868_100003534
809 Ga0068868_100242372
810 Ga0068868_100712822
811 Ga0070660_100383928
812 Ga0070687_100100759
813 Ga0070661_100084282
814 Ga0070661_100108494
815 Ga0070661_100159403
816 Ga0070661_100504569
817 Ga0070668_100082979
818 Ga0070668_100338802
819 Ga0070668_100658652
820 Ga0070669_100044294
821 Ga0070669_100050718
822 Ga0070669_100508065
823 Ga0070675_100003929
824 Ga0070675_100010402
825 Ga0070675_100011240
826 Ga0070675_100231294
827 Ga0070675_100281933
828 Ga0070671_100008407
829 Ga0070671_100020098
830 Ga0070671_100181160
831 Ga0070671_100211408
832 Ga0070671_100624712
833 Ga0070674_100020881
834 Ga0070674_100028306
835 Ga0070674_100088341
836 Ga0070674_100319315
837 Ga0070673_100002371
838 Ga0070673_100011725
839 Ga0070673_100273123
840 Ga0070673_101018487
841 Ga0070688_100099803
842 Ga0070659_100011449
843 Ga0070659_100178140
844 Ga0070659_100481927
845 Ga0070667_100032917
846 Ga0070667_100135496
847 Ga0070667_100222831
848 Ga0070667_100673472
849 Ga0070667_100714862
850 Ga0070700_100067380
851 Ga0070694_100492507
852 Ga0070663_100019470
853 Ga0070663_100624401
854 Ga0070678_100006062
855 Ga0070678_100079865
856 Ga0070678_100081202
857 Ga0070678_100139871
858 Ga0070678_100161592
859 Ga0070678_100224568
860 Ga0070662_100005695
861 Ga0070662_100031932
862 Ga0070662_100066091
863 Ga0070662_100096975
864 Ga0070662_100317970
865 Ga0070681_10017630
866 Ga0068867_100000039
867 Ga0068867_100005426
868 Ga0068867_100011577
869 Ga0068867_100011992
870 Ga0068867_100030867
871 Ga0068867_100064789
872 Ga0068867_100071487
873 Ga0068867_100088852
874 Ga0070706_100032108
875 Ga0070707_100527591
876 Ga0070679_100000726
877 Ga0070684_100005261
878 Ga0070684_100296305
879 Ga0068853_100006811
880 Ga0068853_100016160
881 Ga0068853_100018149
882 Ga0068853_100631394
883 Ga0068853_100727613
884 Ga0070672_100004529
885 Ga0070672_100017872
886 Ga0070672_100026382
887 Ga0070672_100086298
888 Ga0070672_100585351
889 Ga0070693_100041764
890 Ga0070693_100044620
891 Ga0070665_100007443
892 Ga0070665_100104794
893 Ga0070665_100183680
894 Ga0070665_100331876
895 Ga0068855_100018761
896 Ga0070664_100015313
897 Ga0070664_100031340
898 Ga0070664_100082566
899 Ga0070664_100226738
900 Ga0070664_100484406
901 Ga0070664_100499843
902 Ga0068857_100010507
903 Ga0068857_100058624
904 Ga0068857_100916614
905 Ga0068857_101003583
906 Ga0068854_100093842
907 Ga0068854_100137085
908 Ga0068854_100815238
909 Ga0068856_100013192
910 Ga0068856_100074496
911 Ga0068856_100154716
912 Ga0068856_100247911
913 Ga0068856_100531048
914 Ga0070702_100479630
915 Ga0068852_100009092
916 Ga0068852_100013380
917 Ga0068852_100066202
918 Ga0068852_100076990
919 Ga0068852_100114694
920 Ga0068852_100145938
921 Ga0068852_100566609
922 Ga0068859_100051040
923 Ga0068859_100175354
924 Ga0068864_100003169
925 Ga0068864_100009398
926 Ga0068864_100027497
927 Ga0068864_100030416
928 Ga0068864_100245098
929 Ga0068864_100382206
930 Ga0068864_100609456
931 Ga0068866_10019689
932 Ga0068861_100005459
933 Ga0068861_100013781
934 Ga0068861_100145774
935 Ga0068861_100448370
936 Ga0068861_101123611
937 Ga0068851_10008150
938 Ga0068851_10036705
939 Ga0068851_10044727
940 Ga0068851_10095413
941 Ga0068851_10361589
942 Ga0068870_10076234
943 Ga0068870_10107103
944 Ga0068870_10142605
945 Ga0068870_10203098
946 Ga0068863_100018287
947 Ga0068863_100297048
948 Ga0068863_100704941
949 Ga0068858_100010630
950 Ga0068860_100039824
951 Ga0068860_100090075
952 Ga0068860_100126165
953 Ga0068860_100182469
954 Ga0068862_100042040
955 Ga0068862_100086453
956 Ga0068862_100441293
957 Ga0070716_100136193
958 Ga0075362_10185197
959 Ga0075367_10142236
960 Ga0075366_10000910
961 Ga0075366_10003844
962 Ga0075366_10008552
963 Ga0075366_10016010
964 Ga0075366_10021753
965 Ga0075366_10042018
966 Ga0075366_10100776
967 Ga0097621_100009144
968 Ga0097621_100044849
969 Ga0097621_100127529
970 Ga0075370_10000354
971 Ga0075370_10007324
972 Ga0075370_10029066
973 Ga0075370_10038737
974 Ga0075370_10049991
975 Ga0068871_100006200
976 Ga0068871_100008132
977 Ga0068871_100016972
978 Ga0068871_100021762
979 Ga0075430_100024549
980 Ga0068865_100041024
981 Ga0068865_100080474
982 Ga0068865_100112571
983 Ga0068865_100408227
984 Ga0068865_101203528
985 Ga0097620_100051038
986 Ga0097620_100175351
987 Ga0075435_100811210
988 Ga0105240_10002152
989 Ga0105240_10750669
990 Ga0111539_10668624
991 Ga0111539_11322043
992 Ga0105245_10308565
993 Ga0105245_10371842
994 Ga0114129_10080001
995 Ga0114129_11755964
996 Ga0105243_10004160
997 Ga0105243_10079876
998 Ga0105243_10178693
999 Ga0105243_10429104
1000 Ga0105241_10050051
1001 Ga0105242_10084716
1002 Ga0105248_10011079
1003 Ga0105248_10018942
1004 Ga0105248_10074691
1005 Ga0105248_10415963
1006 Ga0105248_10451657
1007 Ga0105248_10956328
1008 Ga0105237_10003209
1009 Ga0105237_10035404
1010 Ga0105238_10009054
1011 Ga0105238_10016299
1012 Ga0105238_10152230
1013 Ga0105238_10334890
1014 Ga0105249_10074684
1015 Ga0105249_10148826
1016 Ga0105249_11515953
1017 Ga0105239_10001461
1018 Ga0105239_10305478
1019 Ga0105246_10061627
1020 Ga0105246_10097110
1021 Ga0105246_10983222
1022 Ga0157373_10053653
1023 Ga0157371_10109439
1024 Ga0157371_10196215
1025 Ga0157370_10576582
1026 Ga0157369_10058720
1027 Ga0157369_10182335
1028 Ga0157374_10031054
1029 Ga0157374_10052887
1030 Ga0157374_10064219
1031 Ga0157374_10344983
1032 Ga0157378_10389624
1033 Ga0157378_10480928
1034 Ga0157378_10689578
1035 Ga0163162_10047853
1036 Ga0163162_10262578
1037 Ga0163162_10335040
1038 Ga0163162_10585832
1039 Ga0157372_10013740
1040 Ga0157372_10163891
1041 Ga0157375_10005174
1042 Ga0157375_10012252
1043 Ga0157375_10014262
1044 Ga0157375_10018621
1045 Ga0157375_10043978
1046 Ga0163163_10170197
1047 Ga0163163_10527962
1048 Ga0163163_10558172
1049 Ga0163163_10868387
1050 Ga0157380_10088041
1051 Ga0157380_10173230
1052 Ga0157380_10471894
1053 Ga0157380_10744582
1054 Ga0157377_10000044
1055 Ga0157377_10001565
1056 Ga0157377_10278963
1057 Ga0157379_10004002
1058 Ga0157379_10010130
1059 Ga0157379_10020334
1060 Ga0157379_10026436
1061 Ga0157379_10589571
1062 Ga0157379_10697595
1063 Ga0157376_10003307
1064 Ga0157376_10007305
1065 Ga0157376_10077851
1066 Ga0157376_10418916
1067 Ga0157376_10625128
1068 Ga0157376_10713108
1069 Ga0182006_1108030
1070 Ga0163161_10006298
1071 Ga0163161_10009331
1072 Ga0163161_10086351
1073 Ga0163161_10102709
1074 Ga0163161_10376810
1075 Ga0163161_10539629
1076 Ga0213872_10000067
1077 Ga0209674_109982
1078 Ga0209563_100013
1079 Ga0209051_1016706
1080 Ga0209051_1041082
1081 Ga0209257_1000033
1082 Ga0207697_10003064
1083 Ga0207697_10027011
1084 Ga0207656_10024202
1085 Ga0207656_10086056
1086 Ga0207656_10128452
1087 Ga0207656_10244438
1088 Ga0207682_10002801
1089 Ga0207682_10011716
1090 Ga0207682_10050682
1091 Ga0207642_10010828
1092 Ga0207688_10041571
1093 Ga0207680_10058549
1094 Ga0207680_10123684
1095 Ga0207645_10004979
1096 Ga0207645_10023445
1097 Ga0207645_10024932
1098 Ga0207645_10049830
1099 Ga0207645_10192813
1100 Ga0207645_10421549
1101 Ga0207643_10042410
1102 Ga0207643_10084950
1103 Ga0207643_10131827
1104 Ga0207643_10397455
1105 Ga0207705_10033024
1106 Ga0207684_10132563
1107 Ga0207654_10052847
1108 Ga0207695_10107276
1109 Ga0207671_10010388
1110 Ga0207671_10048096
1111 Ga0207660_10056055
1112 Ga0207662_10006607
1113 Ga0207662_10181995
1114 Ga0207657_10057700
1115 Ga0207657_10094391
1116 Ga0207649_10063732
1117 Ga0207649_10081985
1118 Ga0207649_10167067
1119 Ga0207649_10417669
1120 Ga0207652_10009072
1121 Ga0207681_10003514
1122 Ga0207681_10018156
1123 Ga0207681_10025216
1124 Ga0207681_10037074
1125 Ga0207694_10145491
1126 Ga0207694_10171384
1127 Ga0207650_10001276
1128 Ga0207650_10004871
1129 Ga0207650_10007499
1130 Ga0207650_10023626
1131 Ga0207650_10048255
1132 Ga0207650_10132661
1133 Ga0207650_10150940
1134 Ga0207650_10255958
1135 Ga0207659_10011834
1136 Ga0207659_10014054
1137 Ga0207659_10016592
1138 Ga0207659_10057723
1139 Ga0207659_10058923
1140 Ga0207659_10087452
1141 Ga0207644_10000523
1142 Ga0207644_10001757
1143 Ga0207644_10057199
1144 Ga0207644_10139116
1145 Ga0207690_10042222
1146 Ga0207690_10241351
1147 Ga0207690_10332564
1148 Ga0207690_10462444
1149 Ga0207706_10006211
1150 Ga0207706_10019872
1151 Ga0207706_10107644
1152 Ga0207706_10205697
1153 Ga0207706_10419226
1154 Ga0207686_10406895
1155 Ga0207709_10001856
1156 Ga0207709_10035063
1157 Ga0207709_10070679
1158 Ga0207709_10083040
1159 Ga0207669_10016372
1160 Ga0207669_10045476
1161 Ga0207669_10058535
1162 Ga0207704_10032069
1163 Ga0207704_10070145
1164 Ga0207704_10107692
1165 Ga0207704_10171053
1166 Ga0207665_10025637
1167 Ga0207691_10003381
1168 Ga0207691_10010897
1169 Ga0207691_10020835
1170 Ga0207691_10101973
1171 Ga0207691_10109769
1172 Ga0207691_10175300
1173 Ga0207711_10004582
1174 Ga0207711_10008794
1175 Ga0207711_10048247
1176 Ga0207711_10126427
1177 Ga0207711_10191886
1178 Ga0207711_10923208
1179 Ga0207689_10003664
1180 Ga0207689_10020357
1181 Ga0207689_10035048
1182 Ga0207661_10037727
1183 Ga0207661_10466442
1184 Ga0207679_10008387
1185 Ga0207679_10030713
1186 Ga0207679_10178370
1187 Ga0207679_10226789
1188 Ga0207679_10333958
1189 Ga0207667_10251901
1190 Ga0207651_10013666
1191 Ga0207651_10014368
1192 Ga0207651_10128790
1193 Ga0207668_10033710
1194 Ga0207668_10188473
1195 Ga0207668_10490701
1196 Ga0207668_10654983
1197 Ga0207640_10049149
1198 Ga0207640_10447656
1199 Ga0207658_10016179
1200 Ga0207658_10066551
1201 Ga0207658_10530481
1202 Ga0207677_10028700
1203 Ga0207677_10062293
1204 Ga0207677_10223449
1205 Ga0207677_10809071
1206 Ga0207703_10018898
1207 Ga0207703_10266864
1208 Ga0207703_10373875
1209 Ga0207639_10040103
1210 Ga0207639_10064583
1211 Ga0207639_10117864
1212 Ga0207639_10494890
1213 Ga0207639_11044310
1214 Ga0207678_10015684
1215 Ga0207678_10040687
1216 Ga0207678_10082065
1217 Ga0207678_10154674
1218 Ga0207708_10012477
1219 Ga0207702_10099445
1220 Ga0207702_10121229
1221 Ga0207702_10386077
1222 Ga0207641_10009103
1223 Ga0207641_10019205
1224 Ga0207641_10021621
1225 Ga0207641_10059586
1226 Ga0207648_10000109
1227 Ga0207648_10004239
1228 Ga0207648_10009368
1229 Ga0207648_10010311
1230 Ga0207648_10441379
1231 Ga0207676_10011582
1232 Ga0207676_10045595
1233 Ga0207676_10079068
1234 Ga0207676_10426881
1235 Ga0207676_10714046
1236 Ga0207674_10031922
1237 Ga0207674_10557935
1238 Ga0207675_100008151
1239 Ga0207675_100023191
1240 Ga0207675_100161335
1241 Ga0207683_10025450
1242 Ga0207683_10059454
1243 Ga0207683_10080603
1244 Ga0207683_10083536
1245 Ga0207698_10016587
1246 Ga0207698_10044118
1247 Ga0207698_10046575
1248 Ga0207698_10202437
1249 Ga0207698_10338146
1250 Ga0207698_10679887
1251 Ga0207698_10711409
1252 Ga0209973_1002610
1253 Ga0209974_10001641
1254 Ga0268266_10060195
1255 Ga0268266_10072607
1256 Ga0268266_10166821
1257 Ga0268266_10219514
1258 Ga0268266_10581397
1259 Ga0268266_10590786
1260 Ga0268265_10106367
1261 Ga0268265_10302459
1262 Ga0268265_10392985
1263 Ga0268264_10003375
1264 Ga0268264_10117505
1265 Ga0307517_10001980
1266 Ga0307515_10010956
1267 Ga0307515_10017116
1268 Ga0307515_10028743
1269 Ga0307515_10065408
1270 Ga0307515_10175282
1271 Ga0307515_10299171
1272 Ga0307512_10097071
1273 Ga0307512_10109888
1274 Ga0307512_10182862
1275 Ga0265330_10003025
1276 Ga0265332_10030405
1277 Ga0265328_10111836
1278 Ga0265329_10132407
1279 Ga0265331_10008795
1280 Ga0265316_10487021
1281 Ga0307513_10017125
1282 Ga0307513_10195204
1283 Ga0307509_10000249
1284 Ga0307509_10003703
1285 Ga0307509_10012634
1286 Ga0307509_10074077
1287 Ga0307509_10108879
1288 Ga0307509_10375294
1289 Ga0307408_100000023
1290 Ga0307408_100015636
1291 Ga0307408_100196020
1292 Ga0307508_10004816
1293 Ga0307508_10006698
1294 Ga0307508_10216955
1295 Ga0307514_10001392
1296 Ga0307514_10075735
1297 Ga0307514_10089643
1298 Ga0307514_10141807
1299 Ga0265314_10017068
1300 Ga0265342_10049206
1301 Ga0307516_10000237
1302 Ga0307516_10000303
1303 Ga0307516_10285416
1304 Ga0307516_10332005
1305 Ga0307516_10339784
1306 Ga0307516_10433851
1307 Ga0307413_10057428
1308 Ga0307413_10168485
1309 Ga0307413_10318493
1310 Ga0307413_10423715
1311 Ga0307410_10234165
1312 Ga0307410_10439420
1313 Ga0307406_10023123
1314 Ga0307406_10984675
1315 Ga0307407_10468201
1316 Ga0307412_10027498
1317 Ga0307412_10034896
1318 Ga0307412_10100837
1319 Ga0307409_100383629
1320 Ga0307416_100014114
1321 Ga0307416_100061065
1322 Ga0307414_10240025
1323 Ga0307411_10012282
1324 Ga0307411_10016314
1325 Ga0307411_10018187
1326 Ga0307411_10026501
1327 Ga0307415_100068180
1328 Ga0307415_100116794
1329 Ga0307510_10043278
1330 Ga0307510_10072075
1331 Ga0373930_0026541
1332 Ga0373959_0010617
1333 Ga0373949_0089859
1334 Ga0373951_0064691
1335 Ga0373952_0012226
1336 Ga0373932_0018150
1337 Ga0373936_0095384
1338 Ga0373939_0000184
1339 Ga0373945_0165722
1340 Ga0373960_0069961
1341 Ga0373943_0109578
1342 Ga0373943_0416011
1343 Ga0373946_0011338
1344 Ga0373946_0068600
1345 Ga0373955_0065797
1346 Ga0373931_0000092
1347 Ga0373931_0002695
1348 Ga0373931_0009750
1349 Ga0373927_0265998
1350 Ga0373927_0678656
1351 Ga0373933_0097619
1352 Ga0373947_0230131
1353 Ga0373937_0171306
1354 Ga0373937_0180302
1355 Ga0373937_0622301
1356 Ga0373925_0050008
1357 Ga0373925_0221711
1358 Ga0373925_0263414
1359 Ga0373925_0392936
1360 Ga0395900_0245950
1361 Ga0395900_0646875
1362 Ga0395905_0000027
1363 Ga0395905_0000151
1364 Ga0395905_0014823
1365 Ga0395905_0074018
1366 Ga0395905_0417523
1367 Ga0395901_0164028
1368 Ga0436365_0757688
1369 Ga0436361_0750298
1370 Ga0451798_0362761
1371 Ga0451802_0227373
1372 Ga0451853_0566426
1373 Ga0451853_1375847
1374 Ga0451853_1931705
1375 Ga0439437_000095
1376 Ga0439455_0003524
1377 Ga0450911_000507
1378 Ga0450888_000691
1379 Ga0450891_000206
1380 Ga0450901_004084
1381 Ga0451577_0004735
1382 Ga0451577_0155936
1383 Ga0451577_0273095
1384 Ga0451577_0404222
1385 Ga0453683_0459440
1386 Ga0466965_0295094
1387 Ga0466964_0218482
1388 Ga0453684_0020128
1389 Ga0453684_0086122
1390 Ga0453684_0134244
1391 Ga0453684_0286196
1392 Ga0453684_0314661
1393 Ga0453684_0412870
1394 Ga0451576_0004667
1395 Ga0451576_0005708
1396 Ga0451576_0212037
1397 Ga0451576_0315333
1398 Ga0495592_0001883
1399 Ga0495638_0279367
1400 Ga0495650_0060731
1401 Ga0495639_0111302
1402 Ga0495610_0038724
1403 Ga0495628_0238440
1404 Ga0495630_0448757
1405 Ga0495666_0098757
1406 Ga0495642_0065027
1407 Ga0495598_0016283
1408 Ga0495621_0112088
1409 Ga0495597_0198210
1410 Ga0495633_0156073
1411 Ga0495656_0003963
1412 Ga0495656_0328626
1413 Ga0495661_0369699
1414 Ga0495599_0135816
1415 Ga0495647_0073605
1416 Ga0495658_0052347
1417 Ga0495658_0154088
1418 Ga0495658_0269335
1419 Ga0495658_0433225
1420 Ga0495669_0026101
1421 Ga0495669_0210553
1422 Ga0495624_0207403
1423 Ga0495670_0272753
1424 Ga0495671_0129216
1425 Ga0495604_0523462
1426 Ga0495636_0110523
1427 Ga0495676_0052751
1428 Ga0495675_0308281
1429 Ga0495677_0017847
1430 Ga0495685_050054
1431 Ga0495684_0260937
1432 Ga0496100_0004969
1433 Ga0496101_0020005
1434 Ga0496102_0050949
1435 Ga0496104_0207849
1436 Ga0496104_0382744
1437 Ga0496105_0152969
1438 Ga0496105_0343379
1439 Ga0496107_0003649
1440 Ga0496108_0163203
1441 Ga0496108_0256556
1442 Ga0496110_0072750
1443 Ga0496114_0168105
1444 Ga0496114_0266760
1445 Ga0496114_0322005
1446 Ga0496115_0160232
1447 Ga0496121_0494783
1448 Ga0496122_0000612
1449 Ga0496123_0000274
1450 Ga0496124_0109171
1451 Ga0501306_027319
1452 Ga0501309_000235
1453 Ga0501310_000547
1454 Ga0501304_005516
1455 Ga0501307_007500
1456 Ga0501294_004193
1457 Ga0501300_023207
1458 Ga0501301_003010
1459 Ga0501311_010619
1460 Ga0501312_018143
1461 Ga0501314_001724
1462 Ga0501315_002842
1463 Ga0501317_023975
1464 Ga0501318_016293
1465 Ga0501322_004543
1466 Ga0501323_010154
1467 Ga0501042_0775042
1468 Ga0501198_000024
1469 Ga0501199_011061
1470 Ga0501206_002409
1471 Ga0501207_053800
1472 Ga0501211_002221
1473 Ga0501222_000020
1474 Ga0501222_001970
1475 Ga0501227_018678
1476 Ga0501235_004234
1477 Ga0501236_016828
1478 Ga0501252_009169
1479 Ga0501258_000428
1480 Ga0501221_000262
1481 Ga0501229_000047
1482 Ga0501232_002169
1483 Ga0501262_005168
1484 Ga0501262_009579
1485 Ga0501267_000585
1486 nmdc:mga03683_281610_c1
1487 nmdc:mga03n38_539126_c1
1488 nmdc:mga00v17_200339_c1
1489 nmdc:mga0yw44_690162_c1
1490 nmdc:mga0k408_100269_c1
1491 nmdc:mga0k408_132241_c1
1492 nmdc:mga0k408_302_c1
1493 nmdc:mga0k408_35485_c1
1494 nmdc:mga0k408_4061_c1
1495 nmdc:mga0k408_57744_c1
1496 nmdc:mga0k408_67442_c1
1497 nmdc:mga0k408_7292_c1
1498 nmdc:mga0k408_830_c1
1499 nmdc:mga07m45_23681_c1
1500 nmdc:mga07m45_5925_c1
1501 nmdc:mga05p37_291899_c1
1502 nmdc:mga09592_1397_c1
1503 nmdc:mga0qj67_17079_c1
1504 nmdc:mga0n895_650250_c1
1505 nmdc:mga0rr50_727903_c1
1506 Ga0495601_0032063
1507 Ga0495595_0058158
1508 Ga0500578_0037319
1509 Ga0500644_0004099
1510 Ga0500651_0030909
1511 Ga0500594_0000665
1512 Ga0500652_080915
1513 Ga0500655_029846
1514 Ga0500559_0000032
1515 Ga0500564_056359
1516 Ga0500619_000006
1517 Ga0500619_009997
1518 Ga0500622_0001884
1519 Ga0500634_0010236
1520 Ga0500636_0173770
1521 Ga0500645_002942
1522 Ga0500587_012117
1523 2643743076
1524 2643932898
1525 2644218507
1526 2644260402
1527 2644301238
1528 2644314148
1529 2739055937
1530 2881103397

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05494

MlaC

MlaC protein

75

239

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qgu-assembly1.cif.gz_A three-dimensional structure of the phospholipid-binding protein from ralstonia solanacearum q8xv73_ralsq in complex with a phospholipid at the resolution 1.53 a. northeast structural genomics consortium target rsr89 0.9476 17 190
2qgu-assembly1.cif.gz_A three-dimensional structure of the phospholipid-binding protein from ralstonia solanacearum q8xv73_ralsq in complex with a phospholipid at the resolution 1.53 a. northeast structural genomics consortium target rsr89 0.917 17 190
6x04-assembly1.cif.gz_I nup133 (aa55-481) from s. cerevisiae bound by vhh-san5 0.8883 105 154
6x04-assembly1.cif.gz_G nup133 (aa55-481) from s. cerevisiae bound by vhh-san5 0.8842 105 154
6x04-assembly1.cif.gz_C nup133 (aa55-481) from s. cerevisiae bound by vhh-san5 0.8817 105 154
ID Description Score Start End Superfamily
2qguA01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9112 17 157 3.10.450.50
2qguA01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8772 17 157 3.10.450.50
af_P0ADV7_24_204_3.10.450.710 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;Tgt2/MlaC 0.8718 16 186 3.10.450.710
4fczA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;Tgt2/MlaC 0.8348 14 187 3.10.450.710
af_P0ADV7_24_204_3.10.450.710 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;Tgt2/MlaC 0.8232 16 186 3.10.450.710
ID Description Score Start End GO Terms
AF-A0A257KGL5-F1-model_v4 Toluene tolerance protein 0.9456 74 192
AF-A0A537AV23-F1-model_v4 ABC transporter substrate-binding protein 0.9408 3 191
AF-A0A2N4U5J0-F1-model_v4 ABC transporter 0.9302 5 186
AF-A0A0N0JKE2-F1-model_v4 Uncharacterized protein 0.9281 2 190
AF-A0A3P4B2E5-F1-model_v4 Putative phospholipid-binding protein MlaC 0.9253 11 182

Map