F479808

General Info

Members Datasets Scaffolds Average Seq Length
765 373 751 200

Family's Representative Sequence

Representative Sequence 3300050494|nmdc:mga06z11_34972_c1|nmdc:mga06z11_34972_c1_173_781
Length 202
Sequence MLMTDSKFYHDGNRRLQDRFESRKMADRQEKIITRTRFTDSDKSFIESARYFFLATADDKGRPDCSFKGGALGFVRVSGDSELAFPDFDGNGMFKSLGNIDINSEVGLLFIDFEKPRRLRVNGTASIRADDPLLAQTIGAQLIARVTARVIFPNCPRYIPTMNLAEESAYAPHAGRDFPEPAWKSFPEFADAVHPRQPTFKG

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
3 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
4 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
5 2791355199
6 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
7 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
8 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
9 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
10 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
124 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
183 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
184 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
185 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
186 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
187 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
190 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
191 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
200 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
201 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
202 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
205 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
206 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
207 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
210 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
218 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
219 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
220 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
221 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
222 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
223 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
224 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
225 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
226 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
227 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
228 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
229 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
230 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
231 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
232 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
233 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
235 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
236 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
237 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
238 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
239 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
240 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
241 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
242 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
243 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
244 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
245 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
246 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
247 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
248 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
251 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
252 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
253 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
254 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
255 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
256 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
257 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
258 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
259 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
260 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
261 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
262 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
263 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
264 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
265 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
266 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
267 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
268 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
269 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
270 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
271 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
272 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
273 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
274 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
275 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
276 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
277 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
278 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
279 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
280 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
281 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
282 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
283 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
284 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
285 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
286 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
287 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
290 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
291 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
292 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
296 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
297 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
298 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
299 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
300 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
301 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
302 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
303 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
304 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
305 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
306 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
307 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
308 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
320 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
321 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
322 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
323 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
324 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
325 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
326 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
327 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
328 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
329 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
330 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
332 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
333 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
334 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
335 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
336 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
337 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
338 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
339 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
340 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
341 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
342 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
343 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
344 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
345 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
346 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
347 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
348 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
349 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
350 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
351 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
352 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
353 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
354 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
355 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
356 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
357 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
358 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
359 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
360 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
361 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
362 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
363 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
364 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
365 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
366 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
367 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
368 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
369 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
370 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
371 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
372 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
373 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.17
Metatranscriptomes 0.13
Isolates 1.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.63
Nodule 1.18
Rhizoplane 8.24
Rhizosphere 77.12
Stem 0
Stem Tuber 0
Unclassified 4.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_FSXC51428_g1 2010549000 Bacteria 785
2 JGI25406J46586_10052595 3300003203 Bacteria 1356
3 JGI25404J52841_10002782 3300003659 Bacteria 3369
4 JGI25404J52841_10046768 3300003659 Bacteria 912
5 JGI25405J52794_10016817 3300003911 Bacteria 1447
6 JGI25405J52794_10023307 3300003911 Bacteria 1259
7 Ga0065714_10237102 3300005288 Bacteria 803
8 Ga0065704_10140531 3300005289 Bacteria 1522
9 Ga0065712_10175080 3300005290 Bacteria 1222
10 Ga0065715_10120354 3300005293 Bacteria 2260
11 Ga0070683_100053329 3300005329 Bacteria 3747
12 Ga0070683_100415541 3300005329 Unclassified 1283
13 Ga0070683_100660189 3300005329 Unclassified 1001
14 Ga0070690_100002833 3300005330 Bacteria 9352
15 Ga0070670_100126286 3300005331 Bacteria 2208
16 Ga0068869_100030484 3300005334 Bacteria 3786
17 Ga0068869_100034418 3300005334 Bacteria 3583
18 Ga0068869_100088480 3300005334 Bacteria 2324
19 Ga0068869_100471785 3300005334 Bacteria 1043
20 Ga0070666_10012049 3300005335 Bacteria 5444
21 Ga0070666_10259335 3300005335 Bacteria 1232
22 Ga0070680_100027574 3300005336 Bacteria 4548
23 Ga0070682_100613571 3300005337 Bacteria 861
24 Ga0068868_100021301 3300005338 Bacteria 4882
25 Ga0068868_100149682 3300005338 Bacteria 1921
26 Ga0068868_100405084 3300005338 Bacteria 1178
27 Ga0068868_100473338 3300005338 Bacteria 1093
28 Ga0070689_100021328 3300005340 Bacteria 4822
29 Ga0070689_100804630 3300005340 Bacteria 827
30 Ga0070687_100285783 3300005343 Bacteria 1040
31 Ga0070687_100348957 3300005343 Unclassified 954
32 Ga0070661_100236318 3300005344 Bacteria 1406
33 Ga0070661_100324465 3300005344 Bacteria 1203
34 Ga0070668_100092246 3300005347 Bacteria 2388
35 Ga0070668_100294907 3300005347 Bacteria 1358
36 Ga0070668_100320161 3300005347 Bacteria 1305
37 Ga0070668_100613835 3300005347 Bacteria 953
38 Ga0070669_100194042 3300005353 Bacteria 1594
39 Ga0070669_100420547 3300005353 Bacteria 1097
40 Ga0070675_100005627 3300005354 Bacteria 9594
41 Ga0070675_100436575 3300005354 Bacteria 1173
42 Ga0070675_100458952 3300005354 Bacteria 1143
43 Ga0070671_100026147 3300005355 Bacteria 4795
44 Ga0070671_100027269 3300005355 Bacteria 4699
45 Ga0070671_101128349 3300005355 Bacteria 689
46 Ga0070688_100270038 3300005365 Bacteria 1218
47 Ga0070667_100002110 3300005367 Bacteria 17526
48 Ga0070667_100292316 3300005367 Bacteria 1465
49 Ga0070667_100340826 3300005367 Bacteria 1356
50 Ga0070713_100009110 3300005436 Bacteria 7080
51 Ga0070701_10386107 3300005438 Bacteria 884
52 Ga0070711_100617199 3300005439 Unclassified 906
53 Ga0070700_100280686 3300005441 Bacteria 1207
54 Ga0070700_100320937 3300005441 Bacteria 1138
55 Ga0070694_100015646 3300005444 Bacteria 4767
56 Ga0070694_100230989 3300005444 Bacteria 1392
57 Ga0070663_100000663 3300005455 Bacteria 18514
58 Ga0070663_100027475 3300005455 Bacteria 3865
59 Ga0070663_100126626 3300005455 Bacteria 1935
60 Ga0070663_100206539 3300005455 Bacteria 1536
61 Ga0070678_100006375 3300005456 Bacteria 6923
62 Ga0070678_100007982 3300005456 Bacteria 6309
63 Ga0070678_100223344 3300005456 Bacteria 1567
64 Ga0070662_100036998 3300005457 Bacteria 3458
65 Ga0070662_100084095 3300005457 Bacteria 2376
66 Ga0070662_100562287 3300005457 Bacteria 957
67 Ga0070681_10087171 3300005458 Bacteria 3075
68 Ga0070681_10411824 3300005458 Bacteria 1263
69 Ga0068867_100141596 3300005459 Bacteria 1880
70 Ga0068867_100186927 3300005459 Bacteria 1651
71 Ga0070685_10084517 3300005466 Bacteria 1909
72 Ga0070685_10331330 3300005466 Bacteria 1035
73 Ga0070706_101040308 3300005467 Bacteria 755
74 Ga0070707_100068164 3300005468 Bacteria 3424
75 Ga0070698_100150659 3300005471 Bacteria 2274
76 Ga0070699_100152211 3300005518 Bacteria 2046
77 Ga0070679_100093183 3300005530 Bacteria 3000
78 Ga0070679_100175359 3300005530 Bacteria 2116
79 Ga0070684_100123045 3300005535 Bacteria 2335
80 Ga0070684_100287374 3300005535 Bacteria 1507
81 Ga0070684_100423553 3300005535 Bacteria 1229
82 Ga0068853_100040290 3300005539 Bacteria 3986
83 Ga0070672_100107034 3300005543 Bacteria 2275
84 Ga0070672_100245803 3300005543 Bacteria 1506
85 Ga0070672_100358104 3300005543 Bacteria 1245
86 Ga0070686_100353989 3300005544 Bacteria 1104
87 Ga0070686_100412334 3300005544 Bacteria 1030
88 Ga0070695_100827146 3300005545 Bacteria 744
89 Ga0070696_100110763 3300005546 Bacteria 1977
90 Ga0070693_100045221 3300005547 Bacteria 2494
91 Ga0070693_100694159 3300005547 Unclassified 744
92 Ga0070665_100003746 3300005548 Bacteria 16097
93 Ga0070665_100005052 3300005548 Bacteria 13691
94 Ga0070665_100013563 3300005548 Bacteria 8199
95 Ga0070665_100021610 3300005548 Bacteria 6470
96 Ga0070665_100058396 3300005548 Bacteria 3868
97 Ga0070665_100166352 3300005548 Bacteria 2207
98 Ga0070665_100576060 3300005548 Bacteria 1138
99 Ga0070665_101268858 3300005548 Bacteria 747
100 Ga0070704_100745055 3300005549 Bacteria 872
101 Ga0068855_100115683 3300005563 Bacteria 3074
102 Ga0068855_100180870 3300005563 Bacteria 2384
103 Ga0068855_100247630 3300005563 Bacteria 1989
104 Ga0068855_100571795 3300005563 Bacteria 1221
105 Ga0068855_100710466 3300005563 Bacteria 1075
106 Ga0070664_100686855 3300005564 Bacteria 953
107 Ga0070664_100793366 3300005564 Bacteria 885
108 Ga0070664_100825307 3300005564 Bacteria 868
109 Ga0068857_100458960 3300005577 Bacteria 1192
110 Ga0068854_100981029 3300005578 Bacteria 747
111 Ga0068856_100014477 3300005614 Bacteria 7618
112 Ga0068856_100560696 3300005614 Bacteria 1164
113 Ga0068852_100015964 3300005616 Bacteria 5845
114 Ga0068852_100061095 3300005616 Bacteria 3274
115 Ga0068852_100176258 3300005616 Bacteria 2008
116 Ga0068852_100501466 3300005616 Bacteria 1209
117 Ga0068859_100032269 3300005617 Bacteria 5261
118 Ga0068859_100051481 3300005617 Bacteria 4139
119 Ga0068859_100275026 3300005617 Bacteria 1776
120 Ga0068859_100565676 3300005617 Bacteria 1231
121 Ga0068859_101200343 3300005617 Bacteria 836
122 Ga0068864_100015563 3300005618 Bacteria 6326
123 Ga0068864_100073770 3300005618 Bacteria 2975
124 Ga0068864_100258536 3300005618 Bacteria 1619
125 Ga0068864_100411786 3300005618 Bacteria 1286
126 Ga0068861_100026034 3300005719 Bacteria 4248
127 Ga0068861_100143367 3300005719 Bacteria 1952
128 Ga0068861_100250239 3300005719 Bacteria 1511
129 Ga0068861_100439447 3300005719 Bacteria 1166
130 Ga0068861_100885039 3300005719 Bacteria 844
131 Ga0068851_10013989 3300005834 Bacteria 3803
132 Ga0068870_10078086 3300005840 Bacteria 1823
133 Ga0068870_10095281 3300005840 Bacteria 1672
134 Ga0068870_10145875 3300005840 Bacteria 1389
135 Ga0068863_100005866 3300005841 Bacteria 12031
136 Ga0068863_100515556 3300005841 Bacteria 1178
137 Ga0068863_100796310 3300005841 Bacteria 943
138 Ga0068858_100000211 3300005842 Bacteria 63065
139 Ga0068858_100070599 3300005842 Bacteria 3237
140 Ga0068860_100011349 3300005843 Bacteria 8779
141 Ga0068860_100094666 3300005843 Bacteria 2847
142 Ga0068860_100423660 3300005843 Bacteria 1320
143 Ga0068860_100460289 3300005843 Bacteria 1266
144 Ga0068860_100501587 3300005843 Bacteria 1212
145 Ga0068860_100738025 3300005843 Bacteria 996
146 Ga0068862_100040067 3300005844 Bacteria 3981
147 Ga0068862_100107140 3300005844 Bacteria 2450
148 Ga0068862_100180060 3300005844 Bacteria 1896
149 Ga0081455_10003425 3300005937 Bacteria 18237
150 Ga0081455_10006252 3300005937 Bacteria 12820
151 Ga0081455_10009461 3300005937 Bacteria 10024
152 Ga0081455_10024092 3300005937 Bacteria 5646
153 Ga0081455_10048280 3300005937 Bacteria 3680
154 Ga0081455_10070721 3300005937 Bacteria 2896
155 Ga0081455_10071950 3300005937 Bacteria 2865
156 Ga0081540_1002589 3300005983 Bacteria 14689
157 Ga0081540_1003572 3300005983 Bacteria 12223
158 Ga0081540_1006855 3300005983 Bacteria 8223
159 Ga0081540_1011161 3300005983 Bacteria 6029
160 Ga0081540_1026873 3300005983 Bacteria 3275
161 Ga0081539_10002583 3300005985 Bacteria 24993
162 Ga0081539_10018896 3300005985 Bacteria 4748
163 Ga0075365_10055643 3300006038 Bacteria 2627
164 Ga0075365_10092443 3300006038 Bacteria 2062
165 Ga0075365_10189150 3300006038 Bacteria 1440
166 Ga0075365_10479373 3300006038 Bacteria 879
167 Ga0075368_10051984 3300006042 Bacteria 1629
168 Ga0075363_100004914 3300006048 Bacteria 5910
169 Ga0075363_100028673 3300006048 Bacteria 2866
170 Ga0075363_100222221 3300006048 Bacteria 1083
171 Ga0070716_100128067 3300006173 Bacteria 1600
172 Ga0070712_100138063 3300006175 Bacteria 1856
173 Ga0075362_10207489 3300006177 Bacteria 955
174 Ga0075367_10094859 3300006178 Bacteria 1819
175 Ga0075367_10157099 3300006178 Bacteria 1413
176 Ga0075367_10180627 3300006178 Bacteria 1315
177 Ga0075367_10708293 3300006178 Bacteria 640
178 Ga0075369_10004778 3300006186 Bacteria 5035
179 Ga0075366_10109826 3300006195 Bacteria 1658
180 Ga0097621_100110397 3300006237 Bacteria 2323
181 Ga0097621_100143301 3300006237 Bacteria 2043
182 Ga0075370_10002046 3300006353 Bacteria 9161
183 Ga0075370_10008551 3300006353 Bacteria 5274
184 Ga0075370_10020184 3300006353 Bacteria 3638
185 Ga0068871_100024943 3300006358 Bacteria 4645
186 Ga0068871_100475191 3300006358 Bacteria 1124
187 Ga0075428_100092094 3300006844 Bacteria 3305
188 Ga0075433_10384723 3300006852 Bacteria 1238
189 Ga0075434_100003708 3300006871 Bacteria 13645
190 Ga0075434_100128231 3300006871 Bacteria 2554
191 Ga0097620_100032269 3300006931 Bacteria 5261
192 Ga0097620_100051481 3300006931 Bacteria 4139
193 Ga0097620_100275013 3300006931 Bacteria 1776
194 Ga0097620_100565678 3300006931 Bacteria 1231
195 Ga0097620_101200356 3300006931 Bacteria 836
196 Ga0075435_100207898 3300007076 Bacteria 1659
197 Ga0075435_100215375 3300007076 Bacteria 1630
198 Ga0105250_10016274 3300009092 Bacteria 3033
199 Ga0105240_10153104 3300009093 Bacteria 2745
200 Ga0105240_10198229 3300009093 Bacteria 2355
201 Ga0105240_10224340 3300009093 Bacteria 2187
202 Ga0105240_10444344 3300009093 Bacteria 1452
203 Ga0105240_11452491 3300009093 Unclassified 720
204 Ga0105247_10267963 3300009101 Bacteria 1173
205 Ga0114129_10264694 3300009147 Bacteria 2302
206 Ga0105243_10201681 3300009148 Bacteria 1745
207 Ga0105241_10221598 3300009174 Bacteria 1590
208 Ga0105241_10474542 3300009174 Bacteria 1111
209 Ga0105242_10714652 3300009176 Bacteria 982
210 Ga0105248_10088569 3300009177 Bacteria 3484
211 Ga0105248_10102374 3300009177 Bacteria 3228
212 Ga0105248_10389701 3300009177 Bacteria 1569
213 Ga0105248_10569824 3300009177 Bacteria 1277
214 Ga0105237_10068817 3300009545 Bacteria 3534
215 Ga0105237_10171890 3300009545 Bacteria 2167
216 Ga0105237_10394184 3300009545 Bacteria 1389
217 Ga0105237_10761259 3300009545 Bacteria 975
218 Ga0105237_10775764 3300009545 Bacteria 965
219 Ga0105238_10017485 3300009551 Bacteria 7290
220 Ga0105238_10229451 3300009551 Bacteria 1833
221 Ga0105249_10133162 3300009553 Bacteria 2375
222 Ga0105249_10169566 3300009553 Bacteria 2116
223 Ga0105249_10219019 3300009553 Bacteria 1872
224 Ga0105239_10047197 3300010375 Bacteria 4720
225 Ga0105239_10133341 3300010375 Bacteria 2764
226 Ga0105239_10215187 3300010375 Bacteria 2154
227 Ga0105239_10302971 3300010375 Bacteria 1800
228 Ga0105239_10362312 3300010375 Bacteria 1637
229 Ga0105246_10326682 3300011119 Bacteria 1249
230 Ga0157373_10290412 3300013100 Bacteria 1160
231 Ga0157369_10516107 3300013105 Bacteria 1236
232 Ga0157369_10540521 3300013105 Unclassified 1205
233 Ga0157374_10004632 3300013296 Bacteria 11535
234 Ga0157374_10149275 3300013296 Bacteria 2272
235 Ga0157378_10031169 3300013297 Bacteria 4710
236 Ga0157378_10059250 3300013297 Bacteria 3416
237 Ga0157378_10792627 3300013297 Bacteria 973
238 Ga0157378_10981845 3300013297 Bacteria 878
239 Ga0163162_10015806 3300013306 Bacteria 7375
240 Ga0163162_10186822 3300013306 Bacteria 2199
241 Ga0163162_10217359 3300013306 Bacteria 2041
242 Ga0163162_10334057 3300013306 Bacteria 1648
243 Ga0163162_10410185 3300013306 Bacteria 1487
244 Ga0163162_10870477 3300013306 Unclassified 1015
245 Ga0157372_10199994 3300013307 Bacteria 2314
246 Ga0157372_11767797 3300013307 Bacteria 711
247 Ga0157375_10184239 3300013308 Bacteria 2240
248 Ga0157375_10423925 3300013308 Bacteria 1496
249 Ga0157375_10480094 3300013308 Bacteria 1408
250 Ga0163163_10002661 3300014325 Bacteria 15120
251 Ga0163163_10044505 3300014325 Bacteria 4355
252 Ga0163163_10069006 3300014325 Bacteria 3519
253 Ga0163163_10733183 3300014325 Bacteria 1052
254 Ga0163163_10751419 3300014325 Bacteria 1039
255 Ga0157380_10268008 3300014326 Bacteria 1555
256 Ga0157380_10313916 3300014326 Bacteria 1450
257 Ga0157380_10475524 3300014326 Bacteria 1207
258 Ga0157380_10803615 3300014326 Bacteria 958
259 Ga0157380_10929236 3300014326 Bacteria 898
260 Ga0157380_11531070 3300014326 Bacteria 721
261 Ga0157379_10033950 3300014968 Bacteria 4548
262 Ga0157379_10050930 3300014968 Bacteria 3697
263 Ga0157379_10153593 3300014968 Bacteria 2076
264 Ga0157379_10793632 3300014968 Bacteria 893
265 Ga0157376_10142716 3300014969 Bacteria 2150
266 Ga0157376_10166202 3300014969 Bacteria 2005
267 Ga0157376_10280747 3300014969 Unclassified 1568
268 Ga0163161_10074398 3300017792 Bacteria 2491
269 Ga0163161_10330622 3300017792 Bacteria 1207
270 Ga0163161_10372823 3300017792 Bacteria 1139
271 Ga0206356_11851354 3300020070 Bacteria 830
272 Ga0213876_10111656 3300021384 Unclassified 1451
273 Ga0209758_1004341 3300025297 Bacteria 11878
274 Ga0207426_1029550 3300025302 Bacteria 1805
275 Ga0207696_1022535 3300025711 Bacteria 2000
276 Ga0207682_10058557 3300025893 Bacteria 1608
277 Ga0207682_10119786 3300025893 Bacteria 1166
278 Ga0207710_10358433 3300025900 Bacteria 744
279 Ga0207688_10027816 3300025901 Bacteria 3110
280 Ga0207680_10005653 3300025903 Bacteria 5982
281 Ga0207680_10405432 3300025903 Bacteria 964
282 Ga0207647_10157200 3300025904 Bacteria 1327
283 Ga0207699_10084532 3300025906 Bacteria 1977
284 Ga0207643_10058362 3300025908 Bacteria 2199
285 Ga0207643_10060125 3300025908 Bacteria 2169
286 Ga0207643_10174637 3300025908 Bacteria 1298
287 Ga0207654_10008634 3300025911 Bacteria 5163
288 Ga0207707_10001660 3300025912 Bacteria 20546
289 Ga0207707_10015879 3300025912 Bacteria 6567
290 Ga0207707_10076954 3300025912 Bacteria 2912
291 Ga0207707_10394135 3300025912 Bacteria 1189
292 Ga0207707_10597119 3300025912 Unclassified 935
293 Ga0207695_10151168 3300025913 Bacteria 2261
294 Ga0207695_10332619 3300025913 Bacteria 1407
295 Ga0207695_10340514 3300025913 Unclassified 1387
296 Ga0207671_10216444 3300025914 Bacteria 1500
297 Ga0207671_10599692 3300025914 Bacteria 878
298 Ga0207693_10205926 3300025915 Bacteria 1547
299 Ga0207663_10550677 3300025916 Unclassified 902
300 Ga0207660_10218833 3300025917 Bacteria 1494
301 Ga0207662_10115789 3300025918 Bacteria 1676
302 Ga0207652_10010980 3300025921 Bacteria 7302
303 Ga0207652_10032578 3300025921 Bacteria 4383
304 Ga0207646_10129621 3300025922 Bacteria 2270
305 Ga0207681_10129706 3300025923 Bacteria 1862
306 Ga0207681_10156311 3300025923 Bacteria 1714
307 Ga0207681_10350734 3300025923 Bacteria 1181
308 Ga0207681_10595574 3300025923 Bacteria 913
309 Ga0207694_10095565 3300025924 Bacteria 2349
310 Ga0207694_10159873 3300025924 Bacteria 1819
311 Ga0207694_10211011 3300025924 Bacteria 1582
312 Ga0207694_10441783 3300025924 Bacteria 1085
313 Ga0207694_10808162 3300025924 Bacteria 792
314 Ga0207650_10103167 3300025925 Bacteria 2198
315 Ga0207650_10468774 3300025925 Bacteria 1050
316 Ga0207659_10002563 3300025926 Bacteria 10813
317 Ga0207700_10418202 3300025928 Bacteria 1177
318 Ga0207644_10088712 3300025931 Bacteria 2301
319 Ga0207644_10089818 3300025931 Bacteria 2287
320 Ga0207644_10287175 3300025931 Bacteria 1322
321 Ga0207644_10818499 3300025931 Bacteria 779
322 Ga0207706_10026350 3300025933 Bacteria 5204
323 Ga0207706_10091005 3300025933 Bacteria 2682
324 Ga0207706_10271770 3300025933 Bacteria 1479
325 Ga0207686_10143974 3300025934 Bacteria 1651
326 Ga0207686_10311154 3300025934 Bacteria 1173
327 Ga0207709_10058106 3300025935 Bacteria 2402
328 Ga0207670_10024373 3300025936 Bacteria 3781
329 Ga0207704_10081930 3300025938 Bacteria 2089
330 Ga0207704_10583100 3300025938 Bacteria 913
331 Ga0207665_10657500 3300025939 Bacteria 822
332 Ga0207691_10017874 3300025940 Bacteria 6719
333 Ga0207711_10006607 3300025941 Bacteria 9769
334 Ga0207711_10182111 3300025941 Bacteria 1911
335 Ga0207711_10289267 3300025941 Bacteria 1510
336 Ga0207689_10035700 3300025942 Bacteria 4129
337 Ga0207689_10043430 3300025942 Bacteria 3716
338 Ga0207689_10045810 3300025942 Bacteria 3616
339 Ga0207689_10089402 3300025942 Bacteria 2530
340 Ga0207661_10002756 3300025944 Bacteria 12095
341 Ga0207661_10462469 3300025944 Bacteria 1156
342 Ga0207679_10124908 3300025945 Bacteria 2055
343 Ga0207679_10296276 3300025945 Bacteria 1392
344 Ga0207679_10718905 3300025945 Bacteria 907
345 Ga0207667_10088183 3300025949 Bacteria 3209
346 Ga0207667_10205767 3300025949 Bacteria 2018
347 Ga0207667_10423973 3300025949 Bacteria 1353
348 Ga0207667_10878329 3300025949 Bacteria 890
349 Ga0207651_10000121 3300025960 Bacteria 33342
350 Ga0207651_10240513 3300025960 Bacteria 1475
351 Ga0207712_10194454 3300025961 Bacteria 1603
352 Ga0207712_10217730 3300025961 Bacteria 1525
353 Ga0207712_10486238 3300025961 Bacteria 1053
354 Ga0207668_10022231 3300025972 Bacteria 4056
355 Ga0207668_10058829 3300025972 Bacteria 2688
356 Ga0207668_10100477 3300025972 Bacteria 2148
357 Ga0207668_10240126 3300025972 Bacteria 1465
358 Ga0207640_10113733 3300025981 Bacteria 1924
359 Ga0207658_10000984 3300025986 Bacteria 23515
360 Ga0207658_10181495 3300025986 Bacteria 1742
361 Ga0207658_10572006 3300025986 Bacteria 1013
362 Ga0207677_10055045 3300026023 Bacteria 2718
363 Ga0207677_10215138 3300026023 Bacteria 1538
364 Ga0207677_10854007 3300026023 Bacteria 818
365 Ga0207703_10002258 3300026035 Bacteria 16841
366 Ga0207703_10023501 3300026035 Bacteria 4843
367 Ga0207703_10102794 3300026035 Bacteria 2425
368 Ga0207703_10141311 3300026035 Bacteria 2090
369 Ga0207703_10530675 3300026035 Bacteria 1108
370 Ga0207703_10660512 3300026035 Bacteria 992
371 Ga0207639_10180677 3300026041 Bacteria 1794
372 Ga0207639_10183016 3300026041 Unclassified 1784
373 Ga0207678_10002185 3300026067 Bacteria 17669
374 Ga0207678_10088427 3300026067 Bacteria 2648
375 Ga0207678_10091352 3300026067 Bacteria 2602
376 Ga0207678_10157606 3300026067 Bacteria 1938
377 Ga0207678_10236692 3300026067 Bacteria 1564
378 Ga0207708_10224149 3300026075 Bacteria 1507
379 Ga0207708_10386140 3300026075 Bacteria 1155
380 Ga0207702_10225436 3300026078 Bacteria 1748
381 Ga0207641_10002109 3300026088 Bacteria 18804
382 Ga0207641_10232595 3300026088 Bacteria 1714
383 Ga0207641_11078432 3300026088 Unclassified 801
384 Ga0207648_10096093 3300026089 Bacteria 2593
385 Ga0207648_11409865 3300026089 Bacteria 655
386 Ga0207676_10000749 3300026095 Bacteria 25458
387 Ga0207676_10057588 3300026095 Bacteria 3061
388 Ga0207676_10235579 3300026095 Bacteria 1639
389 Ga0207674_10444670 3300026116 Bacteria 1253
390 Ga0207674_10750387 3300026116 Bacteria 942
391 Ga0207675_100030553 3300026118 Bacteria 5019
392 Ga0207675_100041965 3300026118 Bacteria 4271
393 Ga0207675_100236907 3300026118 Bacteria 1762
394 Ga0207683_10009422 3300026121 Bacteria 8322
395 Ga0207683_10623100 3300026121 Bacteria 999
396 Ga0207698_10014518 3300026142 Bacteria 5240
397 Ga0209813_10003825 3300027866 Bacteria 3557
398 Ga0268266_10000519 3300028379 Bacteria 54346
399 Ga0268266_10002731 3300028379 Bacteria 18479
400 Ga0268266_10007858 3300028379 Bacteria 9554
401 Ga0268266_10026561 3300028379 Bacteria 4927
402 Ga0268266_10074305 3300028379 Bacteria 2951
403 Ga0268266_10086191 3300028379 Bacteria 2745
404 Ga0268265_10053362 3300028380 Bacteria 3062
405 Ga0268265_10053798 3300028380 Bacteria 3051
406 Ga0268265_10100132 3300028380 Bacteria 2338
407 Ga0268265_10132120 3300028380 Bacteria 2076
408 Ga0268264_10070247 3300028381 Bacteria 2964
409 Ga0268264_10454260 3300028381 Bacteria 1242
410 Ga0307517_10060854 3300028786 Bacteria 3584
411 Ga0307517_10141324 3300028786 Bacteria 1689
412 Ga0307515_10427340 3300028794 Bacteria 944
413 Ga0265325_10000019 3300031241 Bacteria 125265
414 Ga0265339_10078259 3300031249 Bacteria 1751
415 Ga0307513_10209969 3300031456 Bacteria 1779
416 Ga0307513_10505722 3300031456 Bacteria 925
417 Ga0307509_10480983 3300031507 Bacteria 930
418 Ga0307408_100058770 3300031548 Bacteria 2797
419 Ga0307408_100067665 3300031548 Bacteria 2628
420 Ga0307408_100467751 3300031548 Bacteria 1097
421 Ga0265313_10009150 3300031595 Bacteria 6464
422 Ga0307508_10168165 3300031616 Bacteria 1796
423 Ga0307516_10608618 3300031730 Bacteria 747
424 Ga0307405_10134132 3300031731 Bacteria 1716
425 Ga0307406_10140897 3300031901 Bacteria 1707
426 Ga0307406_10286014 3300031901 Bacteria 1260
427 Ga0307412_10156211 3300031911 Bacteria 1689
428 Ga0307409_100938726 3300031995 Bacteria 880
429 Ga0307409_101182771 3300031995 Bacteria 788
430 Ga0307416_100038819 3300032002 Bacteria 3678
431 Ga0307416_100104574 3300032002 Bacteria 2475
432 Ga0307411_10594902 3300032005 Bacteria 950
433 Ga0307411_10878037 3300032005 Bacteria 795
434 Ga0307415_100230503 3300032126 Bacteria 1491
435 Ga0307510_10021151 3300033180 Bacteria 7586
436 Ga0373930_0026998 3300034816 Bacteria 1161
437 Ga0373926_0079621 3300035083 Bacteria 1210
438 Ga0373923_0042926 3300035111 Bacteria 1869
439 Ga0373936_0007126 3300035113 Bacteria 4207
440 Ga0373941_0000361 3300035115 Bacteria 9003
441 Ga0373953_0040133 3300035117 Bacteria 1858
442 Ga0373956_0055632 3300035119 Bacteria 1785
443 Ga0373957_0041614 3300035120 Bacteria 1731
444 Ga0373943_0019457 3300035170 Bacteria 3123
445 Ga0373943_0484986 3300035170 Bacteria 721
446 Ga0373955_0023658 3300035172 Bacteria 3132
447 Ga0373962_0150191 3300035242 Bacteria 762
448 Ga0373935_0277950 3300035692 Bacteria 1178
449 Ga0373927_0120591 3300035695 Bacteria 1711
450 Ga0373927_0302583 3300035695 Bacteria 1052
451 Ga0373927_0304961 3300035695 Bacteria 1048
452 Ga0373933_0103308 3300035724 Bacteria 1770
453 Ga0373947_0014281 3300035725 Bacteria 4555
454 Ga0395905_0814024 3300037471 Bacteria 837
455 Ga0436365_0014507 3300039437 Bacteria 1966
456 Ga0436365_0045752 3300039437 Bacteria 1501
457 Ga0436365_0545826 3300039437 Unclassified 1882
458 Ga0451787_018577 3300041441 Bacteria 937
459 Ga0451791_1804937 3300041451 Bacteria 1315
460 Ga0451793_1582537 3300041452 Bacteria 953
461 Ga0451802_0401890 3300041460 Bacteria 1370
462 Ga0451833_1416861 3300041491 Bacteria 879
463 Ga0439445_0064161 3300042004 Bacteria 1008
464 Ga0466964_0078768 3300044706 Bacteria 1410
465 Ga0466968_0240140 3300044735 Bacteria 858
466 Ga0466960_0030018 3300044901 Bacteria 2500
467 Ga0466967_0156569 3300045976 Bacteria 2135
468 Ga0466967_0449259 3300045976 Bacteria 1259
469 Ga0495617_003959 3300046452 Bacteria 5451
470 Ga0495592_0123300 3300046454 Bacteria 1821
471 Ga0495603_0081307 3300046455 Bacteria 1898
472 Ga0495590_0024119 3300046457 Bacteria 2144
473 Ga0495590_0133332 3300046457 Bacteria 894
474 Ga0495629_0180734 3300046459 Bacteria 1462
475 Ga0495638_0063518 3300046460 Bacteria 2276
476 Ga0495638_0084450 3300046460 Bacteria 1921
477 Ga0495638_0240574 3300046460 Bacteria 1002
478 Ga0495641_0248538 3300046461 Bacteria 799
479 Ga0495580_0013708 3300046472 Bacteria 6175
480 Ga0495580_0091517 3300046472 Bacteria 2117
481 Ga0495582_0006519 3300046473 Bacteria 6478
482 Ga0495582_0377851 3300046473 Bacteria 816
483 Ga0495639_0020308 3300046475 Bacteria 2903
484 Ga0495664_0029189 3300046477 Bacteria 3224
485 Ga0495584_0075589 3300046491 Bacteria 1694
486 Ga0495584_0163924 3300046491 Bacteria 1130
487 Ga0495584_0166094 3300046491 Bacteria 1122
488 Ga0495584_0223075 3300046491 Bacteria 958
489 Ga0495585_0020146 3300046492 Bacteria 3838
490 Ga0495585_0046373 3300046492 Bacteria 2424
491 Ga0495585_0240730 3300046492 Bacteria 906
492 Ga0495594_0138672 3300046499 Bacteria 1379
493 Ga0495594_0506421 3300046499 Bacteria 686
494 Ga0495620_0063470 3300046515 Bacteria 1531
495 Ga0495630_0119700 3300046517 Bacteria 1997
496 Ga0495631_0295888 3300046518 Bacteria 689
497 Ga0495632_0097215 3300046519 Bacteria 1390
498 Ga0495632_0138796 3300046519 Bacteria 1128
499 Ga0495644_0085306 3300046523 Bacteria 1190
500 Ga0495644_0150758 3300046523 Bacteria 890
501 Ga0495648_0124300 3300046524 Bacteria 1381
502 Ga0495666_0038861 3300046526 Bacteria 2313
503 Ga0495642_0098596 3300046528 Bacteria 1242
504 Ga0495652_0416821 3300046529 Bacteria 947
505 Ga0495654_0080369 3300046530 Bacteria 1530
506 Ga0495665_0016908 3300046531 Bacteria 3926
507 Ga0495665_0423981 3300046531 Bacteria 674
508 Ga0495640_0217704 3300046533 Bacteria 1205
509 Ga0495598_0002622 3300046537 Bacteria 3722
510 Ga0495609_0227615 3300046538 Bacteria 773
511 Ga0495621_0103155 3300046539 Bacteria 1087
512 Ga0495645_0113695 3300046543 Bacteria 1914
513 Ga0495622_0043851 3300046557 Bacteria 2079
514 Ga0495622_0182444 3300046557 Bacteria 941
515 Ga0495633_0126629 3300046558 Bacteria 1182
516 Ga0495656_0000977 3300046615 Bacteria 9259
517 Ga0495668_0110188 3300046616 Bacteria 1506
518 Ga0495668_0135783 3300046616 Bacteria 1346
519 Ga0495668_0148631 3300046616 Bacteria 1283
520 Ga0495668_0368834 3300046616 Bacteria 788
521 Ga0495634_0059476 3300046642 Bacteria 2545
522 Ga0495611_0066551 3300046648 Bacteria 1643
523 Ga0495625_0072881 3300046660 Bacteria 2408
524 Ga0495625_0149424 3300046660 Bacteria 1571
525 Ga0495625_0455874 3300046660 Bacteria 789
526 Ga0495588_0006542 3300046674 Bacteria 5255
527 Ga0495623_0460415 3300046679 Bacteria 676
528 Ga0495646_0057485 3300046680 Bacteria 2328
529 Ga0495647_0077745 3300046681 Bacteria 1340
530 Ga0495658_0265998 3300046683 Bacteria 1080
531 Ga0495613_0060056 3300046689 Bacteria 2786
532 Ga0495624_0024501 3300046690 Bacteria 3970
533 Ga0495670_0101018 3300046691 Bacteria 1485
534 Ga0495589_0380027 3300046794 Bacteria 649
535 Ga0495660_0200610 3300046810 Bacteria 953
536 Ga0495581_0009697 3300047315 Bacteria 5574
537 Ga0495581_0425594 3300047315 Bacteria 774
538 Ga0495636_0024287 3300047318 Bacteria 2457
539 Ga0495674_0006663 3300047319 Bacteria 11066
540 Ga0495676_0061833 3300047321 Bacteria 2927
541 Ga0495676_0355225 3300047321 Bacteria 979
542 Ga0495683_0056095 3300047323 Bacteria 1960
543 Ga0495683_0151357 3300047323 Bacteria 1080
544 Ga0495677_0069383 3300047445 Bacteria 1313
545 Ga0495673_0097114 3300047469 Bacteria 1196
546 Ga0495673_0102314 3300047469 Bacteria 1156
547 Ga0495684_0056700 3300047471 Bacteria 2986
548 Ga0495593_0054390 3300047673 Bacteria 2110
549 Ga0495602_0638478 3300048088 Bacteria 728
550 Ga0495626_0248536 3300048091 Bacteria 714
551 Ga0496100_0088762 3300048903 Bacteria 2105
552 Ga0496101_0035125 3300048904 Bacteria 3545
553 Ga0496101_0066897 3300048904 Bacteria 2622
554 Ga0496101_0187069 3300048904 Bacteria 1597
555 Ga0496102_0097203 3300048905 Bacteria 2731
556 Ga0496102_0201748 3300048905 Bacteria 1875
557 Ga0496102_0216857 3300048905 Bacteria 1804
558 Ga0496102_0255196 3300048905 Bacteria 1653
559 Ga0496102_0413524 3300048905 Bacteria 1267
560 Ga0496102_0785450 3300048905 Bacteria 875
561 Ga0496104_0000455 3300048907 Bacteria 35340
562 Ga0496104_0005057 3300048907 Bacteria 11503
563 Ga0496104_0089865 3300048907 Bacteria 2934
564 Ga0496104_0117619 3300048907 Bacteria 2551
565 Ga0496105_0010776 3300048908 Bacteria 7197
566 Ga0496105_0037670 3300048908 Bacteria 3982
567 Ga0496105_0178759 3300048908 Bacteria 1738
568 Ga0496106_0044738 3300048909 Bacteria 3324
569 Ga0496106_0107800 3300048909 Bacteria 2166
570 Ga0496106_0115484 3300048909 Bacteria 2093
571 Ga0496107_0305367 3300048910 Bacteria 1184
572 Ga0496107_0313363 3300048910 Bacteria 1168
573 Ga0496108_0007572 3300048911 Bacteria 8796
574 Ga0496108_0015938 3300048911 Bacteria 6127
575 Ga0496108_0027703 3300048911 Bacteria 4683
576 Ga0496108_0112420 3300048911 Bacteria 2330
577 Ga0496108_0180704 3300048911 Bacteria 1827
578 Ga0496108_0253445 3300048911 Bacteria 1531
579 Ga0496108_0566748 3300048911 Bacteria 990
580 Ga0496109_0121071 3300048912 Bacteria 2438
581 Ga0496109_0144481 3300048912 Bacteria 2225
582 Ga0496109_0272678 3300048912 Bacteria 1594
583 Ga0496109_0401789 3300048912 Bacteria 1294
584 Ga0496109_0579740 3300048912 Bacteria 1057
585 Ga0496109_0965424 3300048912 Bacteria 790
586 Ga0496110_0084349 3300048913 Bacteria 2835
587 Ga0496110_0230430 3300048913 Bacteria 1685
588 Ga0496110_0241566 3300048913 Unclassified 1643
589 Ga0496110_0253616 3300048913 Bacteria 1601
590 Ga0496110_0453813 3300048913 Bacteria 1168
591 Ga0496110_1003274 3300048913 Bacteria 742
592 Ga0496111_0024078 3300048914 Bacteria 4282
593 Ga0496111_0077313 3300048914 Bacteria 2426
594 Ga0496111_0403988 3300048914 Unclassified 1009
595 Ga0496112_0001393 3300048915 Bacteria 18457
596 Ga0496112_0027379 3300048915 Bacteria 5495
597 Ga0496112_0046407 3300048915 Bacteria 4261
598 Ga0496112_0384768 3300048915 Bacteria 1344
599 Ga0496112_0447924 3300048915 Bacteria 1229
600 Ga0496112_0858151 3300048915 Bacteria 831
601 Ga0496113_0134775 3300048916 Bacteria 1940
602 Ga0496113_0140581 3300048916 Unclassified 1899
603 Ga0496113_0313108 3300048916 Bacteria 1258
604 Ga0496113_0445439 3300048916 Bacteria 1040
605 Ga0496114_0107851 3300048917 Bacteria 2383
606 Ga0496114_0667268 3300048917 Bacteria 913
607 Ga0496114_0914543 3300048917 Bacteria 759
608 Ga0496115_0093530 3300048918 Bacteria 2458
609 Ga0496115_0339519 3300048918 Bacteria 1226
610 Ga0496117_0072127 3300048920 Bacteria 2311
611 Ga0496118_0124538 3300048921 Bacteria 1672
612 Ga0496121_0021902 3300048924 Bacteria 6237
613 Ga0496121_0032181 3300048924 Bacteria 4773
614 Ga0496121_0071645 3300048924 Bacteria 2786
615 Ga0496121_0115929 3300048924 Bacteria 2033
616 Ga0496121_0119366 3300048924 Bacteria 1994
617 Ga0496121_0219012 3300048924 Bacteria 1342
618 Ga0496124_0031707 3300048927 Bacteria 4676
619 Ga0496124_0166271 3300048927 Bacteria 1714
620 Ga0496125_0118463 3300048928 Bacteria 1896
621 Ga0496125_0272969 3300048928 Bacteria 1052
622 Ga0496126_0002882 3300048929 Bacteria 22445
623 Ga0496126_0024138 3300048929 Bacteria 5874
624 Ga0496126_0062701 3300048929 Bacteria 3335
625 Ga0496126_0161527 3300048929 Bacteria 1914
626 Ga0496126_0351515 3300048929 Bacteria 1205
627 Ga0496126_0503416 3300048929 Bacteria 968
628 Ga0495678_125067 3300049459 Bacteria 859
629 Ga0495682_0032150 3300049460 Bacteria 1939
630 Ga0495682_0133133 3300049460 Bacteria 889
631 Ga0501032_0035101 3300049569 Bacteria 3430
632 Ga0501032_0075834 3300049569 Bacteria 2239
633 Ga0501032_0230429 3300049569 Bacteria 1204
634 Ga0501033_0061106 3300049570 Bacteria 2777
635 Ga0501033_0143980 3300049570 Bacteria 1722
636 Ga0501034_0000593 3300049571 Bacteria 57233
637 Ga0501034_0002613 3300049571 Bacteria 21379
638 Ga0501034_0003588 3300049571 Bacteria 17615
639 Ga0501034_0035068 3300049571 Bacteria 5087
640 Ga0501034_0044712 3300049571 Bacteria 4477
641 Ga0501034_0055314 3300049571 Bacteria 3993
642 Ga0501034_0400357 3300049571 Bacteria 1295
643 Ga0501034_0413124 3300049571 Bacteria 1271
644 Ga0501036_0006215 3300049572 Bacteria 9687
645 Ga0501036_0015237 3300049572 Bacteria 6420
646 Ga0501036_0026976 3300049572 Bacteria 4854
647 Ga0501036_0073361 3300049572 Bacteria 2893
648 Ga0501037_0028060 3300049573 Bacteria 4157
649 Ga0501037_0187236 3300049573 Bacteria 1466
650 Ga0501038_0014508 3300049574 Bacteria 7180
651 Ga0501038_0086235 3300049574 Bacteria 2638
652 Ga0501038_0271682 3300049574 Bacteria 1336
653 Ga0501039_0022224 3300049575 Bacteria 4869
654 Ga0501039_0056203 3300049575 Bacteria 3048
655 Ga0501043_0009776 3300049579 Bacteria 7516
656 Ga0501043_0036285 3300049579 Bacteria 3877
657 Ga0501043_0146092 3300049579 Bacteria 1851
658 Ga0501043_0256329 3300049579 Bacteria 1346
659 Ga0501046_0051901 3300049580 Bacteria 3234
660 Ga0501047_0001425 3300049581 Bacteria 23479
661 Ga0501047_0021891 3300049581 Bacteria 6138
662 Ga0501047_0132514 3300049581 Bacteria 2372
663 Ga0501048_0006813 3300049582 Bacteria 8677
664 Ga0501067_0154817 3300049583 Bacteria 1277
665 Ga0501068_0005284 3300049584 Bacteria 7054
666 Ga0501068_0295408 3300049584 Bacteria 1036
667 Ga0501069_0161095 3300049585 Bacteria 1292
668 Ga0501069_0344071 3300049585 Bacteria 878
669 Ga0501070_0090535 3300049586 Bacteria 2532
670 Ga0501070_0244203 3300049586 Bacteria 1469
671 Ga0501070_0796118 3300049586 Bacteria 742
672 Ga0501073_0024463 3300049589 Bacteria 4337
673 Ga0501073_0051937 3300049589 Bacteria 2871
674 Ga0501073_0084566 3300049589 Bacteria 2207
675 Ga0501074_0001697 3300049590 Bacteria 15002
676 Ga0501074_0073026 3300049590 Bacteria 2464
677 Ga0501074_0245042 3300049590 Bacteria 1274
678 Ga0501074_0295137 3300049590 Bacteria 1151
679 Ga0501076_0224333 3300049592 Bacteria 1536
680 Ga0501079_0511221 3300049741 Bacteria 944
681 Ga0501080_0002496 3300049742 Bacteria 16104
682 Ga0501080_0372394 3300049742 Bacteria 1288
683 Ga0501080_0807337 3300049742 Bacteria 822
684 Ga0501081_0084008 3300049743 Bacteria 2233
685 Ga0501083_0000907 3300049744 Bacteria 19630
686 Ga0501083_0107294 3300049744 Bacteria 1838
687 Ga0501035_0027957 3300049822 Bacteria 5152
688 Ga0501035_0073122 3300049822 Bacteria 3033
689 Ga0501035_0204363 3300049822 Bacteria 1692
690 Ga0501044_0026561 3300049823 Bacteria 6128
691 Ga0501044_0074577 3300049823 Bacteria 3446
692 Ga0501044_0098785 3300049823 Bacteria 2938
693 Ga0501044_0174599 3300049823 Bacteria 2118
694 Ga0501044_0217238 3300049823 Bacteria 1863
695 Ga0501044_0700303 3300049823 Bacteria 898
696 nmdc:mga03683_141433_c1 3300050489 Bacteria 1082
697 nmdc:mga03n38_2816_c1 3300050490 Bacteria 5470
698 nmdc:mga03n38_357505_c1 3300050490 Bacteria 796
699 nmdc:mga00v17_105962_c1 3300050491 Bacteria 1779
700 nmdc:mga00v17_239393_c1 3300050491 Bacteria 1176
701 nmdc:mga00v17_376480_c1 3300050491 Bacteria 923
702 nmdc:mga00v17_619266_c1 3300050491 Bacteria 697
703 nmdc:mga0yw44_107934_c1 3300050492 Bacteria 1781
704 nmdc:mga0yw44_367753_c1 3300050492 Bacteria 970
705 nmdc:mga0yw44_46341_c1 3300050492 Bacteria 2610
706 nmdc:mga0yw44_56354_c1 3300050492 Bacteria 2394
707 nmdc:mga0yw44_664598_c1 3300050492 Bacteria 708
708 nmdc:mga06z11_116256_c1 3300050494 Bacteria 1487
709 nmdc:mga06z11_212962_c1 3300050494 Bacteria 1127
710 nmdc:mga06z11_34972_c1 3300050494 Bacteria 2469
711 nmdc:mga04h51_2653_c1 3300050495 Bacteria 4258
712 nmdc:mga07m45_12747_c1 3300050496 Bacteria 4445
713 nmdc:mga07m45_7177_c1 3300050496 Bacteria 5677
714 nmdc:mga05p37_933068_c1 3300050507 Bacteria 931
715 nmdc:mga0qj67_533065_c1 3300050509 Bacteria 942
716 nmdc:mga08y16_653652_c1 3300050511 Bacteria 1055
717 nmdc:mga0n895_1022877_c1 3300050512 Bacteria 806
718 nmdc:mga0n895_2683_c1 3300050512 Bacteria 14041
719 nmdc:mga0n895_828236_c1 3300050512 Bacteria 914
720 nmdc:mga0rr50_202335_c1 3300050513 Bacteria 1632
721 Ga0495601_0508923 3300053077 Bacteria 776
722 Ga0495655_0122076 3300053083 Bacteria 794
723 Ga0500643_057111 3300053087 Bacteria 1102
724 Ga0500583_0002146 3300053092 Bacteria 5854
725 Ga0500641_0010909 3300053096 Bacteria 3294
726 Ga0500641_0032132 3300053096 Bacteria 2074
727 Ga0500650_0102599 3300053098 Bacteria 1338
728 Ga0500562_062741 3300053108 Bacteria 999
729 Ga0500595_026500 3300053119 Bacteria 1996
730 Ga0500642_0042665 3300053130 Bacteria 1967
731 Ga0500655_007057 3300053133 Bacteria 2021
732 Ga0500658_0108904 3300053134 Bacteria 1217
733 Ga0500561_0032548 3300053137 Bacteria 1326
734 Ga0500561_0035092 3300053137 Bacteria 1292
735 Ga0500564_224132 3300053138 Bacteria 759
736 Ga0500577_0041332 3300053142 Bacteria 1681
737 Ga0500577_0101939 3300053142 Bacteria 1174
738 Ga0500588_0046310 3300053146 Bacteria 1336
739 Ga0500588_0062429 3300053146 Bacteria 1198
740 Ga0500604_0029032 3300053151 Bacteria 1610
741 Ga0500627_0082880 3300053158 Bacteria 1431
742 Ga0500634_0088424 3300053161 Bacteria 1579
743 Ga0500634_0112562 3300053161 Bacteria 1340
744 Ga0500638_204173 3300053162 Bacteria 833
745 Ga0500637_0061432 3300053178 Bacteria 2153
746 Ga0500611_046552 3300053727 Bacteria 976
747 Ga0500609_018439 3300053731 Bacteria 950
748 Ga0500656_016602 3300053732 Bacteria 874
749 Ga0501084_0818165 3300054114 Bacteria 784
750 Ga0501082_0110947 3300060353 Bacteria 2374
751 Ga0501082_0366631 3300060353 Bacteria 1256

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005444 Ga0070694_100015646 Ga0070694_1000156466 177
2 3300021384 Ga0213876_10111656 Ga0213876_101116563 177
3 3300039437 Ga0436365_0545826 Ga0436365_0545826_49_648 177
4 3300039437 Ga0436365_0045752 Ga0436365_0045752_608_1144 178
5 3300009174 Ga0105241_10221598 Ga0105241_102215982 183
6 3300013100 Ga0157373_10290412 Ga0157373_102904122 183
7 3300025912 Ga0207707_10076954 Ga0207707_100769542 183
8 3300031241 Ga0265325_10000019 Ga0265325_1000001964 184
9 3300031249 Ga0265339_10078259 Ga0265339_100782592 184
10 3300031595 Ga0265313_10009150 Ga0265313_100091502 184
11 3300050512 nmdc:mga0n895_1022877_c1 nmdc:mga0n895_1022877_c1_74_679 184
12 3300005436 Ga0070713_100009110 Ga0070713_1000091106 186
13 3300006175 Ga0070712_100138063 Ga0070712_1001380632 186
14 3300025906 Ga0207699_10084532 Ga0207699_100845322 186
15 3300025915 Ga0207693_10205926 Ga0207693_102059261 186
16 3300025928 Ga0207700_10418202 Ga0207700_104182022 186
17 3300048911 Ga0496108_0027703 Ga0496108_0027703_1268_1867 186
18 3300048913 Ga0496110_0241566 Ga0496110_0241566_861_1460 186
19 3300048914 Ga0496111_0403988 Ga0496111_0403988_95_694 186
20 3300049823 Ga0501044_0074577 Ga0501044_0074577_1913_2503 186
21 3300006038 Ga0075365_10189150 Ga0075365_101891502 187
22 3300006048 Ga0075363_100222221 Ga0075363_1002222211 187
23 3300006178 Ga0075367_10157099 Ga0075367_101570992 187
24 3300027866 Ga0209813_10003825 Ga0209813_100038252 187
25 3300050495 nmdc:mga04h51_2653_c1 nmdc:mga04h51_2653_c1_3373_3978 187
26 3300003659 JGI25404J52841_10046768 JGI25404J52841_100467681 188
27 3300003911 JGI25405J52794_10016817 JGI25405J52794_100168172 188
28 3300005937 Ga0081455_10048280 Ga0081455_100482805 188
29 3300005983 Ga0081540_1011161 Ga0081540_10111615 188
30 3300005983 Ga0081540_1026873 Ga0081540_10268735 188
31 3300049571 Ga0501034_0000593 Ga0501034_0000593_54172_54771 191
32 3300005338 Ga0068868_100473338 Ga0068868_1004733381 192
33 3300005457 Ga0070662_100562287 Ga0070662_1005622871 192
34 3300005618 Ga0068864_100411786 Ga0068864_1004117862 192
35 3300005841 Ga0068863_100515556 Ga0068863_1005155562 192
36 3300025925 Ga0207650_10468774 Ga0207650_104687742 192
37 3300026023 Ga0207677_10215138 Ga0207677_102151383 192
38 3300026095 Ga0207676_10057588 Ga0207676_100575883 192
39 3300026121 Ga0207683_10623100 Ga0207683_106231002 192
40 3300048911 Ga0496108_0007572 Ga0496108_0007572_2656_3234 192
41 3300048913 Ga0496110_1003274 Ga0496110_1003274_40_618 192
42 3300048916 Ga0496113_0134775 Ga0496113_0134775_693_1271 192
43 3300048929 Ga0496126_0062701 Ga0496126_0062701_2091_2807 192
44 3300025908 Ga0207643_10174637 Ga0207643_101746371 194
45 3300003203 JGI25406J46586_10052595 JGI25406J46586_100525952 195
46 3300005329 Ga0070683_100415541 Ga0070683_1004155411 195
47 3300005355 Ga0070671_100027269 Ga0070671_1000272695 195
48 3300005365 Ga0070688_100270038 Ga0070688_1002700381 195
49 3300005367 Ga0070667_100292316 Ga0070667_1002923161 195
50 3300005543 Ga0070672_100245803 Ga0070672_1002458031 195
51 3300005544 Ga0070686_100412334 Ga0070686_1004123342 195
52 3300005616 Ga0068852_100176258 Ga0068852_1001762582 195
53 3300005840 Ga0068870_10145875 Ga0068870_101458753 195
54 3300005843 Ga0068860_100423660 Ga0068860_1004236602 195
55 3300005985 Ga0081539_10002583 Ga0081539_1000258330 195
56 3300006038 Ga0075365_10479373 Ga0075365_104793731 195
57 3300006042 Ga0075368_10051984 Ga0075368_100519842 195
58 3300006178 Ga0075367_10708293 Ga0075367_107082931 195
59 3300009093 Ga0105240_10224340 Ga0105240_102243402 195
60 3300009177 Ga0105248_10102374 Ga0105248_101023742 195
61 3300009177 Ga0105248_10389701 Ga0105248_103897012 195
62 3300009545 Ga0105237_10171890 Ga0105237_101718902 195
63 3300009551 Ga0105238_10229451 Ga0105238_102294513 195
64 3300009553 Ga0105249_10169566 Ga0105249_101695662 195
65 3300010375 Ga0105239_10302971 Ga0105239_103029712 195
66 3300013297 Ga0157378_10059250 Ga0157378_100592502 195
67 3300014325 Ga0163163_10733183 Ga0163163_107331831 195
68 3300014325 Ga0163163_10751419 Ga0163163_107514192 195
69 3300014326 Ga0157380_10475524 Ga0157380_104755242 195
70 3300014326 Ga0157380_10929236 Ga0157380_109292362 195
71 3300014968 Ga0157379_10033950 Ga0157379_100339502 195
72 3300017792 Ga0163161_10372823 Ga0163161_103728231 195
73 3300025913 Ga0207695_10340514 Ga0207695_103405142 195
74 3300025924 Ga0207694_10159873 Ga0207694_101598732 195
75 3300025924 Ga0207694_10808162 Ga0207694_108081621 195
76 3300025931 Ga0207644_10088712 Ga0207644_100887122 195
77 3300025934 Ga0207686_10311154 Ga0207686_103111542 195
78 3300025941 Ga0207711_10182111 Ga0207711_101821112 195
79 3300025941 Ga0207711_10289267 Ga0207711_102892671 195
80 3300025986 Ga0207658_10572006 Ga0207658_105720061 195
81 3300026035 Ga0207703_10141311 Ga0207703_101413112 195
82 3300026041 Ga0207639_10183016 Ga0207639_101830162 195
83 3300031456 Ga0307513_10209969 Ga0307513_102099692 195
84 3300031548 Ga0307408_100058770 Ga0307408_1000587701 195
85 3300031616 Ga0307508_10168165 Ga0307508_101681653 195
86 3300031730 Ga0307516_10608618 Ga0307516_106086181 195
87 3300031901 Ga0307406_10140897 Ga0307406_101408972 195
88 3300031995 Ga0307409_101182771 Ga0307409_1011827711 195
89 3300034816 Ga0373930_0026998 Ga0373930_0026998_371_958 195
90 3300035170 Ga0373943_0484986 Ga0373943_0484986_100_687 195
91 3300035242 Ga0373962_0150191 Ga0373962_0150191_103_690 195
92 3300035695 Ga0373927_0302583 Ga0373927_0302583_64_651 195
93 3300037471 Ga0395905_0814024 Ga0395905_0814024_196_798 195
94 3300042004 Ga0439445_0064161 Ga0439445_0064161_230_832 195
95 3300046473 Ga0495582_0377851 Ga0495582_0377851_146_748 195
96 3300046616 Ga0495668_0110188 Ga0495668_0110188_150_752 195
97 3300046616 Ga0495668_0148631 Ga0495668_0148631_102_704 195
98 3300046660 Ga0495625_0455874 Ga0495625_0455874_134_736 195
99 3300046679 Ga0495623_0460415 Ga0495623_0460415_47_649 195
100 3300046683 Ga0495658_0265998 Ga0495658_0265998_335_937 195
101 3300047315 Ga0495581_0425594 Ga0495581_0425594_56_658 195
102 3300048903 Ga0496100_0088762 Ga0496100_0088762_933_1520 195
103 3300048904 Ga0496101_0035125 Ga0496101_0035125_227_829 195
104 3300048904 Ga0496101_0066897 Ga0496101_0066897_1556_2143 195
105 3300048905 Ga0496102_0097203 Ga0496102_0097203_891_1478 195
106 3300048907 Ga0496104_0089865 Ga0496104_0089865_1011_1598 195
107 3300048909 Ga0496106_0115484 Ga0496106_0115484_1170_1757 195
108 3300048911 Ga0496108_0253445 Ga0496108_0253445_504_1091 195
109 3300048912 Ga0496109_0144481 Ga0496109_0144481_1613_2200 195
110 3300048913 Ga0496110_0084349 Ga0496110_0084349_917_1504 195
111 3300048914 Ga0496111_0077313 Ga0496111_0077313_807_1394 195
112 3300048915 Ga0496112_0001393 Ga0496112_0001393_218_805 195
113 3300048917 Ga0496114_0107851 Ga0496114_0107851_1247_1834 195
114 3300048917 Ga0496114_0667268 Ga0496114_0667268_155_757 195
115 3300048917 Ga0496114_0914543 Ga0496114_0914543_47_649 195
116 3300048918 Ga0496115_0093530 Ga0496115_0093530_1595_2182 195
117 3300049586 Ga0501070_0090535 Ga0501070_0090535_691_1311 195
118 3300050491 nmdc:mga00v17_239393_c1 nmdc:mga00v17_239393_c1_430_1035 195
119 3300050492 nmdc:mga0yw44_664598_c1 nmdc:mga0yw44_664598_c1_19_621 195
120 3300050494 nmdc:mga06z11_34972_c1 nmdc:mga06z11_34972_c1_173_781 195
121 3300053727 Ga0500611_046552 Ga0500611_046552_118_720 195
122 2010549000 RicEn_FSXC51428_g1 RicEn_454400 196
123 3300003659 JGI25404J52841_10002782 JGI25404J52841_100027822 196
124 3300003911 JGI25405J52794_10023307 JGI25405J52794_100233071 196
125 3300005288 Ga0065714_10237102 Ga0065714_102371021 196
126 3300005289 Ga0065704_10140531 Ga0065704_101405312 196
127 3300005290 Ga0065712_10175080 Ga0065712_101750801 196
128 3300005293 Ga0065715_10120354 Ga0065715_101203543 196
129 3300005329 Ga0070683_100053329 Ga0070683_1000533292 196
130 3300005329 Ga0070683_100660189 Ga0070683_1006601891 196
131 3300005330 Ga0070690_100002833 Ga0070690_1000028334 196
132 3300005331 Ga0070670_100126286 Ga0070670_1001262864 196
133 3300005334 Ga0068869_100030484 Ga0068869_1000304843 196
134 3300005334 Ga0068869_100034418 Ga0068869_1000344182 196
135 3300005334 Ga0068869_100088480 Ga0068869_1000884803 196
136 3300005334 Ga0068869_100471785 Ga0068869_1004717851 196
137 3300005335 Ga0070666_10012049 Ga0070666_100120493 196
138 3300005335 Ga0070666_10259335 Ga0070666_102593352 196
139 3300005336 Ga0070680_100027574 Ga0070680_1000275742 196
140 3300005337 Ga0070682_100613571 Ga0070682_1006135711 196
141 3300005338 Ga0068868_100021301 Ga0068868_1000213016 196
142 3300005338 Ga0068868_100149682 Ga0068868_1001496822 196
143 3300005338 Ga0068868_100405084 Ga0068868_1004050842 196
144 3300005340 Ga0070689_100021328 Ga0070689_1000213284 196
145 3300005340 Ga0070689_100804630 Ga0070689_1008046301 196
146 3300005343 Ga0070687_100285783 Ga0070687_1002857831 196
147 3300005343 Ga0070687_100348957 Ga0070687_1003489571 196
148 3300005344 Ga0070661_100236318 Ga0070661_1002363182 196
149 3300005344 Ga0070661_100324465 Ga0070661_1003244652 196
150 3300005347 Ga0070668_100092246 Ga0070668_1000922463 196
151 3300005347 Ga0070668_100294907 Ga0070668_1002949072 196
152 3300005347 Ga0070668_100320161 Ga0070668_1003201612 196
153 3300005347 Ga0070668_100613835 Ga0070668_1006138352 196
154 3300005353 Ga0070669_100194042 Ga0070669_1001940422 196
155 3300005353 Ga0070669_100420547 Ga0070669_1004205471 196
156 3300005354 Ga0070675_100005627 Ga0070675_1000056274 196
157 3300005354 Ga0070675_100436575 Ga0070675_1004365752 196
158 3300005354 Ga0070675_100458952 Ga0070675_1004589522 196
159 3300005355 Ga0070671_100026147 Ga0070671_1000261474 196
160 3300005355 Ga0070671_101128349 Ga0070671_1011283491 196
161 3300005367 Ga0070667_100002110 Ga0070667_1000021107 196
162 3300005367 Ga0070667_100340826 Ga0070667_1003408262 196
163 3300005438 Ga0070701_10386107 Ga0070701_103861072 196
164 3300005439 Ga0070711_100617199 Ga0070711_1006171991 196
165 3300005441 Ga0070700_100280686 Ga0070700_1002806862 196
166 3300005441 Ga0070700_100320937 Ga0070700_1003209371 196
167 3300005444 Ga0070694_100230989 Ga0070694_1002309892 196
168 3300005455 Ga0070663_100000663 Ga0070663_1000006636 196
169 3300005455 Ga0070663_100027475 Ga0070663_1000274753 196
170 3300005455 Ga0070663_100126626 Ga0070663_1001266261 196
171 3300005455 Ga0070663_100206539 Ga0070663_1002065392 196
172 3300005456 Ga0070678_100006375 Ga0070678_1000063754 196
173 3300005456 Ga0070678_100007982 Ga0070678_1000079823 196
174 3300005456 Ga0070678_100223344 Ga0070678_1002233442 196
175 3300005457 Ga0070662_100036998 Ga0070662_1000369982 196
176 3300005457 Ga0070662_100084095 Ga0070662_1000840953 196
177 3300005458 Ga0070681_10087171 Ga0070681_100871712 196
178 3300005458 Ga0070681_10411824 Ga0070681_104118241 196
179 3300005459 Ga0068867_100141596 Ga0068867_1001415962 196
180 3300005459 Ga0068867_100186927 Ga0068867_1001869271 196
181 3300005466 Ga0070685_10084517 Ga0070685_100845173 196
182 3300005466 Ga0070685_10331330 Ga0070685_103313301 196
183 3300005467 Ga0070706_101040308 Ga0070706_1010403081 196
184 3300005468 Ga0070707_100068164 Ga0070707_1000681642 196
185 3300005471 Ga0070698_100150659 Ga0070698_1001506594 196
186 3300005518 Ga0070699_100152211 Ga0070699_1001522112 196
187 3300005530 Ga0070679_100093183 Ga0070679_1000931833 196
188 3300005530 Ga0070679_100175359 Ga0070679_1001753592 196
189 3300005535 Ga0070684_100123045 Ga0070684_1001230451 196
190 3300005535 Ga0070684_100287374 Ga0070684_1002873742 196
191 3300005535 Ga0070684_100423553 Ga0070684_1004235532 196
192 3300005539 Ga0068853_100040290 Ga0068853_1000402902 196
193 3300005543 Ga0070672_100107034 Ga0070672_1001070344 196
194 3300005543 Ga0070672_100358104 Ga0070672_1003581042 196
195 3300005544 Ga0070686_100353989 Ga0070686_1003539891 196
196 3300005545 Ga0070695_100827146 Ga0070695_1008271461 196
197 3300005546 Ga0070696_100110763 Ga0070696_1001107631 196
198 3300005547 Ga0070693_100045221 Ga0070693_1000452212 196
199 3300005547 Ga0070693_100694159 Ga0070693_1006941592 196
200 3300005548 Ga0070665_100003746 Ga0070665_1000037467 196
201 3300005548 Ga0070665_100005052 Ga0070665_1000050523 196
202 3300005548 Ga0070665_100013563 Ga0070665_1000135633 196
203 3300005548 Ga0070665_100021610 Ga0070665_1000216102 196
204 3300005548 Ga0070665_100058396 Ga0070665_1000583962 196
205 3300005548 Ga0070665_100166352 Ga0070665_1001663523 196
206 3300005548 Ga0070665_100576060 Ga0070665_1005760602 196
207 3300005548 Ga0070665_101268858 Ga0070665_1012688581 196
208 3300005549 Ga0070704_100745055 Ga0070704_1007450552 196
209 3300005563 Ga0068855_100115683 Ga0068855_1001156832 196
210 3300005563 Ga0068855_100180870 Ga0068855_1001808703 196
211 3300005563 Ga0068855_100247630 Ga0068855_1002476301 196
212 3300005563 Ga0068855_100571795 Ga0068855_1005717952 196
213 3300005563 Ga0068855_100710466 Ga0068855_1007104662 196
214 3300005564 Ga0070664_100686855 Ga0070664_1006868551 196
215 3300005564 Ga0070664_100793366 Ga0070664_1007933661 196
216 3300005564 Ga0070664_100825307 Ga0070664_1008253072 196
217 3300005577 Ga0068857_100458960 Ga0068857_1004589602 196
218 3300005578 Ga0068854_100981029 Ga0068854_1009810291 196
219 3300005614 Ga0068856_100014477 Ga0068856_1000144778 196
220 3300005614 Ga0068856_100560696 Ga0068856_1005606962 196
221 3300005616 Ga0068852_100015964 Ga0068852_1000159646 196
222 3300005616 Ga0068852_100061095 Ga0068852_1000610952 196
223 3300005616 Ga0068852_100501466 Ga0068852_1005014662 196
224 3300005617 Ga0068859_100032269 Ga0068859_1000322696 196
225 3300005617 Ga0068859_100051481 Ga0068859_1000514812 196
226 3300005617 Ga0068859_100275026 Ga0068859_1002750262 196
227 3300005617 Ga0068859_100565676 Ga0068859_1005656762 196
228 3300005617 Ga0068859_101200343 Ga0068859_1012003431 196
229 3300005618 Ga0068864_100015563 Ga0068864_1000155635 196
230 3300005618 Ga0068864_100073770 Ga0068864_1000737703 196
231 3300005618 Ga0068864_100258536 Ga0068864_1002585362 196
232 3300005719 Ga0068861_100026034 Ga0068861_1000260344 196
233 3300005719 Ga0068861_100143367 Ga0068861_1001433672 196
234 3300005719 Ga0068861_100250239 Ga0068861_1002502393 196
235 3300005719 Ga0068861_100439447 Ga0068861_1004394472 196
236 3300005719 Ga0068861_100885039 Ga0068861_1008850391 196
237 3300005834 Ga0068851_10013989 Ga0068851_100139893 196
238 3300005840 Ga0068870_10078086 Ga0068870_100780862 196
239 3300005840 Ga0068870_10095281 Ga0068870_100952812 196
240 3300005841 Ga0068863_100005866 Ga0068863_1000058667 196
241 3300005841 Ga0068863_100796310 Ga0068863_1007963102 196
242 3300005842 Ga0068858_100000211 Ga0068858_10000021140 196
243 3300005842 Ga0068858_100070599 Ga0068858_1000705992 196
244 3300005843 Ga0068860_100011349 Ga0068860_1000113495 196
245 3300005843 Ga0068860_100094666 Ga0068860_1000946663 196
246 3300005843 Ga0068860_100460289 Ga0068860_1004602892 196
247 3300005843 Ga0068860_100501587 Ga0068860_1005015872 196
248 3300005843 Ga0068860_100738025 Ga0068860_1007380252 196
249 3300005844 Ga0068862_100040067 Ga0068862_1000400673 196
250 3300005844 Ga0068862_100107140 Ga0068862_1001071403 196
251 3300005844 Ga0068862_100180060 Ga0068862_1001800602 196
252 3300005937 Ga0081455_10003425 Ga0081455_1000342515 196
253 3300005937 Ga0081455_10006252 Ga0081455_100062529 196
254 3300005937 Ga0081455_10009461 Ga0081455_100094616 196
255 3300005937 Ga0081455_10024092 Ga0081455_100240923 196
256 3300005937 Ga0081455_10070721 Ga0081455_100707213 196
257 3300005937 Ga0081455_10071950 Ga0081455_100719502 196
258 3300005983 Ga0081540_1002589 Ga0081540_100258911 196
259 3300005983 Ga0081540_1003572 Ga0081540_10035728 196
260 3300005983 Ga0081540_1006855 Ga0081540_10068556 196
261 3300005985 Ga0081539_10018896 Ga0081539_100188963 196
262 3300006038 Ga0075365_10055643 Ga0075365_100556431 196
263 3300006038 Ga0075365_10092443 Ga0075365_100924432 196
264 3300006048 Ga0075363_100004914 Ga0075363_1000049143 196
265 3300006048 Ga0075363_100028673 Ga0075363_1000286732 196
266 3300006173 Ga0070716_100128067 Ga0070716_1001280672 196
267 3300006177 Ga0075362_10207489 Ga0075362_102074891 196
268 3300006178 Ga0075367_10094859 Ga0075367_100948592 196
269 3300006178 Ga0075367_10180627 Ga0075367_101806272 196
270 3300006186 Ga0075369_10004778 Ga0075369_100047785 196
271 3300006195 Ga0075366_10109826 Ga0075366_101098262 196
272 3300006237 Ga0097621_100110397 Ga0097621_1001103973 196
273 3300006237 Ga0097621_100143301 Ga0097621_1001433012 196
274 3300006353 Ga0075370_10002046 Ga0075370_100020464 196
275 3300006353 Ga0075370_10008551 Ga0075370_100085515 196
276 3300006353 Ga0075370_10020184 Ga0075370_100201844 196
277 3300006358 Ga0068871_100024943 Ga0068871_1000249433 196
278 3300006358 Ga0068871_100475191 Ga0068871_1004751912 196
279 3300006844 Ga0075428_100092094 Ga0075428_1000920942 196
280 3300006852 Ga0075433_10384723 Ga0075433_103847232 196
281 3300006871 Ga0075434_100003708 Ga0075434_1000037089 196
282 3300006871 Ga0075434_100128231 Ga0075434_1001282311 196
283 3300006931 Ga0097620_100032269 Ga0097620_1000322696 196
284 3300006931 Ga0097620_100051481 Ga0097620_1000514815 196
285 3300006931 Ga0097620_100275013 Ga0097620_1002750132 196
286 3300006931 Ga0097620_100565678 Ga0097620_1005656782 196
287 3300006931 Ga0097620_101200356 Ga0097620_1012003561 196
288 3300007076 Ga0075435_100207898 Ga0075435_1002078982 196
289 3300007076 Ga0075435_100215375 Ga0075435_1002153752 196
290 3300009092 Ga0105250_10016274 Ga0105250_100162742 196
291 3300009093 Ga0105240_10153104 Ga0105240_101531043 196
292 3300009093 Ga0105240_10198229 Ga0105240_101982292 196
293 3300009093 Ga0105240_10444344 Ga0105240_104443441 196
294 3300009093 Ga0105240_11452491 Ga0105240_114524911 196
295 3300009101 Ga0105247_10267963 Ga0105247_102679632 196
296 3300009147 Ga0114129_10264694 Ga0114129_102646943 196
297 3300009148 Ga0105243_10201681 Ga0105243_102016812 196
298 3300009174 Ga0105241_10474542 Ga0105241_104745421 196
299 3300009176 Ga0105242_10714652 Ga0105242_107146522 196
300 3300009177 Ga0105248_10088569 Ga0105248_100885693 196
301 3300009177 Ga0105248_10569824 Ga0105248_105698241 196
302 3300009545 Ga0105237_10068817 Ga0105237_100688172 196
303 3300009545 Ga0105237_10394184 Ga0105237_103941843 196
304 3300009545 Ga0105237_10761259 Ga0105237_107612591 196
305 3300009545 Ga0105237_10775764 Ga0105237_107757642 196
306 3300009551 Ga0105238_10017485 Ga0105238_1001748511 196
307 3300009553 Ga0105249_10133162 Ga0105249_101331622 196
308 3300009553 Ga0105249_10219019 Ga0105249_102190192 196
309 3300010375 Ga0105239_10047197 Ga0105239_100471974 196
310 3300010375 Ga0105239_10133341 Ga0105239_101333414 196
311 3300010375 Ga0105239_10215187 Ga0105239_102151872 196
312 3300010375 Ga0105239_10362312 Ga0105239_103623122 196
313 3300011119 Ga0105246_10326682 Ga0105246_103266822 196
314 3300013105 Ga0157369_10516107 Ga0157369_105161071 196
315 3300013105 Ga0157369_10540521 Ga0157369_105405211 196
316 3300013296 Ga0157374_10004632 Ga0157374_100046326 196
317 3300013296 Ga0157374_10149275 Ga0157374_101492752 196
318 3300013297 Ga0157378_10031169 Ga0157378_100311692 196
319 3300013297 Ga0157378_10792627 Ga0157378_107926271 196
320 3300013297 Ga0157378_10981845 Ga0157378_109818451 196
321 3300013306 Ga0163162_10015806 Ga0163162_100158067 196
322 3300013306 Ga0163162_10186822 Ga0163162_101868222 196
323 3300013306 Ga0163162_10217359 Ga0163162_102173593 196
324 3300013306 Ga0163162_10334057 Ga0163162_103340572 196
325 3300013306 Ga0163162_10410185 Ga0163162_104101851 196
326 3300013306 Ga0163162_10870477 Ga0163162_108704771 196
327 3300013307 Ga0157372_10199994 Ga0157372_101999942 196
328 3300013307 Ga0157372_11767797 Ga0157372_117677971 196
329 3300013308 Ga0157375_10184239 Ga0157375_101842393 196
330 3300013308 Ga0157375_10423925 Ga0157375_104239252 196
331 3300013308 Ga0157375_10480094 Ga0157375_104800942 196
332 3300014325 Ga0163163_10002661 Ga0163163_1000266111 196
333 3300014325 Ga0163163_10044505 Ga0163163_100445053 196
334 3300014325 Ga0163163_10069006 Ga0163163_100690064 196
335 3300014326 Ga0157380_10268008 Ga0157380_102680081 196
336 3300014326 Ga0157380_10313916 Ga0157380_103139162 196
337 3300014326 Ga0157380_10803615 Ga0157380_108036151 196
338 3300014326 Ga0157380_11531070 Ga0157380_115310701 196
339 3300014968 Ga0157379_10050930 Ga0157379_100509303 196
340 3300014968 Ga0157379_10153593 Ga0157379_101535932 196
341 3300014968 Ga0157379_10793632 Ga0157379_107936321 196
342 3300014969 Ga0157376_10142716 Ga0157376_101427162 196
343 3300014969 Ga0157376_10166202 Ga0157376_101662022 196
344 3300014969 Ga0157376_10280747 Ga0157376_102807472 196
345 3300017792 Ga0163161_10074398 Ga0163161_100743984 196
346 3300017792 Ga0163161_10330622 Ga0163161_103306222 196
347 3300020070 Ga0206356_11851354 Ga0206356_118513541 196
348 3300025297 Ga0209758_1004341 Ga0209758_10043412 196
349 3300025302 Ga0207426_1029550 Ga0207426_10295502 196
350 3300025711 Ga0207696_1022535 Ga0207696_10225352 196
351 3300025893 Ga0207682_10058557 Ga0207682_100585571 196
352 3300025893 Ga0207682_10119786 Ga0207682_101197862 196
353 3300025900 Ga0207710_10358433 Ga0207710_103584331 196
354 3300025901 Ga0207688_10027816 Ga0207688_100278163 196
355 3300025903 Ga0207680_10005653 Ga0207680_100056536 196
356 3300025903 Ga0207680_10405432 Ga0207680_104054321 196
357 3300025904 Ga0207647_10157200 Ga0207647_101572001 196
358 3300025908 Ga0207643_10058362 Ga0207643_100583622 196
359 3300025908 Ga0207643_10060125 Ga0207643_100601252 196
360 3300025911 Ga0207654_10008634 Ga0207654_100086345 196
361 3300025912 Ga0207707_10001660 Ga0207707_1000166011 196
362 3300025912 Ga0207707_10015879 Ga0207707_100158798 196
363 3300025912 Ga0207707_10394135 Ga0207707_103941352 196
364 3300025912 Ga0207707_10597119 Ga0207707_105971191 196
365 3300025913 Ga0207695_10151168 Ga0207695_101511682 196
366 3300025913 Ga0207695_10332619 Ga0207695_103326192 196
367 3300025914 Ga0207671_10216444 Ga0207671_102164443 196
368 3300025914 Ga0207671_10599692 Ga0207671_105996921 196
369 3300025916 Ga0207663_10550677 Ga0207663_105506771 196
370 3300025917 Ga0207660_10218833 Ga0207660_102188332 196
371 3300025918 Ga0207662_10115789 Ga0207662_101157893 196
372 3300025921 Ga0207652_10010980 Ga0207652_100109801 196
373 3300025921 Ga0207652_10032578 Ga0207652_100325783 196
374 3300025922 Ga0207646_10129621 Ga0207646_101296213 196
375 3300025923 Ga0207681_10129706 Ga0207681_101297063 196
376 3300025923 Ga0207681_10156311 Ga0207681_101563112 196
377 3300025923 Ga0207681_10350734 Ga0207681_103507341 196
378 3300025923 Ga0207681_10595574 Ga0207681_105955743 196
379 3300025924 Ga0207694_10095565 Ga0207694_100955652 196
380 3300025924 Ga0207694_10211011 Ga0207694_102110112 196
381 3300025924 Ga0207694_10441783 Ga0207694_104417832 196
382 3300025925 Ga0207650_10103167 Ga0207650_101031672 196
383 3300025926 Ga0207659_10002563 Ga0207659_1000256310 196
384 3300025931 Ga0207644_10089818 Ga0207644_100898182 196
385 3300025931 Ga0207644_10287175 Ga0207644_102871752 196
386 3300025931 Ga0207644_10818499 Ga0207644_108184991 196
387 3300025933 Ga0207706_10026350 Ga0207706_100263504 196
388 3300025933 Ga0207706_10091005 Ga0207706_100910052 196
389 3300025933 Ga0207706_10271770 Ga0207706_102717702 196
390 3300025934 Ga0207686_10143974 Ga0207686_101439742 196
391 3300025935 Ga0207709_10058106 Ga0207709_100581062 196
392 3300025936 Ga0207670_10024373 Ga0207670_100243734 196
393 3300025938 Ga0207704_10081930 Ga0207704_100819302 196
394 3300025938 Ga0207704_10583100 Ga0207704_105831001 196
395 3300025939 Ga0207665_10657500 Ga0207665_106575001 196
396 3300025940 Ga0207691_10017874 Ga0207691_100178746 196
397 3300025941 Ga0207711_10006607 Ga0207711_100066073 196
398 3300025942 Ga0207689_10035700 Ga0207689_100357004 196
399 3300025942 Ga0207689_10043430 Ga0207689_100434302 196
400 3300025942 Ga0207689_10045810 Ga0207689_100458102 196
401 3300025942 Ga0207689_10089402 Ga0207689_100894023 196
402 3300025944 Ga0207661_10002756 Ga0207661_100027564 196
403 3300025944 Ga0207661_10462469 Ga0207661_104624692 196
404 3300025945 Ga0207679_10124908 Ga0207679_101249081 196
405 3300025945 Ga0207679_10296276 Ga0207679_102962762 196
406 3300025945 Ga0207679_10718905 Ga0207679_107189051 196
407 3300025949 Ga0207667_10088183 Ga0207667_100881835 196
408 3300025949 Ga0207667_10205767 Ga0207667_102057674 196
409 3300025949 Ga0207667_10423973 Ga0207667_104239732 196
410 3300025949 Ga0207667_10878329 Ga0207667_108783291 196
411 3300025960 Ga0207651_10000121 Ga0207651_100001218 196
412 3300025960 Ga0207651_10240513 Ga0207651_102405132 196
413 3300025961 Ga0207712_10194454 Ga0207712_101944542 196
414 3300025961 Ga0207712_10217730 Ga0207712_102177302 196
415 3300025961 Ga0207712_10486238 Ga0207712_104862382 196
416 3300025972 Ga0207668_10022231 Ga0207668_100222313 196
417 3300025972 Ga0207668_10058829 Ga0207668_100588292 196
418 3300025972 Ga0207668_10100477 Ga0207668_101004771 196
419 3300025972 Ga0207668_10240126 Ga0207668_102401262 196
420 3300025981 Ga0207640_10113733 Ga0207640_101137332 196
421 3300025986 Ga0207658_10000984 Ga0207658_1000098422 196
422 3300025986 Ga0207658_10181495 Ga0207658_101814952 196
423 3300026023 Ga0207677_10055045 Ga0207677_100550452 196
424 3300026023 Ga0207677_10854007 Ga0207677_108540071 196
425 3300026035 Ga0207703_10002258 Ga0207703_100022586 196
426 3300026035 Ga0207703_10023501 Ga0207703_100235013 196
427 3300026035 Ga0207703_10102794 Ga0207703_101027942 196
428 3300026035 Ga0207703_10530675 Ga0207703_105306752 196
429 3300026035 Ga0207703_10660512 Ga0207703_106605122 196
430 3300026041 Ga0207639_10180677 Ga0207639_101806772 196
431 3300026067 Ga0207678_10002185 Ga0207678_1000218510 196
432 3300026067 Ga0207678_10088427 Ga0207678_100884272 196
433 3300026067 Ga0207678_10091352 Ga0207678_100913522 196
434 3300026067 Ga0207678_10157606 Ga0207678_101576063 196
435 3300026067 Ga0207678_10236692 Ga0207678_102366921 196
436 3300026075 Ga0207708_10224149 Ga0207708_102241492 196
437 3300026075 Ga0207708_10386140 Ga0207708_103861401 196
438 3300026078 Ga0207702_10225436 Ga0207702_102254363 196
439 3300026088 Ga0207641_10002109 Ga0207641_1000210915 196
440 3300026088 Ga0207641_10232595 Ga0207641_102325952 196
441 3300026088 Ga0207641_11078432 Ga0207641_110784321 196
442 3300026089 Ga0207648_10096093 Ga0207648_100960932 196
443 3300026089 Ga0207648_11409865 Ga0207648_114098651 196
444 3300026095 Ga0207676_10000749 Ga0207676_1000074922 196
445 3300026095 Ga0207676_10235579 Ga0207676_102355792 196
446 3300026116 Ga0207674_10444670 Ga0207674_104446702 196
447 3300026116 Ga0207674_10750387 Ga0207674_107503871 196
448 3300026118 Ga0207675_100030553 Ga0207675_1000305532 196
449 3300026118 Ga0207675_100041965 Ga0207675_1000419654 196
450 3300026118 Ga0207675_100236907 Ga0207675_1002369071 196
451 3300026121 Ga0207683_10009422 Ga0207683_100094223 196
452 3300026142 Ga0207698_10014518 Ga0207698_100145185 196
453 3300028379 Ga0268266_10000519 Ga0268266_1000051912 196
454 3300028379 Ga0268266_10002731 Ga0268266_100027314 196
455 3300028379 Ga0268266_10007858 Ga0268266_100078583 196
456 3300028379 Ga0268266_10026561 Ga0268266_100265613 196
457 3300028379 Ga0268266_10074305 Ga0268266_100743053 196
458 3300028379 Ga0268266_10086191 Ga0268266_100861911 196
459 3300028380 Ga0268265_10053362 Ga0268265_100533622 196
460 3300028380 Ga0268265_10053798 Ga0268265_100537981 196
461 3300028380 Ga0268265_10100132 Ga0268265_101001322 196
462 3300028380 Ga0268265_10132120 Ga0268265_101321203 196
463 3300028381 Ga0268264_10070247 Ga0268264_100702474 196
464 3300028381 Ga0268264_10454260 Ga0268264_104542602 196
465 3300028786 Ga0307517_10060854 Ga0307517_100608543 196
466 3300028786 Ga0307517_10141324 Ga0307517_101413242 196
467 3300028794 Ga0307515_10427340 Ga0307515_104273402 196
468 3300031456 Ga0307513_10505722 Ga0307513_105057221 196
469 3300031507 Ga0307509_10480983 Ga0307509_104809831 196
470 3300031548 Ga0307408_100067665 Ga0307408_1000676651 196
471 3300031548 Ga0307408_100467751 Ga0307408_1004677512 196
472 3300031731 Ga0307405_10134132 Ga0307405_101341322 196
473 3300031901 Ga0307406_10286014 Ga0307406_102860142 196
474 3300031911 Ga0307412_10156211 Ga0307412_101562112 196
475 3300031995 Ga0307409_100938726 Ga0307409_1009387262 196
476 3300032002 Ga0307416_100038819 Ga0307416_1000388193 196
477 3300032002 Ga0307416_100104574 Ga0307416_1001045743 196
478 3300032005 Ga0307411_10594902 Ga0307411_105949022 196
479 3300032005 Ga0307411_10878037 Ga0307411_108780372 196
480 3300032126 Ga0307415_100230503 Ga0307415_1002305031 196
481 3300033180 Ga0307510_10021151 Ga0307510_100211512 196
482 3300035083 Ga0373926_0079621 Ga0373926_0079621_24_629 196
483 3300035111 Ga0373923_0042926 Ga0373923_0042926_412_1017 196
484 3300035113 Ga0373936_0007126 Ga0373936_0007126_531_1136 196
485 3300035115 Ga0373941_0000361 Ga0373941_0000361_485_1084 196
486 3300035117 Ga0373953_0040133 Ga0373953_0040133_33_638 196
487 3300035119 Ga0373956_0055632 Ga0373956_0055632_785_1390 196
488 3300035120 Ga0373957_0041614 Ga0373957_0041614_322_927 196
489 3300035170 Ga0373943_0019457 Ga0373943_0019457_1345_1950 196
490 3300035172 Ga0373955_0023658 Ga0373955_0023658_319_924 196
491 3300035692 Ga0373935_0277950 Ga0373935_0277950_302_907 196
492 3300035695 Ga0373927_0120591 Ga0373927_0120591_87_692 196
493 3300035695 Ga0373927_0304961 Ga0373927_0304961_53_658 196
494 3300035724 Ga0373933_0103308 Ga0373933_0103308_989_1594 196
495 3300035725 Ga0373947_0014281 Ga0373947_0014281_3643_4248 196
496 3300039437 Ga0436365_0014507 Ga0436365_0014507_94_699 196
497 3300041441 Ga0451787_018577 Ga0451787_018577_247_852 196
498 3300041451 Ga0451791_1804937 Ga0451791_1804937_187_792 196
499 3300041452 Ga0451793_1582537 Ga0451793_1582537_205_810 196
500 3300041460 Ga0451802_0401890 Ga0451802_0401890_192_797 196
501 3300041491 Ga0451833_1416861 Ga0451833_1416861_88_693 196
502 3300044706 Ga0466964_0078768 Ga0466964_0078768_31_636 196
503 3300044735 Ga0466968_0240140 Ga0466968_0240140_86_691 196
504 3300044901 Ga0466960_0030018 Ga0466960_0030018_1405_2010 196
505 3300045976 Ga0466967_0156569 Ga0466967_0156569_1100_1705 196
506 3300045976 Ga0466967_0449259 Ga0466967_0449259_566_1171 196
507 3300046452 Ga0495617_003959 Ga0495617_003959_814_1416 196
508 3300046454 Ga0495592_0123300 Ga0495592_0123300_1147_1752 196
509 3300046455 Ga0495603_0081307 Ga0495603_0081307_298_903 196
510 3300046457 Ga0495590_0024119 Ga0495590_0024119_1425_2039 196
511 3300046457 Ga0495590_0133332 Ga0495590_0133332_30_635 196
512 3300046459 Ga0495629_0180734 Ga0495629_0180734_538_1143 196
513 3300046460 Ga0495638_0063518 Ga0495638_0063518_431_1036 196
514 3300046460 Ga0495638_0084450 Ga0495638_0084450_738_1343 196
515 3300046460 Ga0495638_0240574 Ga0495638_0240574_357_962 196
516 3300046461 Ga0495641_0248538 Ga0495641_0248538_141_746 196
517 3300046472 Ga0495580_0013708 Ga0495580_0013708_4991_5596 196
518 3300046472 Ga0495580_0091517 Ga0495580_0091517_1461_2066 196
519 3300046473 Ga0495582_0006519 Ga0495582_0006519_5708_6313 196
520 3300046475 Ga0495639_0020308 Ga0495639_0020308_917_1522 196
521 3300046477 Ga0495664_0029189 Ga0495664_0029189_1147_1752 196
522 3300046491 Ga0495584_0075589 Ga0495584_0075589_311_916 196
523 3300046491 Ga0495584_0163924 Ga0495584_0163924_417_1022 196
524 3300046491 Ga0495584_0166094 Ga0495584_0166094_469_1074 196
525 3300046491 Ga0495584_0223075 Ga0495584_0223075_244_849 196
526 3300046492 Ga0495585_0020146 Ga0495585_0020146_2302_2904 196
527 3300046492 Ga0495585_0046373 Ga0495585_0046373_967_1557 196
528 3300046492 Ga0495585_0240730 Ga0495585_0240730_190_795 196
529 3300046499 Ga0495594_0138672 Ga0495594_0138672_96_701 196
530 3300046499 Ga0495594_0506421 Ga0495594_0506421_49_654 196
531 3300046515 Ga0495620_0063470 Ga0495620_0063470_812_1429 196
532 3300046517 Ga0495630_0119700 Ga0495630_0119700_1335_1940 196
533 3300046518 Ga0495631_0295888 Ga0495631_0295888_24_629 196
534 3300046519 Ga0495632_0097215 Ga0495632_0097215_486_1091 196
535 3300046519 Ga0495632_0138796 Ga0495632_0138796_509_1111 196
536 3300046523 Ga0495644_0085306 Ga0495644_0085306_41_646 196
537 3300046523 Ga0495644_0150758 Ga0495644_0150758_115_720 196
538 3300046524 Ga0495648_0124300 Ga0495648_0124300_753_1355 196
539 3300046526 Ga0495666_0038861 Ga0495666_0038861_603_1208 196
540 3300046528 Ga0495642_0098596 Ga0495642_0098596_217_834 196
541 3300046529 Ga0495652_0416821 Ga0495652_0416821_304_909 196
542 3300046530 Ga0495654_0080369 Ga0495654_0080369_654_1271 196
543 3300046531 Ga0495665_0016908 Ga0495665_0016908_2208_2813 196
544 3300046531 Ga0495665_0423981 Ga0495665_0423981_31_636 196
545 3300046533 Ga0495640_0217704 Ga0495640_0217704_306_911 196
546 3300046537 Ga0495598_0002622 Ga0495598_0002622_1962_2552 196
547 3300046538 Ga0495609_0227615 Ga0495609_0227615_129_734 196
548 3300046539 Ga0495621_0103155 Ga0495621_0103155_321_926 196
549 3300046543 Ga0495645_0113695 Ga0495645_0113695_1150_1755 196
550 3300046557 Ga0495622_0043851 Ga0495622_0043851_1122_1727 196
551 3300046557 Ga0495622_0182444 Ga0495622_0182444_222_827 196
552 3300046558 Ga0495633_0126629 Ga0495633_0126629_111_716 196
553 3300046615 Ga0495656_0000977 Ga0495656_0000977_7380_7970 196
554 3300046616 Ga0495668_0135783 Ga0495668_0135783_433_1038 196
555 3300046616 Ga0495668_0368834 Ga0495668_0368834_45_650 196
556 3300046642 Ga0495634_0059476 Ga0495634_0059476_1245_1850 196
557 3300046648 Ga0495611_0066551 Ga0495611_0066551_371_976 196
558 3300046660 Ga0495625_0072881 Ga0495625_0072881_761_1363 196
559 3300046660 Ga0495625_0149424 Ga0495625_0149424_740_1345 196
560 3300046674 Ga0495588_0006542 Ga0495588_0006542_2996_3601 196
561 3300046680 Ga0495646_0057485 Ga0495646_0057485_324_929 196
562 3300046681 Ga0495647_0077745 Ga0495647_0077745_63_668 196
563 3300046689 Ga0495613_0060056 Ga0495613_0060056_1141_1746 196
564 3300046690 Ga0495624_0024501 Ga0495624_0024501_176_781 196
565 3300046691 Ga0495670_0101018 Ga0495670_0101018_439_1029 196
566 3300046794 Ga0495589_0380027 Ga0495589_0380027_10_627 196
567 3300046810 Ga0495660_0200610 Ga0495660_0200610_11_601 196
568 3300047315 Ga0495581_0009697 Ga0495581_0009697_2612_3217 196
569 3300047318 Ga0495636_0024287 Ga0495636_0024287_1768_2358 196
570 3300047319 Ga0495674_0006663 Ga0495674_0006663_6588_7193 196
571 3300047321 Ga0495676_0061833 Ga0495676_0061833_303_908 196
572 3300047321 Ga0495676_0355225 Ga0495676_0355225_308_913 196
573 3300047323 Ga0495683_0056095 Ga0495683_0056095_762_1379 196
574 3300047323 Ga0495683_0151357 Ga0495683_0151357_17_622 196
575 3300047445 Ga0495677_0069383 Ga0495677_0069383_133_738 196
576 3300047469 Ga0495673_0097114 Ga0495673_0097114_345_935 196
577 3300047469 Ga0495673_0102314 Ga0495673_0102314_77_679 196
578 3300047471 Ga0495684_0056700 Ga0495684_0056700_2158_2763 196
579 3300047673 Ga0495593_0054390 Ga0495593_0054390_172_777 196
580 3300048088 Ga0495602_0638478 Ga0495602_0638478_20_634 196
581 3300048091 Ga0495626_0248536 Ga0495626_0248536_38_643 196
582 3300048904 Ga0496101_0187069 Ga0496101_0187069_781_1386 196
583 3300048905 Ga0496102_0201748 Ga0496102_0201748_1178_1783 196
584 3300048905 Ga0496102_0216857 Ga0496102_0216857_704_1309 196
585 3300048905 Ga0496102_0255196 Ga0496102_0255196_610_1215 196
586 3300048905 Ga0496102_0413524 Ga0496102_0413524_389_994 196
587 3300048905 Ga0496102_0785450 Ga0496102_0785450_257_862 196
588 3300048907 Ga0496104_0000455 Ga0496104_0000455_5952_6557 196
589 3300048907 Ga0496104_0005057 Ga0496104_0005057_836_1441 196
590 3300048907 Ga0496104_0117619 Ga0496104_0117619_147_752 196
591 3300048908 Ga0496105_0010776 Ga0496105_0010776_451_1056 196
592 3300048908 Ga0496105_0037670 Ga0496105_0037670_621_1226 196
593 3300048908 Ga0496105_0178759 Ga0496105_0178759_800_1405 196
594 3300048909 Ga0496106_0044738 Ga0496106_0044738_2685_3290 196
595 3300048909 Ga0496106_0107800 Ga0496106_0107800_1409_2014 196
596 3300048910 Ga0496107_0305367 Ga0496107_0305367_509_1114 196
597 3300048910 Ga0496107_0313363 Ga0496107_0313363_354_959 196
598 3300048911 Ga0496108_0015938 Ga0496108_0015938_11_616 196
599 3300048911 Ga0496108_0112420 Ga0496108_0112420_1332_1922 196
600 3300048911 Ga0496108_0180704 Ga0496108_0180704_251_856 196
601 3300048911 Ga0496108_0566748 Ga0496108_0566748_259_864 196
602 3300048912 Ga0496109_0121071 Ga0496109_0121071_881_1486 196
603 3300048912 Ga0496109_0272678 Ga0496109_0272678_651_1256 196
604 3300048912 Ga0496109_0401789 Ga0496109_0401789_382_987 196
605 3300048912 Ga0496109_0579740 Ga0496109_0579740_456_1046 196
606 3300048912 Ga0496109_0965424 Ga0496109_0965424_139_744 196
607 3300048913 Ga0496110_0230430 Ga0496110_0230430_217_822 196
608 3300048913 Ga0496110_0253616 Ga0496110_0253616_872_1477 196
609 3300048913 Ga0496110_0453813 Ga0496110_0453813_62_667 196
610 3300048914 Ga0496111_0024078 Ga0496111_0024078_404_1009 196
611 3300048915 Ga0496112_0027379 Ga0496112_0027379_3779_4384 196
612 3300048915 Ga0496112_0046407 Ga0496112_0046407_248_853 196
613 3300048915 Ga0496112_0384768 Ga0496112_0384768_586_1188 196
614 3300048915 Ga0496112_0447924 Ga0496112_0447924_354_959 196
615 3300048915 Ga0496112_0858151 Ga0496112_0858151_206_811 196
616 3300048916 Ga0496113_0140581 Ga0496113_0140581_378_983 196
617 3300048916 Ga0496113_0313108 Ga0496113_0313108_397_987 196
618 3300048916 Ga0496113_0445439 Ga0496113_0445439_316_921 196
619 3300048918 Ga0496115_0339519 Ga0496115_0339519_154_759 196
620 3300048920 Ga0496117_0072127 Ga0496117_0072127_1538_2143 196
621 3300048921 Ga0496118_0124538 Ga0496118_0124538_53_658 196
622 3300048924 Ga0496121_0021902 Ga0496121_0021902_5061_5666 196
623 3300048924 Ga0496121_0032181 Ga0496121_0032181_3457_4047 196
624 3300048924 Ga0496121_0071645 Ga0496121_0071645_496_1101 196
625 3300048924 Ga0496121_0115929 Ga0496121_0115929_1230_1835 196
626 3300048924 Ga0496121_0119366 Ga0496121_0119366_1009_1614 196
627 3300048924 Ga0496121_0219012 Ga0496121_0219012_277_882 196
628 3300048927 Ga0496124_0031707 Ga0496124_0031707_291_896 196
629 3300048927 Ga0496124_0166271 Ga0496124_0166271_1070_1675 196
630 3300048928 Ga0496125_0118463 Ga0496125_0118463_1123_1728 196
631 3300048928 Ga0496125_0272969 Ga0496125_0272969_424_1029 196
632 3300048929 Ga0496126_0002882 Ga0496126_0002882_13443_14033 196
633 3300048929 Ga0496126_0024138 Ga0496126_0024138_1304_1909 196
634 3300048929 Ga0496126_0161527 Ga0496126_0161527_1050_1655 196
635 3300048929 Ga0496126_0351515 Ga0496126_0351515_486_1091 196
636 3300048929 Ga0496126_0503416 Ga0496126_0503416_265_870 196
637 3300049459 Ga0495678_125067 Ga0495678_125067_29_634 196
638 3300049460 Ga0495682_0032150 Ga0495682_0032150_414_1019 196
639 3300049460 Ga0495682_0133133 Ga0495682_0133133_94_699 196
640 3300049569 Ga0501032_0035101 Ga0501032_0035101_1853_2452 196
641 3300049569 Ga0501032_0075834 Ga0501032_0075834_259_858 196
642 3300049569 Ga0501032_0230429 Ga0501032_0230429_408_1007 196
643 3300049570 Ga0501033_0061106 Ga0501033_0061106_1628_2227 196
644 3300049570 Ga0501033_0143980 Ga0501033_0143980_463_1062 196
645 3300049571 Ga0501034_0002613 Ga0501034_0002613_16560_17153 196
646 3300049571 Ga0501034_0003588 Ga0501034_0003588_9904_10503 196
647 3300049571 Ga0501034_0035068 Ga0501034_0035068_222_821 196
648 3300049571 Ga0501034_0044712 Ga0501034_0044712_1814_2413 196
649 3300049571 Ga0501034_0055314 Ga0501034_0055314_1004_1603 196
650 3300049571 Ga0501034_0400357 Ga0501034_0400357_94_693 196
651 3300049571 Ga0501034_0413124 Ga0501034_0413124_548_1141 196
652 3300049572 Ga0501036_0006215 Ga0501036_0006215_6518_7117 196
653 3300049572 Ga0501036_0015237 Ga0501036_0015237_3707_4306 196
654 3300049572 Ga0501036_0026976 Ga0501036_0026976_1865_2464 196
655 3300049572 Ga0501036_0073361 Ga0501036_0073361_312_911 196
656 3300049573 Ga0501037_0028060 Ga0501037_0028060_1615_2310 196
657 3300049573 Ga0501037_0187236 Ga0501037_0187236_423_1022 196
658 3300049574 Ga0501038_0014508 Ga0501038_0014508_1481_2176 196
659 3300049574 Ga0501038_0086235 Ga0501038_0086235_1888_2487 196
660 3300049574 Ga0501038_0271682 Ga0501038_0271682_325_924 196
661 3300049575 Ga0501039_0022224 Ga0501039_0022224_400_999 196
662 3300049575 Ga0501039_0056203 Ga0501039_0056203_90_689 196
663 3300049579 Ga0501043_0009776 Ga0501043_0009776_2864_3559 196
664 3300049579 Ga0501043_0036285 Ga0501043_0036285_1775_2374 196
665 3300049579 Ga0501043_0146092 Ga0501043_0146092_488_1087 196
666 3300049579 Ga0501043_0256329 Ga0501043_0256329_611_1210 196
667 3300049580 Ga0501046_0051901 Ga0501046_0051901_1320_2015 196
668 3300049581 Ga0501047_0001425 Ga0501047_0001425_19936_20535 196
669 3300049581 Ga0501047_0021891 Ga0501047_0021891_3286_3885 196
670 3300049581 Ga0501047_0132514 Ga0501047_0132514_1057_1752 196
671 3300049582 Ga0501048_0006813 Ga0501048_0006813_7362_7961 196
672 3300049583 Ga0501067_0154817 Ga0501067_0154817_583_1188 196
673 3300049584 Ga0501068_0005284 Ga0501068_0005284_4458_5153 196
674 3300049584 Ga0501068_0295408 Ga0501068_0295408_222_821 196
675 3300049585 Ga0501069_0161095 Ga0501069_0161095_382_987 196
676 3300049585 Ga0501069_0344071 Ga0501069_0344071_29_628 196
677 3300049586 Ga0501070_0244203 Ga0501070_0244203_268_867 196
678 3300049586 Ga0501070_0796118 Ga0501070_0796118_66_665 196
679 3300049589 Ga0501073_0024463 Ga0501073_0024463_127_726 196
680 3300049589 Ga0501073_0051937 Ga0501073_0051937_978_1673 196
681 3300049589 Ga0501073_0084566 Ga0501073_0084566_58_657 196
682 3300049590 Ga0501074_0001697 Ga0501074_0001697_5681_6280 196
683 3300049590 Ga0501074_0073026 Ga0501074_0073026_591_1190 196
684 3300049590 Ga0501074_0245042 Ga0501074_0245042_93_692 196
685 3300049590 Ga0501074_0295137 Ga0501074_0295137_317_916 196
686 3300049592 Ga0501076_0224333 Ga0501076_0224333_799_1398 196
687 3300049741 Ga0501079_0511221 Ga0501079_0511221_253_852 196
688 3300049742 Ga0501080_0002496 Ga0501080_0002496_1185_1784 196
689 3300049742 Ga0501080_0372394 Ga0501080_0372394_441_1040 196
690 3300049742 Ga0501080_0807337 Ga0501080_0807337_70_669 196
691 3300049743 Ga0501081_0084008 Ga0501081_0084008_13_612 196
692 3300049744 Ga0501083_0000907 Ga0501083_0000907_18828_19427 196
693 3300049744 Ga0501083_0107294 Ga0501083_0107294_226_921 196
694 3300049822 Ga0501035_0027957 Ga0501035_0027957_2391_2990 196
695 3300049822 Ga0501035_0073122 Ga0501035_0073122_2350_2949 196
696 3300049822 Ga0501035_0204363 Ga0501035_0204363_13_612 196
697 3300049823 Ga0501044_0026561 Ga0501044_0026561_1221_1820 196
698 3300049823 Ga0501044_0098785 Ga0501044_0098785_175_774 196
699 3300049823 Ga0501044_0174599 Ga0501044_0174599_812_1411 196
700 3300049823 Ga0501044_0217238 Ga0501044_0217238_797_1396 196
701 3300049823 Ga0501044_0700303 Ga0501044_0700303_257_856 196
702 3300050489 nmdc:mga03683_141433_c1 nmdc:mga03683_141433_c1_452_1057 196
703 3300050490 nmdc:mga03n38_2816_c1 nmdc:mga03n38_2816_c1_3547_4152 196
704 3300050490 nmdc:mga03n38_357505_c1 nmdc:mga03n38_357505_c1_65_670 196
705 3300050491 nmdc:mga00v17_105962_c1 nmdc:mga00v17_105962_c1_326_931 196
706 3300050491 nmdc:mga00v17_376480_c1 nmdc:mga00v17_376480_c1_80_685 196
707 3300050491 nmdc:mga00v17_619266_c1 nmdc:mga00v17_619266_c1_23_628 196
708 3300050492 nmdc:mga0yw44_107934_c1 nmdc:mga0yw44_107934_c1_806_1411 196
709 3300050492 nmdc:mga0yw44_367753_c1 nmdc:mga0yw44_367753_c1_42_647 196
710 3300050492 nmdc:mga0yw44_46341_c1 nmdc:mga0yw44_46341_c1_920_1525 196
711 3300050492 nmdc:mga0yw44_56354_c1 nmdc:mga0yw44_56354_c1_1498_2103 196
712 3300050494 nmdc:mga06z11_116256_c1 nmdc:mga06z11_116256_c1_374_979 196
713 3300050494 nmdc:mga06z11_212962_c1 nmdc:mga06z11_212962_c1_100_705 196
714 3300050496 nmdc:mga07m45_12747_c1 nmdc:mga07m45_12747_c1_194_799 196
715 3300050496 nmdc:mga07m45_7177_c1 nmdc:mga07m45_7177_c1_1925_2530 196
716 3300050507 nmdc:mga05p37_933068_c1 nmdc:mga05p37_933068_c1_59_664 196
717 3300050509 nmdc:mga0qj67_533065_c1 nmdc:mga0qj67_533065_c1_21_698 196
718 3300050511 nmdc:mga08y16_653652_c1 nmdc:mga08y16_653652_c1_59_664 196
719 3300050512 nmdc:mga0n895_2683_c1 nmdc:mga0n895_2683_c1_2795_3400 196
720 3300050512 nmdc:mga0n895_828236_c1 nmdc:mga0n895_828236_c1_70_675 196
721 3300050513 nmdc:mga0rr50_202335_c1 nmdc:mga0rr50_202335_c1_666_1271 196
722 3300053077 Ga0495601_0508923 Ga0495601_0508923_70_675 196
723 3300053083 Ga0495655_0122076 Ga0495655_0122076_136_750 196
724 3300053087 Ga0500643_057111 Ga0500643_057111_116_721 196
725 3300053092 Ga0500583_0002146 Ga0500583_0002146_4175_4780 196
726 3300053096 Ga0500641_0010909 Ga0500641_0010909_782_1387 196
727 3300053096 Ga0500641_0032132 Ga0500641_0032132_513_1118 196
728 3300053098 Ga0500650_0102599 Ga0500650_0102599_473_1078 196
729 3300053108 Ga0500562_062741 Ga0500562_062741_64_669 196
730 3300053119 Ga0500595_026500 Ga0500595_026500_1351_1956 196
731 3300053130 Ga0500642_0042665 Ga0500642_0042665_680_1285 196
732 3300053133 Ga0500655_007057 Ga0500655_007057_705_1307 196
733 3300053134 Ga0500658_0108904 Ga0500658_0108904_242_847 196
734 3300053137 Ga0500561_0032548 Ga0500561_0032548_595_1200 196
735 3300053137 Ga0500561_0035092 Ga0500561_0035092_501_1106 196
736 3300053138 Ga0500564_224132 Ga0500564_224132_13_603 196
737 3300053142 Ga0500577_0041332 Ga0500577_0041332_389_994 196
738 3300053142 Ga0500577_0101939 Ga0500577_0101939_491_1108 196
739 3300053146 Ga0500588_0046310 Ga0500588_0046310_720_1325 196
740 3300053146 Ga0500588_0062429 Ga0500588_0062429_80_685 196
741 3300053151 Ga0500604_0029032 Ga0500604_0029032_429_1034 196
742 3300053158 Ga0500627_0082880 Ga0500627_0082880_464_1069 196
743 3300053161 Ga0500634_0088424 Ga0500634_0088424_18_623 196
744 3300053161 Ga0500634_0112562 Ga0500634_0112562_521_1126 196
745 3300053162 Ga0500638_204173 Ga0500638_204173_128_733 196
746 3300053178 Ga0500637_0061432 Ga0500637_0061432_647_1252 196
747 3300053731 Ga0500609_018439 Ga0500609_018439_193_798 196
748 3300053732 Ga0500656_016602 Ga0500656_016602_236_841 196
749 3300054114 Ga0501084_0818165 Ga0501084_0818165_107_706 196
750 3300060353 Ga0501082_0110947 Ga0501082_0110947_408_1007 196
751 3300060353 Ga0501082_0366631 Ga0501082_0366631_267_866 196
752 iso_pu_bacteria 2513237101 2513693407 196
753 iso_pu_bacteria 2513237104 2513715202 196
754 iso_pu_bacteria 2721755755 2723848320 196
755 iso_pu_bacteria 2791355199 2793079597 196
756 iso_pu_bacteria 2874604998 2874607466 196
757 iso_pu_bacteria 2876808645 2876814805 196
758 iso_pu_bacteria 2879110137 2879111053 196
759 iso_pu_bacteria 2889033259 2889037155 196
760 iso_pu_bacteria 2922386360 2922392916 196
761 iso_pu_bacteria 8006926726 8006928425 196
762 iso_pu_bacteria 8006964411 8006969624 196
763 iso_pu_bacteria 8006984368 8006990673 196
764 iso_pu_bacteria 8006994254 8006998701 196
765 iso_pu_bacteria 8056673599 8056676666 196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

38

132

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3awh-assembly1.cif.gz_B e13k mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) 0.807 38 149
2htd-assembly1.cif.gz_A crystal structure of a putative pyridoxamine 5'-phosphate oxidase (ldb0262) from lactobacillus delbrueckii subsp. at 1.60 a resolution 0.8059 28 146
7kpz-assembly1.cif.gz_A 1.70 a resolution crystal structure of group a streptococcus hupz-v5-his6 0.8052 31 147
1wli-assembly1.cif.gz_B l122y mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) 0.7991 44 149
2e83-assembly1.cif.gz_B t31v mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) 0.7961 44 149
ID Description Score Start End Superfamily
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8176 31 149 2.30.110.10
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8052 31 149 2.30.110.10
2htdA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8007 28 146 2.30.110.10
1wliA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7964 44 149 2.30.110.10
af_Q54YS6_26_227_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7938 43 130 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A537QQE2-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9692 2 193
AF-A0A4Y9RLZ5-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9604 2 172
AF-A0A433B166-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9597 2 188
AF-A0A0B7IS50-F1-model_v4 Pyridoxamine 5'-phosphate oxidase-related FMN-binding protein 0.9579 2 189
AF-A0A3N5H7Z0-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9569 2 188

Feature Viewer

pLDDT pTM Quality
89.93 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map