F479808
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 765 | 373 | 751 | 200 |
Family's Representative Sequence
| Representative Sequence | 3300050494|nmdc:mga06z11_34972_c1|nmdc:mga06z11_34972_c1_173_781 |
| Length | 202 |
| Sequence | MLMTDSKFYHDGNRRLQDRFESRKMADRQEKIITRTRFTDSDKSFIESARYFFLATADDKGRPDCSFKGGALGFVRVSGDSELAFPDFDGNGMFKSLGNIDINSEVGLLFIDFEKPRRLRVNGTASIRADDPLLAQTIGAQLIARVTARVIFPNCPRYIPTMNLAEESAYAPHAGRDFPEPAWKSFPEFADAVHPRQPTFKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 3 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 4 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 5 | 2791355199 | |||
| 6 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 7 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 8 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 9 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 10 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 11 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 12 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 13 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 17 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 122 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 183 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 184 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 185 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 187 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 188 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 189 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 191 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 192 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 194 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 200 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 201 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 202 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 204 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 208 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 209 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 211 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 213 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 214 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 215 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 216 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 217 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 222 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 223 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 224 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 225 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 226 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 227 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 288 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 289 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 290 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 291 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 292 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 295 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 296 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 297 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 298 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 299 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 300 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 301 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 302 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 303 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 304 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 305 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 306 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 333 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 334 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 335 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 336 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 337 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 338 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 339 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 347 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 348 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 349 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 350 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 351 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 352 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 353 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 354 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 355 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 356 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 357 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 358 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 359 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 360 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 361 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 362 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 363 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 364 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 365 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 366 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 367 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 370 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 371 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 372 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 373 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.17 |
| Metatranscriptomes | 0.13 |
| Isolates | 1.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.63 |
| Nodule | 1.18 |
| Rhizoplane | 8.24 |
| Rhizosphere | 77.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_FSXC51428_g1 | 2010549000 | Bacteria | 785 |
| 2 | JGI25406J46586_10052595 | 3300003203 | Bacteria | 1356 |
| 3 | JGI25404J52841_10002782 | 3300003659 | Bacteria | 3369 |
| 4 | JGI25404J52841_10046768 | 3300003659 | Bacteria | 912 |
| 5 | JGI25405J52794_10016817 | 3300003911 | Bacteria | 1447 |
| 6 | JGI25405J52794_10023307 | 3300003911 | Bacteria | 1259 |
| 7 | Ga0065714_10237102 | 3300005288 | Bacteria | 803 |
| 8 | Ga0065704_10140531 | 3300005289 | Bacteria | 1522 |
| 9 | Ga0065712_10175080 | 3300005290 | Bacteria | 1222 |
| 10 | Ga0065715_10120354 | 3300005293 | Bacteria | 2260 |
| 11 | Ga0070683_100053329 | 3300005329 | Bacteria | 3747 |
| 12 | Ga0070683_100415541 | 3300005329 | Unclassified | 1283 |
| 13 | Ga0070683_100660189 | 3300005329 | Unclassified | 1001 |
| 14 | Ga0070690_100002833 | 3300005330 | Bacteria | 9352 |
| 15 | Ga0070670_100126286 | 3300005331 | Bacteria | 2208 |
| 16 | Ga0068869_100030484 | 3300005334 | Bacteria | 3786 |
| 17 | Ga0068869_100034418 | 3300005334 | Bacteria | 3583 |
| 18 | Ga0068869_100088480 | 3300005334 | Bacteria | 2324 |
| 19 | Ga0068869_100471785 | 3300005334 | Bacteria | 1043 |
| 20 | Ga0070666_10012049 | 3300005335 | Bacteria | 5444 |
| 21 | Ga0070666_10259335 | 3300005335 | Bacteria | 1232 |
| 22 | Ga0070680_100027574 | 3300005336 | Bacteria | 4548 |
| 23 | Ga0070682_100613571 | 3300005337 | Bacteria | 861 |
| 24 | Ga0068868_100021301 | 3300005338 | Bacteria | 4882 |
| 25 | Ga0068868_100149682 | 3300005338 | Bacteria | 1921 |
| 26 | Ga0068868_100405084 | 3300005338 | Bacteria | 1178 |
| 27 | Ga0068868_100473338 | 3300005338 | Bacteria | 1093 |
| 28 | Ga0070689_100021328 | 3300005340 | Bacteria | 4822 |
| 29 | Ga0070689_100804630 | 3300005340 | Bacteria | 827 |
| 30 | Ga0070687_100285783 | 3300005343 | Bacteria | 1040 |
| 31 | Ga0070687_100348957 | 3300005343 | Unclassified | 954 |
| 32 | Ga0070661_100236318 | 3300005344 | Bacteria | 1406 |
| 33 | Ga0070661_100324465 | 3300005344 | Bacteria | 1203 |
| 34 | Ga0070668_100092246 | 3300005347 | Bacteria | 2388 |
| 35 | Ga0070668_100294907 | 3300005347 | Bacteria | 1358 |
| 36 | Ga0070668_100320161 | 3300005347 | Bacteria | 1305 |
| 37 | Ga0070668_100613835 | 3300005347 | Bacteria | 953 |
| 38 | Ga0070669_100194042 | 3300005353 | Bacteria | 1594 |
| 39 | Ga0070669_100420547 | 3300005353 | Bacteria | 1097 |
| 40 | Ga0070675_100005627 | 3300005354 | Bacteria | 9594 |
| 41 | Ga0070675_100436575 | 3300005354 | Bacteria | 1173 |
| 42 | Ga0070675_100458952 | 3300005354 | Bacteria | 1143 |
| 43 | Ga0070671_100026147 | 3300005355 | Bacteria | 4795 |
| 44 | Ga0070671_100027269 | 3300005355 | Bacteria | 4699 |
| 45 | Ga0070671_101128349 | 3300005355 | Bacteria | 689 |
| 46 | Ga0070688_100270038 | 3300005365 | Bacteria | 1218 |
| 47 | Ga0070667_100002110 | 3300005367 | Bacteria | 17526 |
| 48 | Ga0070667_100292316 | 3300005367 | Bacteria | 1465 |
| 49 | Ga0070667_100340826 | 3300005367 | Bacteria | 1356 |
| 50 | Ga0070713_100009110 | 3300005436 | Bacteria | 7080 |
| 51 | Ga0070701_10386107 | 3300005438 | Bacteria | 884 |
| 52 | Ga0070711_100617199 | 3300005439 | Unclassified | 906 |
| 53 | Ga0070700_100280686 | 3300005441 | Bacteria | 1207 |
| 54 | Ga0070700_100320937 | 3300005441 | Bacteria | 1138 |
| 55 | Ga0070694_100015646 | 3300005444 | Bacteria | 4767 |
| 56 | Ga0070694_100230989 | 3300005444 | Bacteria | 1392 |
| 57 | Ga0070663_100000663 | 3300005455 | Bacteria | 18514 |
| 58 | Ga0070663_100027475 | 3300005455 | Bacteria | 3865 |
| 59 | Ga0070663_100126626 | 3300005455 | Bacteria | 1935 |
| 60 | Ga0070663_100206539 | 3300005455 | Bacteria | 1536 |
| 61 | Ga0070678_100006375 | 3300005456 | Bacteria | 6923 |
| 62 | Ga0070678_100007982 | 3300005456 | Bacteria | 6309 |
| 63 | Ga0070678_100223344 | 3300005456 | Bacteria | 1567 |
| 64 | Ga0070662_100036998 | 3300005457 | Bacteria | 3458 |
| 65 | Ga0070662_100084095 | 3300005457 | Bacteria | 2376 |
| 66 | Ga0070662_100562287 | 3300005457 | Bacteria | 957 |
| 67 | Ga0070681_10087171 | 3300005458 | Bacteria | 3075 |
| 68 | Ga0070681_10411824 | 3300005458 | Bacteria | 1263 |
| 69 | Ga0068867_100141596 | 3300005459 | Bacteria | 1880 |
| 70 | Ga0068867_100186927 | 3300005459 | Bacteria | 1651 |
| 71 | Ga0070685_10084517 | 3300005466 | Bacteria | 1909 |
| 72 | Ga0070685_10331330 | 3300005466 | Bacteria | 1035 |
| 73 | Ga0070706_101040308 | 3300005467 | Bacteria | 755 |
| 74 | Ga0070707_100068164 | 3300005468 | Bacteria | 3424 |
| 75 | Ga0070698_100150659 | 3300005471 | Bacteria | 2274 |
| 76 | Ga0070699_100152211 | 3300005518 | Bacteria | 2046 |
| 77 | Ga0070679_100093183 | 3300005530 | Bacteria | 3000 |
| 78 | Ga0070679_100175359 | 3300005530 | Bacteria | 2116 |
| 79 | Ga0070684_100123045 | 3300005535 | Bacteria | 2335 |
| 80 | Ga0070684_100287374 | 3300005535 | Bacteria | 1507 |
| 81 | Ga0070684_100423553 | 3300005535 | Bacteria | 1229 |
| 82 | Ga0068853_100040290 | 3300005539 | Bacteria | 3986 |
| 83 | Ga0070672_100107034 | 3300005543 | Bacteria | 2275 |
| 84 | Ga0070672_100245803 | 3300005543 | Bacteria | 1506 |
| 85 | Ga0070672_100358104 | 3300005543 | Bacteria | 1245 |
| 86 | Ga0070686_100353989 | 3300005544 | Bacteria | 1104 |
| 87 | Ga0070686_100412334 | 3300005544 | Bacteria | 1030 |
| 88 | Ga0070695_100827146 | 3300005545 | Bacteria | 744 |
| 89 | Ga0070696_100110763 | 3300005546 | Bacteria | 1977 |
| 90 | Ga0070693_100045221 | 3300005547 | Bacteria | 2494 |
| 91 | Ga0070693_100694159 | 3300005547 | Unclassified | 744 |
| 92 | Ga0070665_100003746 | 3300005548 | Bacteria | 16097 |
| 93 | Ga0070665_100005052 | 3300005548 | Bacteria | 13691 |
| 94 | Ga0070665_100013563 | 3300005548 | Bacteria | 8199 |
| 95 | Ga0070665_100021610 | 3300005548 | Bacteria | 6470 |
| 96 | Ga0070665_100058396 | 3300005548 | Bacteria | 3868 |
| 97 | Ga0070665_100166352 | 3300005548 | Bacteria | 2207 |
| 98 | Ga0070665_100576060 | 3300005548 | Bacteria | 1138 |
| 99 | Ga0070665_101268858 | 3300005548 | Bacteria | 747 |
| 100 | Ga0070704_100745055 | 3300005549 | Bacteria | 872 |
| 101 | Ga0068855_100115683 | 3300005563 | Bacteria | 3074 |
| 102 | Ga0068855_100180870 | 3300005563 | Bacteria | 2384 |
| 103 | Ga0068855_100247630 | 3300005563 | Bacteria | 1989 |
| 104 | Ga0068855_100571795 | 3300005563 | Bacteria | 1221 |
| 105 | Ga0068855_100710466 | 3300005563 | Bacteria | 1075 |
| 106 | Ga0070664_100686855 | 3300005564 | Bacteria | 953 |
| 107 | Ga0070664_100793366 | 3300005564 | Bacteria | 885 |
| 108 | Ga0070664_100825307 | 3300005564 | Bacteria | 868 |
| 109 | Ga0068857_100458960 | 3300005577 | Bacteria | 1192 |
| 110 | Ga0068854_100981029 | 3300005578 | Bacteria | 747 |
| 111 | Ga0068856_100014477 | 3300005614 | Bacteria | 7618 |
| 112 | Ga0068856_100560696 | 3300005614 | Bacteria | 1164 |
| 113 | Ga0068852_100015964 | 3300005616 | Bacteria | 5845 |
| 114 | Ga0068852_100061095 | 3300005616 | Bacteria | 3274 |
| 115 | Ga0068852_100176258 | 3300005616 | Bacteria | 2008 |
| 116 | Ga0068852_100501466 | 3300005616 | Bacteria | 1209 |
| 117 | Ga0068859_100032269 | 3300005617 | Bacteria | 5261 |
| 118 | Ga0068859_100051481 | 3300005617 | Bacteria | 4139 |
| 119 | Ga0068859_100275026 | 3300005617 | Bacteria | 1776 |
| 120 | Ga0068859_100565676 | 3300005617 | Bacteria | 1231 |
| 121 | Ga0068859_101200343 | 3300005617 | Bacteria | 836 |
| 122 | Ga0068864_100015563 | 3300005618 | Bacteria | 6326 |
| 123 | Ga0068864_100073770 | 3300005618 | Bacteria | 2975 |
| 124 | Ga0068864_100258536 | 3300005618 | Bacteria | 1619 |
| 125 | Ga0068864_100411786 | 3300005618 | Bacteria | 1286 |
| 126 | Ga0068861_100026034 | 3300005719 | Bacteria | 4248 |
| 127 | Ga0068861_100143367 | 3300005719 | Bacteria | 1952 |
| 128 | Ga0068861_100250239 | 3300005719 | Bacteria | 1511 |
| 129 | Ga0068861_100439447 | 3300005719 | Bacteria | 1166 |
| 130 | Ga0068861_100885039 | 3300005719 | Bacteria | 844 |
| 131 | Ga0068851_10013989 | 3300005834 | Bacteria | 3803 |
| 132 | Ga0068870_10078086 | 3300005840 | Bacteria | 1823 |
| 133 | Ga0068870_10095281 | 3300005840 | Bacteria | 1672 |
| 134 | Ga0068870_10145875 | 3300005840 | Bacteria | 1389 |
| 135 | Ga0068863_100005866 | 3300005841 | Bacteria | 12031 |
| 136 | Ga0068863_100515556 | 3300005841 | Bacteria | 1178 |
| 137 | Ga0068863_100796310 | 3300005841 | Bacteria | 943 |
| 138 | Ga0068858_100000211 | 3300005842 | Bacteria | 63065 |
| 139 | Ga0068858_100070599 | 3300005842 | Bacteria | 3237 |
| 140 | Ga0068860_100011349 | 3300005843 | Bacteria | 8779 |
| 141 | Ga0068860_100094666 | 3300005843 | Bacteria | 2847 |
| 142 | Ga0068860_100423660 | 3300005843 | Bacteria | 1320 |
| 143 | Ga0068860_100460289 | 3300005843 | Bacteria | 1266 |
| 144 | Ga0068860_100501587 | 3300005843 | Bacteria | 1212 |
| 145 | Ga0068860_100738025 | 3300005843 | Bacteria | 996 |
| 146 | Ga0068862_100040067 | 3300005844 | Bacteria | 3981 |
| 147 | Ga0068862_100107140 | 3300005844 | Bacteria | 2450 |
| 148 | Ga0068862_100180060 | 3300005844 | Bacteria | 1896 |
| 149 | Ga0081455_10003425 | 3300005937 | Bacteria | 18237 |
| 150 | Ga0081455_10006252 | 3300005937 | Bacteria | 12820 |
| 151 | Ga0081455_10009461 | 3300005937 | Bacteria | 10024 |
| 152 | Ga0081455_10024092 | 3300005937 | Bacteria | 5646 |
| 153 | Ga0081455_10048280 | 3300005937 | Bacteria | 3680 |
| 154 | Ga0081455_10070721 | 3300005937 | Bacteria | 2896 |
| 155 | Ga0081455_10071950 | 3300005937 | Bacteria | 2865 |
| 156 | Ga0081540_1002589 | 3300005983 | Bacteria | 14689 |
| 157 | Ga0081540_1003572 | 3300005983 | Bacteria | 12223 |
| 158 | Ga0081540_1006855 | 3300005983 | Bacteria | 8223 |
| 159 | Ga0081540_1011161 | 3300005983 | Bacteria | 6029 |
| 160 | Ga0081540_1026873 | 3300005983 | Bacteria | 3275 |
| 161 | Ga0081539_10002583 | 3300005985 | Bacteria | 24993 |
| 162 | Ga0081539_10018896 | 3300005985 | Bacteria | 4748 |
| 163 | Ga0075365_10055643 | 3300006038 | Bacteria | 2627 |
| 164 | Ga0075365_10092443 | 3300006038 | Bacteria | 2062 |
| 165 | Ga0075365_10189150 | 3300006038 | Bacteria | 1440 |
| 166 | Ga0075365_10479373 | 3300006038 | Bacteria | 879 |
| 167 | Ga0075368_10051984 | 3300006042 | Bacteria | 1629 |
| 168 | Ga0075363_100004914 | 3300006048 | Bacteria | 5910 |
| 169 | Ga0075363_100028673 | 3300006048 | Bacteria | 2866 |
| 170 | Ga0075363_100222221 | 3300006048 | Bacteria | 1083 |
| 171 | Ga0070716_100128067 | 3300006173 | Bacteria | 1600 |
| 172 | Ga0070712_100138063 | 3300006175 | Bacteria | 1856 |
| 173 | Ga0075362_10207489 | 3300006177 | Bacteria | 955 |
| 174 | Ga0075367_10094859 | 3300006178 | Bacteria | 1819 |
| 175 | Ga0075367_10157099 | 3300006178 | Bacteria | 1413 |
| 176 | Ga0075367_10180627 | 3300006178 | Bacteria | 1315 |
| 177 | Ga0075367_10708293 | 3300006178 | Bacteria | 640 |
| 178 | Ga0075369_10004778 | 3300006186 | Bacteria | 5035 |
| 179 | Ga0075366_10109826 | 3300006195 | Bacteria | 1658 |
| 180 | Ga0097621_100110397 | 3300006237 | Bacteria | 2323 |
| 181 | Ga0097621_100143301 | 3300006237 | Bacteria | 2043 |
| 182 | Ga0075370_10002046 | 3300006353 | Bacteria | 9161 |
| 183 | Ga0075370_10008551 | 3300006353 | Bacteria | 5274 |
| 184 | Ga0075370_10020184 | 3300006353 | Bacteria | 3638 |
| 185 | Ga0068871_100024943 | 3300006358 | Bacteria | 4645 |
| 186 | Ga0068871_100475191 | 3300006358 | Bacteria | 1124 |
| 187 | Ga0075428_100092094 | 3300006844 | Bacteria | 3305 |
| 188 | Ga0075433_10384723 | 3300006852 | Bacteria | 1238 |
| 189 | Ga0075434_100003708 | 3300006871 | Bacteria | 13645 |
| 190 | Ga0075434_100128231 | 3300006871 | Bacteria | 2554 |
| 191 | Ga0097620_100032269 | 3300006931 | Bacteria | 5261 |
| 192 | Ga0097620_100051481 | 3300006931 | Bacteria | 4139 |
| 193 | Ga0097620_100275013 | 3300006931 | Bacteria | 1776 |
| 194 | Ga0097620_100565678 | 3300006931 | Bacteria | 1231 |
| 195 | Ga0097620_101200356 | 3300006931 | Bacteria | 836 |
| 196 | Ga0075435_100207898 | 3300007076 | Bacteria | 1659 |
| 197 | Ga0075435_100215375 | 3300007076 | Bacteria | 1630 |
| 198 | Ga0105250_10016274 | 3300009092 | Bacteria | 3033 |
| 199 | Ga0105240_10153104 | 3300009093 | Bacteria | 2745 |
| 200 | Ga0105240_10198229 | 3300009093 | Bacteria | 2355 |
| 201 | Ga0105240_10224340 | 3300009093 | Bacteria | 2187 |
| 202 | Ga0105240_10444344 | 3300009093 | Bacteria | 1452 |
| 203 | Ga0105240_11452491 | 3300009093 | Unclassified | 720 |
| 204 | Ga0105247_10267963 | 3300009101 | Bacteria | 1173 |
| 205 | Ga0114129_10264694 | 3300009147 | Bacteria | 2302 |
| 206 | Ga0105243_10201681 | 3300009148 | Bacteria | 1745 |
| 207 | Ga0105241_10221598 | 3300009174 | Bacteria | 1590 |
| 208 | Ga0105241_10474542 | 3300009174 | Bacteria | 1111 |
| 209 | Ga0105242_10714652 | 3300009176 | Bacteria | 982 |
| 210 | Ga0105248_10088569 | 3300009177 | Bacteria | 3484 |
| 211 | Ga0105248_10102374 | 3300009177 | Bacteria | 3228 |
| 212 | Ga0105248_10389701 | 3300009177 | Bacteria | 1569 |
| 213 | Ga0105248_10569824 | 3300009177 | Bacteria | 1277 |
| 214 | Ga0105237_10068817 | 3300009545 | Bacteria | 3534 |
| 215 | Ga0105237_10171890 | 3300009545 | Bacteria | 2167 |
| 216 | Ga0105237_10394184 | 3300009545 | Bacteria | 1389 |
| 217 | Ga0105237_10761259 | 3300009545 | Bacteria | 975 |
| 218 | Ga0105237_10775764 | 3300009545 | Bacteria | 965 |
| 219 | Ga0105238_10017485 | 3300009551 | Bacteria | 7290 |
| 220 | Ga0105238_10229451 | 3300009551 | Bacteria | 1833 |
| 221 | Ga0105249_10133162 | 3300009553 | Bacteria | 2375 |
| 222 | Ga0105249_10169566 | 3300009553 | Bacteria | 2116 |
| 223 | Ga0105249_10219019 | 3300009553 | Bacteria | 1872 |
| 224 | Ga0105239_10047197 | 3300010375 | Bacteria | 4720 |
| 225 | Ga0105239_10133341 | 3300010375 | Bacteria | 2764 |
| 226 | Ga0105239_10215187 | 3300010375 | Bacteria | 2154 |
| 227 | Ga0105239_10302971 | 3300010375 | Bacteria | 1800 |
| 228 | Ga0105239_10362312 | 3300010375 | Bacteria | 1637 |
| 229 | Ga0105246_10326682 | 3300011119 | Bacteria | 1249 |
| 230 | Ga0157373_10290412 | 3300013100 | Bacteria | 1160 |
| 231 | Ga0157369_10516107 | 3300013105 | Bacteria | 1236 |
| 232 | Ga0157369_10540521 | 3300013105 | Unclassified | 1205 |
| 233 | Ga0157374_10004632 | 3300013296 | Bacteria | 11535 |
| 234 | Ga0157374_10149275 | 3300013296 | Bacteria | 2272 |
| 235 | Ga0157378_10031169 | 3300013297 | Bacteria | 4710 |
| 236 | Ga0157378_10059250 | 3300013297 | Bacteria | 3416 |
| 237 | Ga0157378_10792627 | 3300013297 | Bacteria | 973 |
| 238 | Ga0157378_10981845 | 3300013297 | Bacteria | 878 |
| 239 | Ga0163162_10015806 | 3300013306 | Bacteria | 7375 |
| 240 | Ga0163162_10186822 | 3300013306 | Bacteria | 2199 |
| 241 | Ga0163162_10217359 | 3300013306 | Bacteria | 2041 |
| 242 | Ga0163162_10334057 | 3300013306 | Bacteria | 1648 |
| 243 | Ga0163162_10410185 | 3300013306 | Bacteria | 1487 |
| 244 | Ga0163162_10870477 | 3300013306 | Unclassified | 1015 |
| 245 | Ga0157372_10199994 | 3300013307 | Bacteria | 2314 |
| 246 | Ga0157372_11767797 | 3300013307 | Bacteria | 711 |
| 247 | Ga0157375_10184239 | 3300013308 | Bacteria | 2240 |
| 248 | Ga0157375_10423925 | 3300013308 | Bacteria | 1496 |
| 249 | Ga0157375_10480094 | 3300013308 | Bacteria | 1408 |
| 250 | Ga0163163_10002661 | 3300014325 | Bacteria | 15120 |
| 251 | Ga0163163_10044505 | 3300014325 | Bacteria | 4355 |
| 252 | Ga0163163_10069006 | 3300014325 | Bacteria | 3519 |
| 253 | Ga0163163_10733183 | 3300014325 | Bacteria | 1052 |
| 254 | Ga0163163_10751419 | 3300014325 | Bacteria | 1039 |
| 255 | Ga0157380_10268008 | 3300014326 | Bacteria | 1555 |
| 256 | Ga0157380_10313916 | 3300014326 | Bacteria | 1450 |
| 257 | Ga0157380_10475524 | 3300014326 | Bacteria | 1207 |
| 258 | Ga0157380_10803615 | 3300014326 | Bacteria | 958 |
| 259 | Ga0157380_10929236 | 3300014326 | Bacteria | 898 |
| 260 | Ga0157380_11531070 | 3300014326 | Bacteria | 721 |
| 261 | Ga0157379_10033950 | 3300014968 | Bacteria | 4548 |
| 262 | Ga0157379_10050930 | 3300014968 | Bacteria | 3697 |
| 263 | Ga0157379_10153593 | 3300014968 | Bacteria | 2076 |
| 264 | Ga0157379_10793632 | 3300014968 | Bacteria | 893 |
| 265 | Ga0157376_10142716 | 3300014969 | Bacteria | 2150 |
| 266 | Ga0157376_10166202 | 3300014969 | Bacteria | 2005 |
| 267 | Ga0157376_10280747 | 3300014969 | Unclassified | 1568 |
| 268 | Ga0163161_10074398 | 3300017792 | Bacteria | 2491 |
| 269 | Ga0163161_10330622 | 3300017792 | Bacteria | 1207 |
| 270 | Ga0163161_10372823 | 3300017792 | Bacteria | 1139 |
| 271 | Ga0206356_11851354 | 3300020070 | Bacteria | 830 |
| 272 | Ga0213876_10111656 | 3300021384 | Unclassified | 1451 |
| 273 | Ga0209758_1004341 | 3300025297 | Bacteria | 11878 |
| 274 | Ga0207426_1029550 | 3300025302 | Bacteria | 1805 |
| 275 | Ga0207696_1022535 | 3300025711 | Bacteria | 2000 |
| 276 | Ga0207682_10058557 | 3300025893 | Bacteria | 1608 |
| 277 | Ga0207682_10119786 | 3300025893 | Bacteria | 1166 |
| 278 | Ga0207710_10358433 | 3300025900 | Bacteria | 744 |
| 279 | Ga0207688_10027816 | 3300025901 | Bacteria | 3110 |
| 280 | Ga0207680_10005653 | 3300025903 | Bacteria | 5982 |
| 281 | Ga0207680_10405432 | 3300025903 | Bacteria | 964 |
| 282 | Ga0207647_10157200 | 3300025904 | Bacteria | 1327 |
| 283 | Ga0207699_10084532 | 3300025906 | Bacteria | 1977 |
| 284 | Ga0207643_10058362 | 3300025908 | Bacteria | 2199 |
| 285 | Ga0207643_10060125 | 3300025908 | Bacteria | 2169 |
| 286 | Ga0207643_10174637 | 3300025908 | Bacteria | 1298 |
| 287 | Ga0207654_10008634 | 3300025911 | Bacteria | 5163 |
| 288 | Ga0207707_10001660 | 3300025912 | Bacteria | 20546 |
| 289 | Ga0207707_10015879 | 3300025912 | Bacteria | 6567 |
| 290 | Ga0207707_10076954 | 3300025912 | Bacteria | 2912 |
| 291 | Ga0207707_10394135 | 3300025912 | Bacteria | 1189 |
| 292 | Ga0207707_10597119 | 3300025912 | Unclassified | 935 |
| 293 | Ga0207695_10151168 | 3300025913 | Bacteria | 2261 |
| 294 | Ga0207695_10332619 | 3300025913 | Bacteria | 1407 |
| 295 | Ga0207695_10340514 | 3300025913 | Unclassified | 1387 |
| 296 | Ga0207671_10216444 | 3300025914 | Bacteria | 1500 |
| 297 | Ga0207671_10599692 | 3300025914 | Bacteria | 878 |
| 298 | Ga0207693_10205926 | 3300025915 | Bacteria | 1547 |
| 299 | Ga0207663_10550677 | 3300025916 | Unclassified | 902 |
| 300 | Ga0207660_10218833 | 3300025917 | Bacteria | 1494 |
| 301 | Ga0207662_10115789 | 3300025918 | Bacteria | 1676 |
| 302 | Ga0207652_10010980 | 3300025921 | Bacteria | 7302 |
| 303 | Ga0207652_10032578 | 3300025921 | Bacteria | 4383 |
| 304 | Ga0207646_10129621 | 3300025922 | Bacteria | 2270 |
| 305 | Ga0207681_10129706 | 3300025923 | Bacteria | 1862 |
| 306 | Ga0207681_10156311 | 3300025923 | Bacteria | 1714 |
| 307 | Ga0207681_10350734 | 3300025923 | Bacteria | 1181 |
| 308 | Ga0207681_10595574 | 3300025923 | Bacteria | 913 |
| 309 | Ga0207694_10095565 | 3300025924 | Bacteria | 2349 |
| 310 | Ga0207694_10159873 | 3300025924 | Bacteria | 1819 |
| 311 | Ga0207694_10211011 | 3300025924 | Bacteria | 1582 |
| 312 | Ga0207694_10441783 | 3300025924 | Bacteria | 1085 |
| 313 | Ga0207694_10808162 | 3300025924 | Bacteria | 792 |
| 314 | Ga0207650_10103167 | 3300025925 | Bacteria | 2198 |
| 315 | Ga0207650_10468774 | 3300025925 | Bacteria | 1050 |
| 316 | Ga0207659_10002563 | 3300025926 | Bacteria | 10813 |
| 317 | Ga0207700_10418202 | 3300025928 | Bacteria | 1177 |
| 318 | Ga0207644_10088712 | 3300025931 | Bacteria | 2301 |
| 319 | Ga0207644_10089818 | 3300025931 | Bacteria | 2287 |
| 320 | Ga0207644_10287175 | 3300025931 | Bacteria | 1322 |
| 321 | Ga0207644_10818499 | 3300025931 | Bacteria | 779 |
| 322 | Ga0207706_10026350 | 3300025933 | Bacteria | 5204 |
| 323 | Ga0207706_10091005 | 3300025933 | Bacteria | 2682 |
| 324 | Ga0207706_10271770 | 3300025933 | Bacteria | 1479 |
| 325 | Ga0207686_10143974 | 3300025934 | Bacteria | 1651 |
| 326 | Ga0207686_10311154 | 3300025934 | Bacteria | 1173 |
| 327 | Ga0207709_10058106 | 3300025935 | Bacteria | 2402 |
| 328 | Ga0207670_10024373 | 3300025936 | Bacteria | 3781 |
| 329 | Ga0207704_10081930 | 3300025938 | Bacteria | 2089 |
| 330 | Ga0207704_10583100 | 3300025938 | Bacteria | 913 |
| 331 | Ga0207665_10657500 | 3300025939 | Bacteria | 822 |
| 332 | Ga0207691_10017874 | 3300025940 | Bacteria | 6719 |
| 333 | Ga0207711_10006607 | 3300025941 | Bacteria | 9769 |
| 334 | Ga0207711_10182111 | 3300025941 | Bacteria | 1911 |
| 335 | Ga0207711_10289267 | 3300025941 | Bacteria | 1510 |
| 336 | Ga0207689_10035700 | 3300025942 | Bacteria | 4129 |
| 337 | Ga0207689_10043430 | 3300025942 | Bacteria | 3716 |
| 338 | Ga0207689_10045810 | 3300025942 | Bacteria | 3616 |
| 339 | Ga0207689_10089402 | 3300025942 | Bacteria | 2530 |
| 340 | Ga0207661_10002756 | 3300025944 | Bacteria | 12095 |
| 341 | Ga0207661_10462469 | 3300025944 | Bacteria | 1156 |
| 342 | Ga0207679_10124908 | 3300025945 | Bacteria | 2055 |
| 343 | Ga0207679_10296276 | 3300025945 | Bacteria | 1392 |
| 344 | Ga0207679_10718905 | 3300025945 | Bacteria | 907 |
| 345 | Ga0207667_10088183 | 3300025949 | Bacteria | 3209 |
| 346 | Ga0207667_10205767 | 3300025949 | Bacteria | 2018 |
| 347 | Ga0207667_10423973 | 3300025949 | Bacteria | 1353 |
| 348 | Ga0207667_10878329 | 3300025949 | Bacteria | 890 |
| 349 | Ga0207651_10000121 | 3300025960 | Bacteria | 33342 |
| 350 | Ga0207651_10240513 | 3300025960 | Bacteria | 1475 |
| 351 | Ga0207712_10194454 | 3300025961 | Bacteria | 1603 |
| 352 | Ga0207712_10217730 | 3300025961 | Bacteria | 1525 |
| 353 | Ga0207712_10486238 | 3300025961 | Bacteria | 1053 |
| 354 | Ga0207668_10022231 | 3300025972 | Bacteria | 4056 |
| 355 | Ga0207668_10058829 | 3300025972 | Bacteria | 2688 |
| 356 | Ga0207668_10100477 | 3300025972 | Bacteria | 2148 |
| 357 | Ga0207668_10240126 | 3300025972 | Bacteria | 1465 |
| 358 | Ga0207640_10113733 | 3300025981 | Bacteria | 1924 |
| 359 | Ga0207658_10000984 | 3300025986 | Bacteria | 23515 |
| 360 | Ga0207658_10181495 | 3300025986 | Bacteria | 1742 |
| 361 | Ga0207658_10572006 | 3300025986 | Bacteria | 1013 |
| 362 | Ga0207677_10055045 | 3300026023 | Bacteria | 2718 |
| 363 | Ga0207677_10215138 | 3300026023 | Bacteria | 1538 |
| 364 | Ga0207677_10854007 | 3300026023 | Bacteria | 818 |
| 365 | Ga0207703_10002258 | 3300026035 | Bacteria | 16841 |
| 366 | Ga0207703_10023501 | 3300026035 | Bacteria | 4843 |
| 367 | Ga0207703_10102794 | 3300026035 | Bacteria | 2425 |
| 368 | Ga0207703_10141311 | 3300026035 | Bacteria | 2090 |
| 369 | Ga0207703_10530675 | 3300026035 | Bacteria | 1108 |
| 370 | Ga0207703_10660512 | 3300026035 | Bacteria | 992 |
| 371 | Ga0207639_10180677 | 3300026041 | Bacteria | 1794 |
| 372 | Ga0207639_10183016 | 3300026041 | Unclassified | 1784 |
| 373 | Ga0207678_10002185 | 3300026067 | Bacteria | 17669 |
| 374 | Ga0207678_10088427 | 3300026067 | Bacteria | 2648 |
| 375 | Ga0207678_10091352 | 3300026067 | Bacteria | 2602 |
| 376 | Ga0207678_10157606 | 3300026067 | Bacteria | 1938 |
| 377 | Ga0207678_10236692 | 3300026067 | Bacteria | 1564 |
| 378 | Ga0207708_10224149 | 3300026075 | Bacteria | 1507 |
| 379 | Ga0207708_10386140 | 3300026075 | Bacteria | 1155 |
| 380 | Ga0207702_10225436 | 3300026078 | Bacteria | 1748 |
| 381 | Ga0207641_10002109 | 3300026088 | Bacteria | 18804 |
| 382 | Ga0207641_10232595 | 3300026088 | Bacteria | 1714 |
| 383 | Ga0207641_11078432 | 3300026088 | Unclassified | 801 |
| 384 | Ga0207648_10096093 | 3300026089 | Bacteria | 2593 |
| 385 | Ga0207648_11409865 | 3300026089 | Bacteria | 655 |
| 386 | Ga0207676_10000749 | 3300026095 | Bacteria | 25458 |
| 387 | Ga0207676_10057588 | 3300026095 | Bacteria | 3061 |
| 388 | Ga0207676_10235579 | 3300026095 | Bacteria | 1639 |
| 389 | Ga0207674_10444670 | 3300026116 | Bacteria | 1253 |
| 390 | Ga0207674_10750387 | 3300026116 | Bacteria | 942 |
| 391 | Ga0207675_100030553 | 3300026118 | Bacteria | 5019 |
| 392 | Ga0207675_100041965 | 3300026118 | Bacteria | 4271 |
| 393 | Ga0207675_100236907 | 3300026118 | Bacteria | 1762 |
| 394 | Ga0207683_10009422 | 3300026121 | Bacteria | 8322 |
| 395 | Ga0207683_10623100 | 3300026121 | Bacteria | 999 |
| 396 | Ga0207698_10014518 | 3300026142 | Bacteria | 5240 |
| 397 | Ga0209813_10003825 | 3300027866 | Bacteria | 3557 |
| 398 | Ga0268266_10000519 | 3300028379 | Bacteria | 54346 |
| 399 | Ga0268266_10002731 | 3300028379 | Bacteria | 18479 |
| 400 | Ga0268266_10007858 | 3300028379 | Bacteria | 9554 |
| 401 | Ga0268266_10026561 | 3300028379 | Bacteria | 4927 |
| 402 | Ga0268266_10074305 | 3300028379 | Bacteria | 2951 |
| 403 | Ga0268266_10086191 | 3300028379 | Bacteria | 2745 |
| 404 | Ga0268265_10053362 | 3300028380 | Bacteria | 3062 |
| 405 | Ga0268265_10053798 | 3300028380 | Bacteria | 3051 |
| 406 | Ga0268265_10100132 | 3300028380 | Bacteria | 2338 |
| 407 | Ga0268265_10132120 | 3300028380 | Bacteria | 2076 |
| 408 | Ga0268264_10070247 | 3300028381 | Bacteria | 2964 |
| 409 | Ga0268264_10454260 | 3300028381 | Bacteria | 1242 |
| 410 | Ga0307517_10060854 | 3300028786 | Bacteria | 3584 |
| 411 | Ga0307517_10141324 | 3300028786 | Bacteria | 1689 |
| 412 | Ga0307515_10427340 | 3300028794 | Bacteria | 944 |
| 413 | Ga0265325_10000019 | 3300031241 | Bacteria | 125265 |
| 414 | Ga0265339_10078259 | 3300031249 | Bacteria | 1751 |
| 415 | Ga0307513_10209969 | 3300031456 | Bacteria | 1779 |
| 416 | Ga0307513_10505722 | 3300031456 | Bacteria | 925 |
| 417 | Ga0307509_10480983 | 3300031507 | Bacteria | 930 |
| 418 | Ga0307408_100058770 | 3300031548 | Bacteria | 2797 |
| 419 | Ga0307408_100067665 | 3300031548 | Bacteria | 2628 |
| 420 | Ga0307408_100467751 | 3300031548 | Bacteria | 1097 |
| 421 | Ga0265313_10009150 | 3300031595 | Bacteria | 6464 |
| 422 | Ga0307508_10168165 | 3300031616 | Bacteria | 1796 |
| 423 | Ga0307516_10608618 | 3300031730 | Bacteria | 747 |
| 424 | Ga0307405_10134132 | 3300031731 | Bacteria | 1716 |
| 425 | Ga0307406_10140897 | 3300031901 | Bacteria | 1707 |
| 426 | Ga0307406_10286014 | 3300031901 | Bacteria | 1260 |
| 427 | Ga0307412_10156211 | 3300031911 | Bacteria | 1689 |
| 428 | Ga0307409_100938726 | 3300031995 | Bacteria | 880 |
| 429 | Ga0307409_101182771 | 3300031995 | Bacteria | 788 |
| 430 | Ga0307416_100038819 | 3300032002 | Bacteria | 3678 |
| 431 | Ga0307416_100104574 | 3300032002 | Bacteria | 2475 |
| 432 | Ga0307411_10594902 | 3300032005 | Bacteria | 950 |
| 433 | Ga0307411_10878037 | 3300032005 | Bacteria | 795 |
| 434 | Ga0307415_100230503 | 3300032126 | Bacteria | 1491 |
| 435 | Ga0307510_10021151 | 3300033180 | Bacteria | 7586 |
| 436 | Ga0373930_0026998 | 3300034816 | Bacteria | 1161 |
| 437 | Ga0373926_0079621 | 3300035083 | Bacteria | 1210 |
| 438 | Ga0373923_0042926 | 3300035111 | Bacteria | 1869 |
| 439 | Ga0373936_0007126 | 3300035113 | Bacteria | 4207 |
| 440 | Ga0373941_0000361 | 3300035115 | Bacteria | 9003 |
| 441 | Ga0373953_0040133 | 3300035117 | Bacteria | 1858 |
| 442 | Ga0373956_0055632 | 3300035119 | Bacteria | 1785 |
| 443 | Ga0373957_0041614 | 3300035120 | Bacteria | 1731 |
| 444 | Ga0373943_0019457 | 3300035170 | Bacteria | 3123 |
| 445 | Ga0373943_0484986 | 3300035170 | Bacteria | 721 |
| 446 | Ga0373955_0023658 | 3300035172 | Bacteria | 3132 |
| 447 | Ga0373962_0150191 | 3300035242 | Bacteria | 762 |
| 448 | Ga0373935_0277950 | 3300035692 | Bacteria | 1178 |
| 449 | Ga0373927_0120591 | 3300035695 | Bacteria | 1711 |
| 450 | Ga0373927_0302583 | 3300035695 | Bacteria | 1052 |
| 451 | Ga0373927_0304961 | 3300035695 | Bacteria | 1048 |
| 452 | Ga0373933_0103308 | 3300035724 | Bacteria | 1770 |
| 453 | Ga0373947_0014281 | 3300035725 | Bacteria | 4555 |
| 454 | Ga0395905_0814024 | 3300037471 | Bacteria | 837 |
| 455 | Ga0436365_0014507 | 3300039437 | Bacteria | 1966 |
| 456 | Ga0436365_0045752 | 3300039437 | Bacteria | 1501 |
| 457 | Ga0436365_0545826 | 3300039437 | Unclassified | 1882 |
| 458 | Ga0451787_018577 | 3300041441 | Bacteria | 937 |
| 459 | Ga0451791_1804937 | 3300041451 | Bacteria | 1315 |
| 460 | Ga0451793_1582537 | 3300041452 | Bacteria | 953 |
| 461 | Ga0451802_0401890 | 3300041460 | Bacteria | 1370 |
| 462 | Ga0451833_1416861 | 3300041491 | Bacteria | 879 |
| 463 | Ga0439445_0064161 | 3300042004 | Bacteria | 1008 |
| 464 | Ga0466964_0078768 | 3300044706 | Bacteria | 1410 |
| 465 | Ga0466968_0240140 | 3300044735 | Bacteria | 858 |
| 466 | Ga0466960_0030018 | 3300044901 | Bacteria | 2500 |
| 467 | Ga0466967_0156569 | 3300045976 | Bacteria | 2135 |
| 468 | Ga0466967_0449259 | 3300045976 | Bacteria | 1259 |
| 469 | Ga0495617_003959 | 3300046452 | Bacteria | 5451 |
| 470 | Ga0495592_0123300 | 3300046454 | Bacteria | 1821 |
| 471 | Ga0495603_0081307 | 3300046455 | Bacteria | 1898 |
| 472 | Ga0495590_0024119 | 3300046457 | Bacteria | 2144 |
| 473 | Ga0495590_0133332 | 3300046457 | Bacteria | 894 |
| 474 | Ga0495629_0180734 | 3300046459 | Bacteria | 1462 |
| 475 | Ga0495638_0063518 | 3300046460 | Bacteria | 2276 |
| 476 | Ga0495638_0084450 | 3300046460 | Bacteria | 1921 |
| 477 | Ga0495638_0240574 | 3300046460 | Bacteria | 1002 |
| 478 | Ga0495641_0248538 | 3300046461 | Bacteria | 799 |
| 479 | Ga0495580_0013708 | 3300046472 | Bacteria | 6175 |
| 480 | Ga0495580_0091517 | 3300046472 | Bacteria | 2117 |
| 481 | Ga0495582_0006519 | 3300046473 | Bacteria | 6478 |
| 482 | Ga0495582_0377851 | 3300046473 | Bacteria | 816 |
| 483 | Ga0495639_0020308 | 3300046475 | Bacteria | 2903 |
| 484 | Ga0495664_0029189 | 3300046477 | Bacteria | 3224 |
| 485 | Ga0495584_0075589 | 3300046491 | Bacteria | 1694 |
| 486 | Ga0495584_0163924 | 3300046491 | Bacteria | 1130 |
| 487 | Ga0495584_0166094 | 3300046491 | Bacteria | 1122 |
| 488 | Ga0495584_0223075 | 3300046491 | Bacteria | 958 |
| 489 | Ga0495585_0020146 | 3300046492 | Bacteria | 3838 |
| 490 | Ga0495585_0046373 | 3300046492 | Bacteria | 2424 |
| 491 | Ga0495585_0240730 | 3300046492 | Bacteria | 906 |
| 492 | Ga0495594_0138672 | 3300046499 | Bacteria | 1379 |
| 493 | Ga0495594_0506421 | 3300046499 | Bacteria | 686 |
| 494 | Ga0495620_0063470 | 3300046515 | Bacteria | 1531 |
| 495 | Ga0495630_0119700 | 3300046517 | Bacteria | 1997 |
| 496 | Ga0495631_0295888 | 3300046518 | Bacteria | 689 |
| 497 | Ga0495632_0097215 | 3300046519 | Bacteria | 1390 |
| 498 | Ga0495632_0138796 | 3300046519 | Bacteria | 1128 |
| 499 | Ga0495644_0085306 | 3300046523 | Bacteria | 1190 |
| 500 | Ga0495644_0150758 | 3300046523 | Bacteria | 890 |
| 501 | Ga0495648_0124300 | 3300046524 | Bacteria | 1381 |
| 502 | Ga0495666_0038861 | 3300046526 | Bacteria | 2313 |
| 503 | Ga0495642_0098596 | 3300046528 | Bacteria | 1242 |
| 504 | Ga0495652_0416821 | 3300046529 | Bacteria | 947 |
| 505 | Ga0495654_0080369 | 3300046530 | Bacteria | 1530 |
| 506 | Ga0495665_0016908 | 3300046531 | Bacteria | 3926 |
| 507 | Ga0495665_0423981 | 3300046531 | Bacteria | 674 |
| 508 | Ga0495640_0217704 | 3300046533 | Bacteria | 1205 |
| 509 | Ga0495598_0002622 | 3300046537 | Bacteria | 3722 |
| 510 | Ga0495609_0227615 | 3300046538 | Bacteria | 773 |
| 511 | Ga0495621_0103155 | 3300046539 | Bacteria | 1087 |
| 512 | Ga0495645_0113695 | 3300046543 | Bacteria | 1914 |
| 513 | Ga0495622_0043851 | 3300046557 | Bacteria | 2079 |
| 514 | Ga0495622_0182444 | 3300046557 | Bacteria | 941 |
| 515 | Ga0495633_0126629 | 3300046558 | Bacteria | 1182 |
| 516 | Ga0495656_0000977 | 3300046615 | Bacteria | 9259 |
| 517 | Ga0495668_0110188 | 3300046616 | Bacteria | 1506 |
| 518 | Ga0495668_0135783 | 3300046616 | Bacteria | 1346 |
| 519 | Ga0495668_0148631 | 3300046616 | Bacteria | 1283 |
| 520 | Ga0495668_0368834 | 3300046616 | Bacteria | 788 |
| 521 | Ga0495634_0059476 | 3300046642 | Bacteria | 2545 |
| 522 | Ga0495611_0066551 | 3300046648 | Bacteria | 1643 |
| 523 | Ga0495625_0072881 | 3300046660 | Bacteria | 2408 |
| 524 | Ga0495625_0149424 | 3300046660 | Bacteria | 1571 |
| 525 | Ga0495625_0455874 | 3300046660 | Bacteria | 789 |
| 526 | Ga0495588_0006542 | 3300046674 | Bacteria | 5255 |
| 527 | Ga0495623_0460415 | 3300046679 | Bacteria | 676 |
| 528 | Ga0495646_0057485 | 3300046680 | Bacteria | 2328 |
| 529 | Ga0495647_0077745 | 3300046681 | Bacteria | 1340 |
| 530 | Ga0495658_0265998 | 3300046683 | Bacteria | 1080 |
| 531 | Ga0495613_0060056 | 3300046689 | Bacteria | 2786 |
| 532 | Ga0495624_0024501 | 3300046690 | Bacteria | 3970 |
| 533 | Ga0495670_0101018 | 3300046691 | Bacteria | 1485 |
| 534 | Ga0495589_0380027 | 3300046794 | Bacteria | 649 |
| 535 | Ga0495660_0200610 | 3300046810 | Bacteria | 953 |
| 536 | Ga0495581_0009697 | 3300047315 | Bacteria | 5574 |
| 537 | Ga0495581_0425594 | 3300047315 | Bacteria | 774 |
| 538 | Ga0495636_0024287 | 3300047318 | Bacteria | 2457 |
| 539 | Ga0495674_0006663 | 3300047319 | Bacteria | 11066 |
| 540 | Ga0495676_0061833 | 3300047321 | Bacteria | 2927 |
| 541 | Ga0495676_0355225 | 3300047321 | Bacteria | 979 |
| 542 | Ga0495683_0056095 | 3300047323 | Bacteria | 1960 |
| 543 | Ga0495683_0151357 | 3300047323 | Bacteria | 1080 |
| 544 | Ga0495677_0069383 | 3300047445 | Bacteria | 1313 |
| 545 | Ga0495673_0097114 | 3300047469 | Bacteria | 1196 |
| 546 | Ga0495673_0102314 | 3300047469 | Bacteria | 1156 |
| 547 | Ga0495684_0056700 | 3300047471 | Bacteria | 2986 |
| 548 | Ga0495593_0054390 | 3300047673 | Bacteria | 2110 |
| 549 | Ga0495602_0638478 | 3300048088 | Bacteria | 728 |
| 550 | Ga0495626_0248536 | 3300048091 | Bacteria | 714 |
| 551 | Ga0496100_0088762 | 3300048903 | Bacteria | 2105 |
| 552 | Ga0496101_0035125 | 3300048904 | Bacteria | 3545 |
| 553 | Ga0496101_0066897 | 3300048904 | Bacteria | 2622 |
| 554 | Ga0496101_0187069 | 3300048904 | Bacteria | 1597 |
| 555 | Ga0496102_0097203 | 3300048905 | Bacteria | 2731 |
| 556 | Ga0496102_0201748 | 3300048905 | Bacteria | 1875 |
| 557 | Ga0496102_0216857 | 3300048905 | Bacteria | 1804 |
| 558 | Ga0496102_0255196 | 3300048905 | Bacteria | 1653 |
| 559 | Ga0496102_0413524 | 3300048905 | Bacteria | 1267 |
| 560 | Ga0496102_0785450 | 3300048905 | Bacteria | 875 |
| 561 | Ga0496104_0000455 | 3300048907 | Bacteria | 35340 |
| 562 | Ga0496104_0005057 | 3300048907 | Bacteria | 11503 |
| 563 | Ga0496104_0089865 | 3300048907 | Bacteria | 2934 |
| 564 | Ga0496104_0117619 | 3300048907 | Bacteria | 2551 |
| 565 | Ga0496105_0010776 | 3300048908 | Bacteria | 7197 |
| 566 | Ga0496105_0037670 | 3300048908 | Bacteria | 3982 |
| 567 | Ga0496105_0178759 | 3300048908 | Bacteria | 1738 |
| 568 | Ga0496106_0044738 | 3300048909 | Bacteria | 3324 |
| 569 | Ga0496106_0107800 | 3300048909 | Bacteria | 2166 |
| 570 | Ga0496106_0115484 | 3300048909 | Bacteria | 2093 |
| 571 | Ga0496107_0305367 | 3300048910 | Bacteria | 1184 |
| 572 | Ga0496107_0313363 | 3300048910 | Bacteria | 1168 |
| 573 | Ga0496108_0007572 | 3300048911 | Bacteria | 8796 |
| 574 | Ga0496108_0015938 | 3300048911 | Bacteria | 6127 |
| 575 | Ga0496108_0027703 | 3300048911 | Bacteria | 4683 |
| 576 | Ga0496108_0112420 | 3300048911 | Bacteria | 2330 |
| 577 | Ga0496108_0180704 | 3300048911 | Bacteria | 1827 |
| 578 | Ga0496108_0253445 | 3300048911 | Bacteria | 1531 |
| 579 | Ga0496108_0566748 | 3300048911 | Bacteria | 990 |
| 580 | Ga0496109_0121071 | 3300048912 | Bacteria | 2438 |
| 581 | Ga0496109_0144481 | 3300048912 | Bacteria | 2225 |
| 582 | Ga0496109_0272678 | 3300048912 | Bacteria | 1594 |
| 583 | Ga0496109_0401789 | 3300048912 | Bacteria | 1294 |
| 584 | Ga0496109_0579740 | 3300048912 | Bacteria | 1057 |
| 585 | Ga0496109_0965424 | 3300048912 | Bacteria | 790 |
| 586 | Ga0496110_0084349 | 3300048913 | Bacteria | 2835 |
| 587 | Ga0496110_0230430 | 3300048913 | Bacteria | 1685 |
| 588 | Ga0496110_0241566 | 3300048913 | Unclassified | 1643 |
| 589 | Ga0496110_0253616 | 3300048913 | Bacteria | 1601 |
| 590 | Ga0496110_0453813 | 3300048913 | Bacteria | 1168 |
| 591 | Ga0496110_1003274 | 3300048913 | Bacteria | 742 |
| 592 | Ga0496111_0024078 | 3300048914 | Bacteria | 4282 |
| 593 | Ga0496111_0077313 | 3300048914 | Bacteria | 2426 |
| 594 | Ga0496111_0403988 | 3300048914 | Unclassified | 1009 |
| 595 | Ga0496112_0001393 | 3300048915 | Bacteria | 18457 |
| 596 | Ga0496112_0027379 | 3300048915 | Bacteria | 5495 |
| 597 | Ga0496112_0046407 | 3300048915 | Bacteria | 4261 |
| 598 | Ga0496112_0384768 | 3300048915 | Bacteria | 1344 |
| 599 | Ga0496112_0447924 | 3300048915 | Bacteria | 1229 |
| 600 | Ga0496112_0858151 | 3300048915 | Bacteria | 831 |
| 601 | Ga0496113_0134775 | 3300048916 | Bacteria | 1940 |
| 602 | Ga0496113_0140581 | 3300048916 | Unclassified | 1899 |
| 603 | Ga0496113_0313108 | 3300048916 | Bacteria | 1258 |
| 604 | Ga0496113_0445439 | 3300048916 | Bacteria | 1040 |
| 605 | Ga0496114_0107851 | 3300048917 | Bacteria | 2383 |
| 606 | Ga0496114_0667268 | 3300048917 | Bacteria | 913 |
| 607 | Ga0496114_0914543 | 3300048917 | Bacteria | 759 |
| 608 | Ga0496115_0093530 | 3300048918 | Bacteria | 2458 |
| 609 | Ga0496115_0339519 | 3300048918 | Bacteria | 1226 |
| 610 | Ga0496117_0072127 | 3300048920 | Bacteria | 2311 |
| 611 | Ga0496118_0124538 | 3300048921 | Bacteria | 1672 |
| 612 | Ga0496121_0021902 | 3300048924 | Bacteria | 6237 |
| 613 | Ga0496121_0032181 | 3300048924 | Bacteria | 4773 |
| 614 | Ga0496121_0071645 | 3300048924 | Bacteria | 2786 |
| 615 | Ga0496121_0115929 | 3300048924 | Bacteria | 2033 |
| 616 | Ga0496121_0119366 | 3300048924 | Bacteria | 1994 |
| 617 | Ga0496121_0219012 | 3300048924 | Bacteria | 1342 |
| 618 | Ga0496124_0031707 | 3300048927 | Bacteria | 4676 |
| 619 | Ga0496124_0166271 | 3300048927 | Bacteria | 1714 |
| 620 | Ga0496125_0118463 | 3300048928 | Bacteria | 1896 |
| 621 | Ga0496125_0272969 | 3300048928 | Bacteria | 1052 |
| 622 | Ga0496126_0002882 | 3300048929 | Bacteria | 22445 |
| 623 | Ga0496126_0024138 | 3300048929 | Bacteria | 5874 |
| 624 | Ga0496126_0062701 | 3300048929 | Bacteria | 3335 |
| 625 | Ga0496126_0161527 | 3300048929 | Bacteria | 1914 |
| 626 | Ga0496126_0351515 | 3300048929 | Bacteria | 1205 |
| 627 | Ga0496126_0503416 | 3300048929 | Bacteria | 968 |
| 628 | Ga0495678_125067 | 3300049459 | Bacteria | 859 |
| 629 | Ga0495682_0032150 | 3300049460 | Bacteria | 1939 |
| 630 | Ga0495682_0133133 | 3300049460 | Bacteria | 889 |
| 631 | Ga0501032_0035101 | 3300049569 | Bacteria | 3430 |
| 632 | Ga0501032_0075834 | 3300049569 | Bacteria | 2239 |
| 633 | Ga0501032_0230429 | 3300049569 | Bacteria | 1204 |
| 634 | Ga0501033_0061106 | 3300049570 | Bacteria | 2777 |
| 635 | Ga0501033_0143980 | 3300049570 | Bacteria | 1722 |
| 636 | Ga0501034_0000593 | 3300049571 | Bacteria | 57233 |
| 637 | Ga0501034_0002613 | 3300049571 | Bacteria | 21379 |
| 638 | Ga0501034_0003588 | 3300049571 | Bacteria | 17615 |
| 639 | Ga0501034_0035068 | 3300049571 | Bacteria | 5087 |
| 640 | Ga0501034_0044712 | 3300049571 | Bacteria | 4477 |
| 641 | Ga0501034_0055314 | 3300049571 | Bacteria | 3993 |
| 642 | Ga0501034_0400357 | 3300049571 | Bacteria | 1295 |
| 643 | Ga0501034_0413124 | 3300049571 | Bacteria | 1271 |
| 644 | Ga0501036_0006215 | 3300049572 | Bacteria | 9687 |
| 645 | Ga0501036_0015237 | 3300049572 | Bacteria | 6420 |
| 646 | Ga0501036_0026976 | 3300049572 | Bacteria | 4854 |
| 647 | Ga0501036_0073361 | 3300049572 | Bacteria | 2893 |
| 648 | Ga0501037_0028060 | 3300049573 | Bacteria | 4157 |
| 649 | Ga0501037_0187236 | 3300049573 | Bacteria | 1466 |
| 650 | Ga0501038_0014508 | 3300049574 | Bacteria | 7180 |
| 651 | Ga0501038_0086235 | 3300049574 | Bacteria | 2638 |
| 652 | Ga0501038_0271682 | 3300049574 | Bacteria | 1336 |
| 653 | Ga0501039_0022224 | 3300049575 | Bacteria | 4869 |
| 654 | Ga0501039_0056203 | 3300049575 | Bacteria | 3048 |
| 655 | Ga0501043_0009776 | 3300049579 | Bacteria | 7516 |
| 656 | Ga0501043_0036285 | 3300049579 | Bacteria | 3877 |
| 657 | Ga0501043_0146092 | 3300049579 | Bacteria | 1851 |
| 658 | Ga0501043_0256329 | 3300049579 | Bacteria | 1346 |
| 659 | Ga0501046_0051901 | 3300049580 | Bacteria | 3234 |
| 660 | Ga0501047_0001425 | 3300049581 | Bacteria | 23479 |
| 661 | Ga0501047_0021891 | 3300049581 | Bacteria | 6138 |
| 662 | Ga0501047_0132514 | 3300049581 | Bacteria | 2372 |
| 663 | Ga0501048_0006813 | 3300049582 | Bacteria | 8677 |
| 664 | Ga0501067_0154817 | 3300049583 | Bacteria | 1277 |
| 665 | Ga0501068_0005284 | 3300049584 | Bacteria | 7054 |
| 666 | Ga0501068_0295408 | 3300049584 | Bacteria | 1036 |
| 667 | Ga0501069_0161095 | 3300049585 | Bacteria | 1292 |
| 668 | Ga0501069_0344071 | 3300049585 | Bacteria | 878 |
| 669 | Ga0501070_0090535 | 3300049586 | Bacteria | 2532 |
| 670 | Ga0501070_0244203 | 3300049586 | Bacteria | 1469 |
| 671 | Ga0501070_0796118 | 3300049586 | Bacteria | 742 |
| 672 | Ga0501073_0024463 | 3300049589 | Bacteria | 4337 |
| 673 | Ga0501073_0051937 | 3300049589 | Bacteria | 2871 |
| 674 | Ga0501073_0084566 | 3300049589 | Bacteria | 2207 |
| 675 | Ga0501074_0001697 | 3300049590 | Bacteria | 15002 |
| 676 | Ga0501074_0073026 | 3300049590 | Bacteria | 2464 |
| 677 | Ga0501074_0245042 | 3300049590 | Bacteria | 1274 |
| 678 | Ga0501074_0295137 | 3300049590 | Bacteria | 1151 |
| 679 | Ga0501076_0224333 | 3300049592 | Bacteria | 1536 |
| 680 | Ga0501079_0511221 | 3300049741 | Bacteria | 944 |
| 681 | Ga0501080_0002496 | 3300049742 | Bacteria | 16104 |
| 682 | Ga0501080_0372394 | 3300049742 | Bacteria | 1288 |
| 683 | Ga0501080_0807337 | 3300049742 | Bacteria | 822 |
| 684 | Ga0501081_0084008 | 3300049743 | Bacteria | 2233 |
| 685 | Ga0501083_0000907 | 3300049744 | Bacteria | 19630 |
| 686 | Ga0501083_0107294 | 3300049744 | Bacteria | 1838 |
| 687 | Ga0501035_0027957 | 3300049822 | Bacteria | 5152 |
| 688 | Ga0501035_0073122 | 3300049822 | Bacteria | 3033 |
| 689 | Ga0501035_0204363 | 3300049822 | Bacteria | 1692 |
| 690 | Ga0501044_0026561 | 3300049823 | Bacteria | 6128 |
| 691 | Ga0501044_0074577 | 3300049823 | Bacteria | 3446 |
| 692 | Ga0501044_0098785 | 3300049823 | Bacteria | 2938 |
| 693 | Ga0501044_0174599 | 3300049823 | Bacteria | 2118 |
| 694 | Ga0501044_0217238 | 3300049823 | Bacteria | 1863 |
| 695 | Ga0501044_0700303 | 3300049823 | Bacteria | 898 |
| 696 | nmdc:mga03683_141433_c1 | 3300050489 | Bacteria | 1082 |
| 697 | nmdc:mga03n38_2816_c1 | 3300050490 | Bacteria | 5470 |
| 698 | nmdc:mga03n38_357505_c1 | 3300050490 | Bacteria | 796 |
| 699 | nmdc:mga00v17_105962_c1 | 3300050491 | Bacteria | 1779 |
| 700 | nmdc:mga00v17_239393_c1 | 3300050491 | Bacteria | 1176 |
| 701 | nmdc:mga00v17_376480_c1 | 3300050491 | Bacteria | 923 |
| 702 | nmdc:mga00v17_619266_c1 | 3300050491 | Bacteria | 697 |
| 703 | nmdc:mga0yw44_107934_c1 | 3300050492 | Bacteria | 1781 |
| 704 | nmdc:mga0yw44_367753_c1 | 3300050492 | Bacteria | 970 |
| 705 | nmdc:mga0yw44_46341_c1 | 3300050492 | Bacteria | 2610 |
| 706 | nmdc:mga0yw44_56354_c1 | 3300050492 | Bacteria | 2394 |
| 707 | nmdc:mga0yw44_664598_c1 | 3300050492 | Bacteria | 708 |
| 708 | nmdc:mga06z11_116256_c1 | 3300050494 | Bacteria | 1487 |
| 709 | nmdc:mga06z11_212962_c1 | 3300050494 | Bacteria | 1127 |
| 710 | nmdc:mga06z11_34972_c1 | 3300050494 | Bacteria | 2469 |
| 711 | nmdc:mga04h51_2653_c1 | 3300050495 | Bacteria | 4258 |
| 712 | nmdc:mga07m45_12747_c1 | 3300050496 | Bacteria | 4445 |
| 713 | nmdc:mga07m45_7177_c1 | 3300050496 | Bacteria | 5677 |
| 714 | nmdc:mga05p37_933068_c1 | 3300050507 | Bacteria | 931 |
| 715 | nmdc:mga0qj67_533065_c1 | 3300050509 | Bacteria | 942 |
| 716 | nmdc:mga08y16_653652_c1 | 3300050511 | Bacteria | 1055 |
| 717 | nmdc:mga0n895_1022877_c1 | 3300050512 | Bacteria | 806 |
| 718 | nmdc:mga0n895_2683_c1 | 3300050512 | Bacteria | 14041 |
| 719 | nmdc:mga0n895_828236_c1 | 3300050512 | Bacteria | 914 |
| 720 | nmdc:mga0rr50_202335_c1 | 3300050513 | Bacteria | 1632 |
| 721 | Ga0495601_0508923 | 3300053077 | Bacteria | 776 |
| 722 | Ga0495655_0122076 | 3300053083 | Bacteria | 794 |
| 723 | Ga0500643_057111 | 3300053087 | Bacteria | 1102 |
| 724 | Ga0500583_0002146 | 3300053092 | Bacteria | 5854 |
| 725 | Ga0500641_0010909 | 3300053096 | Bacteria | 3294 |
| 726 | Ga0500641_0032132 | 3300053096 | Bacteria | 2074 |
| 727 | Ga0500650_0102599 | 3300053098 | Bacteria | 1338 |
| 728 | Ga0500562_062741 | 3300053108 | Bacteria | 999 |
| 729 | Ga0500595_026500 | 3300053119 | Bacteria | 1996 |
| 730 | Ga0500642_0042665 | 3300053130 | Bacteria | 1967 |
| 731 | Ga0500655_007057 | 3300053133 | Bacteria | 2021 |
| 732 | Ga0500658_0108904 | 3300053134 | Bacteria | 1217 |
| 733 | Ga0500561_0032548 | 3300053137 | Bacteria | 1326 |
| 734 | Ga0500561_0035092 | 3300053137 | Bacteria | 1292 |
| 735 | Ga0500564_224132 | 3300053138 | Bacteria | 759 |
| 736 | Ga0500577_0041332 | 3300053142 | Bacteria | 1681 |
| 737 | Ga0500577_0101939 | 3300053142 | Bacteria | 1174 |
| 738 | Ga0500588_0046310 | 3300053146 | Bacteria | 1336 |
| 739 | Ga0500588_0062429 | 3300053146 | Bacteria | 1198 |
| 740 | Ga0500604_0029032 | 3300053151 | Bacteria | 1610 |
| 741 | Ga0500627_0082880 | 3300053158 | Bacteria | 1431 |
| 742 | Ga0500634_0088424 | 3300053161 | Bacteria | 1579 |
| 743 | Ga0500634_0112562 | 3300053161 | Bacteria | 1340 |
| 744 | Ga0500638_204173 | 3300053162 | Bacteria | 833 |
| 745 | Ga0500637_0061432 | 3300053178 | Bacteria | 2153 |
| 746 | Ga0500611_046552 | 3300053727 | Bacteria | 976 |
| 747 | Ga0500609_018439 | 3300053731 | Bacteria | 950 |
| 748 | Ga0500656_016602 | 3300053732 | Bacteria | 874 |
| 749 | Ga0501084_0818165 | 3300054114 | Bacteria | 784 |
| 750 | Ga0501082_0110947 | 3300060353 | Bacteria | 2374 |
| 751 | Ga0501082_0366631 | 3300060353 | Bacteria | 1256 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005444 | Ga0070694_100015646 | Ga0070694_1000156466 | 177 |
| 2 | 3300021384 | Ga0213876_10111656 | Ga0213876_101116563 | 177 |
| 3 | 3300039437 | Ga0436365_0545826 | Ga0436365_0545826_49_648 | 177 |
| 4 | 3300039437 | Ga0436365_0045752 | Ga0436365_0045752_608_1144 | 178 |
| 5 | 3300009174 | Ga0105241_10221598 | Ga0105241_102215982 | 183 |
| 6 | 3300013100 | Ga0157373_10290412 | Ga0157373_102904122 | 183 |
| 7 | 3300025912 | Ga0207707_10076954 | Ga0207707_100769542 | 183 |
| 8 | 3300031241 | Ga0265325_10000019 | Ga0265325_1000001964 | 184 |
| 9 | 3300031249 | Ga0265339_10078259 | Ga0265339_100782592 | 184 |
| 10 | 3300031595 | Ga0265313_10009150 | Ga0265313_100091502 | 184 |
| 11 | 3300050512 | nmdc:mga0n895_1022877_c1 | nmdc:mga0n895_1022877_c1_74_679 | 184 |
| 12 | 3300005436 | Ga0070713_100009110 | Ga0070713_1000091106 | 186 |
| 13 | 3300006175 | Ga0070712_100138063 | Ga0070712_1001380632 | 186 |
| 14 | 3300025906 | Ga0207699_10084532 | Ga0207699_100845322 | 186 |
| 15 | 3300025915 | Ga0207693_10205926 | Ga0207693_102059261 | 186 |
| 16 | 3300025928 | Ga0207700_10418202 | Ga0207700_104182022 | 186 |
| 17 | 3300048911 | Ga0496108_0027703 | Ga0496108_0027703_1268_1867 | 186 |
| 18 | 3300048913 | Ga0496110_0241566 | Ga0496110_0241566_861_1460 | 186 |
| 19 | 3300048914 | Ga0496111_0403988 | Ga0496111_0403988_95_694 | 186 |
| 20 | 3300049823 | Ga0501044_0074577 | Ga0501044_0074577_1913_2503 | 186 |
| 21 | 3300006038 | Ga0075365_10189150 | Ga0075365_101891502 | 187 |
| 22 | 3300006048 | Ga0075363_100222221 | Ga0075363_1002222211 | 187 |
| 23 | 3300006178 | Ga0075367_10157099 | Ga0075367_101570992 | 187 |
| 24 | 3300027866 | Ga0209813_10003825 | Ga0209813_100038252 | 187 |
| 25 | 3300050495 | nmdc:mga04h51_2653_c1 | nmdc:mga04h51_2653_c1_3373_3978 | 187 |
| 26 | 3300003659 | JGI25404J52841_10046768 | JGI25404J52841_100467681 | 188 |
| 27 | 3300003911 | JGI25405J52794_10016817 | JGI25405J52794_100168172 | 188 |
| 28 | 3300005937 | Ga0081455_10048280 | Ga0081455_100482805 | 188 |
| 29 | 3300005983 | Ga0081540_1011161 | Ga0081540_10111615 | 188 |
| 30 | 3300005983 | Ga0081540_1026873 | Ga0081540_10268735 | 188 |
| 31 | 3300049571 | Ga0501034_0000593 | Ga0501034_0000593_54172_54771 | 191 |
| 32 | 3300005338 | Ga0068868_100473338 | Ga0068868_1004733381 | 192 |
| 33 | 3300005457 | Ga0070662_100562287 | Ga0070662_1005622871 | 192 |
| 34 | 3300005618 | Ga0068864_100411786 | Ga0068864_1004117862 | 192 |
| 35 | 3300005841 | Ga0068863_100515556 | Ga0068863_1005155562 | 192 |
| 36 | 3300025925 | Ga0207650_10468774 | Ga0207650_104687742 | 192 |
| 37 | 3300026023 | Ga0207677_10215138 | Ga0207677_102151383 | 192 |
| 38 | 3300026095 | Ga0207676_10057588 | Ga0207676_100575883 | 192 |
| 39 | 3300026121 | Ga0207683_10623100 | Ga0207683_106231002 | 192 |
| 40 | 3300048911 | Ga0496108_0007572 | Ga0496108_0007572_2656_3234 | 192 |
| 41 | 3300048913 | Ga0496110_1003274 | Ga0496110_1003274_40_618 | 192 |
| 42 | 3300048916 | Ga0496113_0134775 | Ga0496113_0134775_693_1271 | 192 |
| 43 | 3300048929 | Ga0496126_0062701 | Ga0496126_0062701_2091_2807 | 192 |
| 44 | 3300025908 | Ga0207643_10174637 | Ga0207643_101746371 | 194 |
| 45 | 3300003203 | JGI25406J46586_10052595 | JGI25406J46586_100525952 | 195 |
| 46 | 3300005329 | Ga0070683_100415541 | Ga0070683_1004155411 | 195 |
| 47 | 3300005355 | Ga0070671_100027269 | Ga0070671_1000272695 | 195 |
| 48 | 3300005365 | Ga0070688_100270038 | Ga0070688_1002700381 | 195 |
| 49 | 3300005367 | Ga0070667_100292316 | Ga0070667_1002923161 | 195 |
| 50 | 3300005543 | Ga0070672_100245803 | Ga0070672_1002458031 | 195 |
| 51 | 3300005544 | Ga0070686_100412334 | Ga0070686_1004123342 | 195 |
| 52 | 3300005616 | Ga0068852_100176258 | Ga0068852_1001762582 | 195 |
| 53 | 3300005840 | Ga0068870_10145875 | Ga0068870_101458753 | 195 |
| 54 | 3300005843 | Ga0068860_100423660 | Ga0068860_1004236602 | 195 |
| 55 | 3300005985 | Ga0081539_10002583 | Ga0081539_1000258330 | 195 |
| 56 | 3300006038 | Ga0075365_10479373 | Ga0075365_104793731 | 195 |
| 57 | 3300006042 | Ga0075368_10051984 | Ga0075368_100519842 | 195 |
| 58 | 3300006178 | Ga0075367_10708293 | Ga0075367_107082931 | 195 |
| 59 | 3300009093 | Ga0105240_10224340 | Ga0105240_102243402 | 195 |
| 60 | 3300009177 | Ga0105248_10102374 | Ga0105248_101023742 | 195 |
| 61 | 3300009177 | Ga0105248_10389701 | Ga0105248_103897012 | 195 |
| 62 | 3300009545 | Ga0105237_10171890 | Ga0105237_101718902 | 195 |
| 63 | 3300009551 | Ga0105238_10229451 | Ga0105238_102294513 | 195 |
| 64 | 3300009553 | Ga0105249_10169566 | Ga0105249_101695662 | 195 |
| 65 | 3300010375 | Ga0105239_10302971 | Ga0105239_103029712 | 195 |
| 66 | 3300013297 | Ga0157378_10059250 | Ga0157378_100592502 | 195 |
| 67 | 3300014325 | Ga0163163_10733183 | Ga0163163_107331831 | 195 |
| 68 | 3300014325 | Ga0163163_10751419 | Ga0163163_107514192 | 195 |
| 69 | 3300014326 | Ga0157380_10475524 | Ga0157380_104755242 | 195 |
| 70 | 3300014326 | Ga0157380_10929236 | Ga0157380_109292362 | 195 |
| 71 | 3300014968 | Ga0157379_10033950 | Ga0157379_100339502 | 195 |
| 72 | 3300017792 | Ga0163161_10372823 | Ga0163161_103728231 | 195 |
| 73 | 3300025913 | Ga0207695_10340514 | Ga0207695_103405142 | 195 |
| 74 | 3300025924 | Ga0207694_10159873 | Ga0207694_101598732 | 195 |
| 75 | 3300025924 | Ga0207694_10808162 | Ga0207694_108081621 | 195 |
| 76 | 3300025931 | Ga0207644_10088712 | Ga0207644_100887122 | 195 |
| 77 | 3300025934 | Ga0207686_10311154 | Ga0207686_103111542 | 195 |
| 78 | 3300025941 | Ga0207711_10182111 | Ga0207711_101821112 | 195 |
| 79 | 3300025941 | Ga0207711_10289267 | Ga0207711_102892671 | 195 |
| 80 | 3300025986 | Ga0207658_10572006 | Ga0207658_105720061 | 195 |
| 81 | 3300026035 | Ga0207703_10141311 | Ga0207703_101413112 | 195 |
| 82 | 3300026041 | Ga0207639_10183016 | Ga0207639_101830162 | 195 |
| 83 | 3300031456 | Ga0307513_10209969 | Ga0307513_102099692 | 195 |
| 84 | 3300031548 | Ga0307408_100058770 | Ga0307408_1000587701 | 195 |
| 85 | 3300031616 | Ga0307508_10168165 | Ga0307508_101681653 | 195 |
| 86 | 3300031730 | Ga0307516_10608618 | Ga0307516_106086181 | 195 |
| 87 | 3300031901 | Ga0307406_10140897 | Ga0307406_101408972 | 195 |
| 88 | 3300031995 | Ga0307409_101182771 | Ga0307409_1011827711 | 195 |
| 89 | 3300034816 | Ga0373930_0026998 | Ga0373930_0026998_371_958 | 195 |
| 90 | 3300035170 | Ga0373943_0484986 | Ga0373943_0484986_100_687 | 195 |
| 91 | 3300035242 | Ga0373962_0150191 | Ga0373962_0150191_103_690 | 195 |
| 92 | 3300035695 | Ga0373927_0302583 | Ga0373927_0302583_64_651 | 195 |
| 93 | 3300037471 | Ga0395905_0814024 | Ga0395905_0814024_196_798 | 195 |
| 94 | 3300042004 | Ga0439445_0064161 | Ga0439445_0064161_230_832 | 195 |
| 95 | 3300046473 | Ga0495582_0377851 | Ga0495582_0377851_146_748 | 195 |
| 96 | 3300046616 | Ga0495668_0110188 | Ga0495668_0110188_150_752 | 195 |
| 97 | 3300046616 | Ga0495668_0148631 | Ga0495668_0148631_102_704 | 195 |
| 98 | 3300046660 | Ga0495625_0455874 | Ga0495625_0455874_134_736 | 195 |
| 99 | 3300046679 | Ga0495623_0460415 | Ga0495623_0460415_47_649 | 195 |
| 100 | 3300046683 | Ga0495658_0265998 | Ga0495658_0265998_335_937 | 195 |
| 101 | 3300047315 | Ga0495581_0425594 | Ga0495581_0425594_56_658 | 195 |
| 102 | 3300048903 | Ga0496100_0088762 | Ga0496100_0088762_933_1520 | 195 |
| 103 | 3300048904 | Ga0496101_0035125 | Ga0496101_0035125_227_829 | 195 |
| 104 | 3300048904 | Ga0496101_0066897 | Ga0496101_0066897_1556_2143 | 195 |
| 105 | 3300048905 | Ga0496102_0097203 | Ga0496102_0097203_891_1478 | 195 |
| 106 | 3300048907 | Ga0496104_0089865 | Ga0496104_0089865_1011_1598 | 195 |
| 107 | 3300048909 | Ga0496106_0115484 | Ga0496106_0115484_1170_1757 | 195 |
| 108 | 3300048911 | Ga0496108_0253445 | Ga0496108_0253445_504_1091 | 195 |
| 109 | 3300048912 | Ga0496109_0144481 | Ga0496109_0144481_1613_2200 | 195 |
| 110 | 3300048913 | Ga0496110_0084349 | Ga0496110_0084349_917_1504 | 195 |
| 111 | 3300048914 | Ga0496111_0077313 | Ga0496111_0077313_807_1394 | 195 |
| 112 | 3300048915 | Ga0496112_0001393 | Ga0496112_0001393_218_805 | 195 |
| 113 | 3300048917 | Ga0496114_0107851 | Ga0496114_0107851_1247_1834 | 195 |
| 114 | 3300048917 | Ga0496114_0667268 | Ga0496114_0667268_155_757 | 195 |
| 115 | 3300048917 | Ga0496114_0914543 | Ga0496114_0914543_47_649 | 195 |
| 116 | 3300048918 | Ga0496115_0093530 | Ga0496115_0093530_1595_2182 | 195 |
| 117 | 3300049586 | Ga0501070_0090535 | Ga0501070_0090535_691_1311 | 195 |
| 118 | 3300050491 | nmdc:mga00v17_239393_c1 | nmdc:mga00v17_239393_c1_430_1035 | 195 |
| 119 | 3300050492 | nmdc:mga0yw44_664598_c1 | nmdc:mga0yw44_664598_c1_19_621 | 195 |
| 120 | 3300050494 | nmdc:mga06z11_34972_c1 | nmdc:mga06z11_34972_c1_173_781 | 195 |
| 121 | 3300053727 | Ga0500611_046552 | Ga0500611_046552_118_720 | 195 |
| 122 | 2010549000 | RicEn_FSXC51428_g1 | RicEn_454400 | 196 |
| 123 | 3300003659 | JGI25404J52841_10002782 | JGI25404J52841_100027822 | 196 |
| 124 | 3300003911 | JGI25405J52794_10023307 | JGI25405J52794_100233071 | 196 |
| 125 | 3300005288 | Ga0065714_10237102 | Ga0065714_102371021 | 196 |
| 126 | 3300005289 | Ga0065704_10140531 | Ga0065704_101405312 | 196 |
| 127 | 3300005290 | Ga0065712_10175080 | Ga0065712_101750801 | 196 |
| 128 | 3300005293 | Ga0065715_10120354 | Ga0065715_101203543 | 196 |
| 129 | 3300005329 | Ga0070683_100053329 | Ga0070683_1000533292 | 196 |
| 130 | 3300005329 | Ga0070683_100660189 | Ga0070683_1006601891 | 196 |
| 131 | 3300005330 | Ga0070690_100002833 | Ga0070690_1000028334 | 196 |
| 132 | 3300005331 | Ga0070670_100126286 | Ga0070670_1001262864 | 196 |
| 133 | 3300005334 | Ga0068869_100030484 | Ga0068869_1000304843 | 196 |
| 134 | 3300005334 | Ga0068869_100034418 | Ga0068869_1000344182 | 196 |
| 135 | 3300005334 | Ga0068869_100088480 | Ga0068869_1000884803 | 196 |
| 136 | 3300005334 | Ga0068869_100471785 | Ga0068869_1004717851 | 196 |
| 137 | 3300005335 | Ga0070666_10012049 | Ga0070666_100120493 | 196 |
| 138 | 3300005335 | Ga0070666_10259335 | Ga0070666_102593352 | 196 |
| 139 | 3300005336 | Ga0070680_100027574 | Ga0070680_1000275742 | 196 |
| 140 | 3300005337 | Ga0070682_100613571 | Ga0070682_1006135711 | 196 |
| 141 | 3300005338 | Ga0068868_100021301 | Ga0068868_1000213016 | 196 |
| 142 | 3300005338 | Ga0068868_100149682 | Ga0068868_1001496822 | 196 |
| 143 | 3300005338 | Ga0068868_100405084 | Ga0068868_1004050842 | 196 |
| 144 | 3300005340 | Ga0070689_100021328 | Ga0070689_1000213284 | 196 |
| 145 | 3300005340 | Ga0070689_100804630 | Ga0070689_1008046301 | 196 |
| 146 | 3300005343 | Ga0070687_100285783 | Ga0070687_1002857831 | 196 |
| 147 | 3300005343 | Ga0070687_100348957 | Ga0070687_1003489571 | 196 |
| 148 | 3300005344 | Ga0070661_100236318 | Ga0070661_1002363182 | 196 |
| 149 | 3300005344 | Ga0070661_100324465 | Ga0070661_1003244652 | 196 |
| 150 | 3300005347 | Ga0070668_100092246 | Ga0070668_1000922463 | 196 |
| 151 | 3300005347 | Ga0070668_100294907 | Ga0070668_1002949072 | 196 |
| 152 | 3300005347 | Ga0070668_100320161 | Ga0070668_1003201612 | 196 |
| 153 | 3300005347 | Ga0070668_100613835 | Ga0070668_1006138352 | 196 |
| 154 | 3300005353 | Ga0070669_100194042 | Ga0070669_1001940422 | 196 |
| 155 | 3300005353 | Ga0070669_100420547 | Ga0070669_1004205471 | 196 |
| 156 | 3300005354 | Ga0070675_100005627 | Ga0070675_1000056274 | 196 |
| 157 | 3300005354 | Ga0070675_100436575 | Ga0070675_1004365752 | 196 |
| 158 | 3300005354 | Ga0070675_100458952 | Ga0070675_1004589522 | 196 |
| 159 | 3300005355 | Ga0070671_100026147 | Ga0070671_1000261474 | 196 |
| 160 | 3300005355 | Ga0070671_101128349 | Ga0070671_1011283491 | 196 |
| 161 | 3300005367 | Ga0070667_100002110 | Ga0070667_1000021107 | 196 |
| 162 | 3300005367 | Ga0070667_100340826 | Ga0070667_1003408262 | 196 |
| 163 | 3300005438 | Ga0070701_10386107 | Ga0070701_103861072 | 196 |
| 164 | 3300005439 | Ga0070711_100617199 | Ga0070711_1006171991 | 196 |
| 165 | 3300005441 | Ga0070700_100280686 | Ga0070700_1002806862 | 196 |
| 166 | 3300005441 | Ga0070700_100320937 | Ga0070700_1003209371 | 196 |
| 167 | 3300005444 | Ga0070694_100230989 | Ga0070694_1002309892 | 196 |
| 168 | 3300005455 | Ga0070663_100000663 | Ga0070663_1000006636 | 196 |
| 169 | 3300005455 | Ga0070663_100027475 | Ga0070663_1000274753 | 196 |
| 170 | 3300005455 | Ga0070663_100126626 | Ga0070663_1001266261 | 196 |
| 171 | 3300005455 | Ga0070663_100206539 | Ga0070663_1002065392 | 196 |
| 172 | 3300005456 | Ga0070678_100006375 | Ga0070678_1000063754 | 196 |
| 173 | 3300005456 | Ga0070678_100007982 | Ga0070678_1000079823 | 196 |
| 174 | 3300005456 | Ga0070678_100223344 | Ga0070678_1002233442 | 196 |
| 175 | 3300005457 | Ga0070662_100036998 | Ga0070662_1000369982 | 196 |
| 176 | 3300005457 | Ga0070662_100084095 | Ga0070662_1000840953 | 196 |
| 177 | 3300005458 | Ga0070681_10087171 | Ga0070681_100871712 | 196 |
| 178 | 3300005458 | Ga0070681_10411824 | Ga0070681_104118241 | 196 |
| 179 | 3300005459 | Ga0068867_100141596 | Ga0068867_1001415962 | 196 |
| 180 | 3300005459 | Ga0068867_100186927 | Ga0068867_1001869271 | 196 |
| 181 | 3300005466 | Ga0070685_10084517 | Ga0070685_100845173 | 196 |
| 182 | 3300005466 | Ga0070685_10331330 | Ga0070685_103313301 | 196 |
| 183 | 3300005467 | Ga0070706_101040308 | Ga0070706_1010403081 | 196 |
| 184 | 3300005468 | Ga0070707_100068164 | Ga0070707_1000681642 | 196 |
| 185 | 3300005471 | Ga0070698_100150659 | Ga0070698_1001506594 | 196 |
| 186 | 3300005518 | Ga0070699_100152211 | Ga0070699_1001522112 | 196 |
| 187 | 3300005530 | Ga0070679_100093183 | Ga0070679_1000931833 | 196 |
| 188 | 3300005530 | Ga0070679_100175359 | Ga0070679_1001753592 | 196 |
| 189 | 3300005535 | Ga0070684_100123045 | Ga0070684_1001230451 | 196 |
| 190 | 3300005535 | Ga0070684_100287374 | Ga0070684_1002873742 | 196 |
| 191 | 3300005535 | Ga0070684_100423553 | Ga0070684_1004235532 | 196 |
| 192 | 3300005539 | Ga0068853_100040290 | Ga0068853_1000402902 | 196 |
| 193 | 3300005543 | Ga0070672_100107034 | Ga0070672_1001070344 | 196 |
| 194 | 3300005543 | Ga0070672_100358104 | Ga0070672_1003581042 | 196 |
| 195 | 3300005544 | Ga0070686_100353989 | Ga0070686_1003539891 | 196 |
| 196 | 3300005545 | Ga0070695_100827146 | Ga0070695_1008271461 | 196 |
| 197 | 3300005546 | Ga0070696_100110763 | Ga0070696_1001107631 | 196 |
| 198 | 3300005547 | Ga0070693_100045221 | Ga0070693_1000452212 | 196 |
| 199 | 3300005547 | Ga0070693_100694159 | Ga0070693_1006941592 | 196 |
| 200 | 3300005548 | Ga0070665_100003746 | Ga0070665_1000037467 | 196 |
| 201 | 3300005548 | Ga0070665_100005052 | Ga0070665_1000050523 | 196 |
| 202 | 3300005548 | Ga0070665_100013563 | Ga0070665_1000135633 | 196 |
| 203 | 3300005548 | Ga0070665_100021610 | Ga0070665_1000216102 | 196 |
| 204 | 3300005548 | Ga0070665_100058396 | Ga0070665_1000583962 | 196 |
| 205 | 3300005548 | Ga0070665_100166352 | Ga0070665_1001663523 | 196 |
| 206 | 3300005548 | Ga0070665_100576060 | Ga0070665_1005760602 | 196 |
| 207 | 3300005548 | Ga0070665_101268858 | Ga0070665_1012688581 | 196 |
| 208 | 3300005549 | Ga0070704_100745055 | Ga0070704_1007450552 | 196 |
| 209 | 3300005563 | Ga0068855_100115683 | Ga0068855_1001156832 | 196 |
| 210 | 3300005563 | Ga0068855_100180870 | Ga0068855_1001808703 | 196 |
| 211 | 3300005563 | Ga0068855_100247630 | Ga0068855_1002476301 | 196 |
| 212 | 3300005563 | Ga0068855_100571795 | Ga0068855_1005717952 | 196 |
| 213 | 3300005563 | Ga0068855_100710466 | Ga0068855_1007104662 | 196 |
| 214 | 3300005564 | Ga0070664_100686855 | Ga0070664_1006868551 | 196 |
| 215 | 3300005564 | Ga0070664_100793366 | Ga0070664_1007933661 | 196 |
| 216 | 3300005564 | Ga0070664_100825307 | Ga0070664_1008253072 | 196 |
| 217 | 3300005577 | Ga0068857_100458960 | Ga0068857_1004589602 | 196 |
| 218 | 3300005578 | Ga0068854_100981029 | Ga0068854_1009810291 | 196 |
| 219 | 3300005614 | Ga0068856_100014477 | Ga0068856_1000144778 | 196 |
| 220 | 3300005614 | Ga0068856_100560696 | Ga0068856_1005606962 | 196 |
| 221 | 3300005616 | Ga0068852_100015964 | Ga0068852_1000159646 | 196 |
| 222 | 3300005616 | Ga0068852_100061095 | Ga0068852_1000610952 | 196 |
| 223 | 3300005616 | Ga0068852_100501466 | Ga0068852_1005014662 | 196 |
| 224 | 3300005617 | Ga0068859_100032269 | Ga0068859_1000322696 | 196 |
| 225 | 3300005617 | Ga0068859_100051481 | Ga0068859_1000514812 | 196 |
| 226 | 3300005617 | Ga0068859_100275026 | Ga0068859_1002750262 | 196 |
| 227 | 3300005617 | Ga0068859_100565676 | Ga0068859_1005656762 | 196 |
| 228 | 3300005617 | Ga0068859_101200343 | Ga0068859_1012003431 | 196 |
| 229 | 3300005618 | Ga0068864_100015563 | Ga0068864_1000155635 | 196 |
| 230 | 3300005618 | Ga0068864_100073770 | Ga0068864_1000737703 | 196 |
| 231 | 3300005618 | Ga0068864_100258536 | Ga0068864_1002585362 | 196 |
| 232 | 3300005719 | Ga0068861_100026034 | Ga0068861_1000260344 | 196 |
| 233 | 3300005719 | Ga0068861_100143367 | Ga0068861_1001433672 | 196 |
| 234 | 3300005719 | Ga0068861_100250239 | Ga0068861_1002502393 | 196 |
| 235 | 3300005719 | Ga0068861_100439447 | Ga0068861_1004394472 | 196 |
| 236 | 3300005719 | Ga0068861_100885039 | Ga0068861_1008850391 | 196 |
| 237 | 3300005834 | Ga0068851_10013989 | Ga0068851_100139893 | 196 |
| 238 | 3300005840 | Ga0068870_10078086 | Ga0068870_100780862 | 196 |
| 239 | 3300005840 | Ga0068870_10095281 | Ga0068870_100952812 | 196 |
| 240 | 3300005841 | Ga0068863_100005866 | Ga0068863_1000058667 | 196 |
| 241 | 3300005841 | Ga0068863_100796310 | Ga0068863_1007963102 | 196 |
| 242 | 3300005842 | Ga0068858_100000211 | Ga0068858_10000021140 | 196 |
| 243 | 3300005842 | Ga0068858_100070599 | Ga0068858_1000705992 | 196 |
| 244 | 3300005843 | Ga0068860_100011349 | Ga0068860_1000113495 | 196 |
| 245 | 3300005843 | Ga0068860_100094666 | Ga0068860_1000946663 | 196 |
| 246 | 3300005843 | Ga0068860_100460289 | Ga0068860_1004602892 | 196 |
| 247 | 3300005843 | Ga0068860_100501587 | Ga0068860_1005015872 | 196 |
| 248 | 3300005843 | Ga0068860_100738025 | Ga0068860_1007380252 | 196 |
| 249 | 3300005844 | Ga0068862_100040067 | Ga0068862_1000400673 | 196 |
| 250 | 3300005844 | Ga0068862_100107140 | Ga0068862_1001071403 | 196 |
| 251 | 3300005844 | Ga0068862_100180060 | Ga0068862_1001800602 | 196 |
| 252 | 3300005937 | Ga0081455_10003425 | Ga0081455_1000342515 | 196 |
| 253 | 3300005937 | Ga0081455_10006252 | Ga0081455_100062529 | 196 |
| 254 | 3300005937 | Ga0081455_10009461 | Ga0081455_100094616 | 196 |
| 255 | 3300005937 | Ga0081455_10024092 | Ga0081455_100240923 | 196 |
| 256 | 3300005937 | Ga0081455_10070721 | Ga0081455_100707213 | 196 |
| 257 | 3300005937 | Ga0081455_10071950 | Ga0081455_100719502 | 196 |
| 258 | 3300005983 | Ga0081540_1002589 | Ga0081540_100258911 | 196 |
| 259 | 3300005983 | Ga0081540_1003572 | Ga0081540_10035728 | 196 |
| 260 | 3300005983 | Ga0081540_1006855 | Ga0081540_10068556 | 196 |
| 261 | 3300005985 | Ga0081539_10018896 | Ga0081539_100188963 | 196 |
| 262 | 3300006038 | Ga0075365_10055643 | Ga0075365_100556431 | 196 |
| 263 | 3300006038 | Ga0075365_10092443 | Ga0075365_100924432 | 196 |
| 264 | 3300006048 | Ga0075363_100004914 | Ga0075363_1000049143 | 196 |
| 265 | 3300006048 | Ga0075363_100028673 | Ga0075363_1000286732 | 196 |
| 266 | 3300006173 | Ga0070716_100128067 | Ga0070716_1001280672 | 196 |
| 267 | 3300006177 | Ga0075362_10207489 | Ga0075362_102074891 | 196 |
| 268 | 3300006178 | Ga0075367_10094859 | Ga0075367_100948592 | 196 |
| 269 | 3300006178 | Ga0075367_10180627 | Ga0075367_101806272 | 196 |
| 270 | 3300006186 | Ga0075369_10004778 | Ga0075369_100047785 | 196 |
| 271 | 3300006195 | Ga0075366_10109826 | Ga0075366_101098262 | 196 |
| 272 | 3300006237 | Ga0097621_100110397 | Ga0097621_1001103973 | 196 |
| 273 | 3300006237 | Ga0097621_100143301 | Ga0097621_1001433012 | 196 |
| 274 | 3300006353 | Ga0075370_10002046 | Ga0075370_100020464 | 196 |
| 275 | 3300006353 | Ga0075370_10008551 | Ga0075370_100085515 | 196 |
| 276 | 3300006353 | Ga0075370_10020184 | Ga0075370_100201844 | 196 |
| 277 | 3300006358 | Ga0068871_100024943 | Ga0068871_1000249433 | 196 |
| 278 | 3300006358 | Ga0068871_100475191 | Ga0068871_1004751912 | 196 |
| 279 | 3300006844 | Ga0075428_100092094 | Ga0075428_1000920942 | 196 |
| 280 | 3300006852 | Ga0075433_10384723 | Ga0075433_103847232 | 196 |
| 281 | 3300006871 | Ga0075434_100003708 | Ga0075434_1000037089 | 196 |
| 282 | 3300006871 | Ga0075434_100128231 | Ga0075434_1001282311 | 196 |
| 283 | 3300006931 | Ga0097620_100032269 | Ga0097620_1000322696 | 196 |
| 284 | 3300006931 | Ga0097620_100051481 | Ga0097620_1000514815 | 196 |
| 285 | 3300006931 | Ga0097620_100275013 | Ga0097620_1002750132 | 196 |
| 286 | 3300006931 | Ga0097620_100565678 | Ga0097620_1005656782 | 196 |
| 287 | 3300006931 | Ga0097620_101200356 | Ga0097620_1012003561 | 196 |
| 288 | 3300007076 | Ga0075435_100207898 | Ga0075435_1002078982 | 196 |
| 289 | 3300007076 | Ga0075435_100215375 | Ga0075435_1002153752 | 196 |
| 290 | 3300009092 | Ga0105250_10016274 | Ga0105250_100162742 | 196 |
| 291 | 3300009093 | Ga0105240_10153104 | Ga0105240_101531043 | 196 |
| 292 | 3300009093 | Ga0105240_10198229 | Ga0105240_101982292 | 196 |
| 293 | 3300009093 | Ga0105240_10444344 | Ga0105240_104443441 | 196 |
| 294 | 3300009093 | Ga0105240_11452491 | Ga0105240_114524911 | 196 |
| 295 | 3300009101 | Ga0105247_10267963 | Ga0105247_102679632 | 196 |
| 296 | 3300009147 | Ga0114129_10264694 | Ga0114129_102646943 | 196 |
| 297 | 3300009148 | Ga0105243_10201681 | Ga0105243_102016812 | 196 |
| 298 | 3300009174 | Ga0105241_10474542 | Ga0105241_104745421 | 196 |
| 299 | 3300009176 | Ga0105242_10714652 | Ga0105242_107146522 | 196 |
| 300 | 3300009177 | Ga0105248_10088569 | Ga0105248_100885693 | 196 |
| 301 | 3300009177 | Ga0105248_10569824 | Ga0105248_105698241 | 196 |
| 302 | 3300009545 | Ga0105237_10068817 | Ga0105237_100688172 | 196 |
| 303 | 3300009545 | Ga0105237_10394184 | Ga0105237_103941843 | 196 |
| 304 | 3300009545 | Ga0105237_10761259 | Ga0105237_107612591 | 196 |
| 305 | 3300009545 | Ga0105237_10775764 | Ga0105237_107757642 | 196 |
| 306 | 3300009551 | Ga0105238_10017485 | Ga0105238_1001748511 | 196 |
| 307 | 3300009553 | Ga0105249_10133162 | Ga0105249_101331622 | 196 |
| 308 | 3300009553 | Ga0105249_10219019 | Ga0105249_102190192 | 196 |
| 309 | 3300010375 | Ga0105239_10047197 | Ga0105239_100471974 | 196 |
| 310 | 3300010375 | Ga0105239_10133341 | Ga0105239_101333414 | 196 |
| 311 | 3300010375 | Ga0105239_10215187 | Ga0105239_102151872 | 196 |
| 312 | 3300010375 | Ga0105239_10362312 | Ga0105239_103623122 | 196 |
| 313 | 3300011119 | Ga0105246_10326682 | Ga0105246_103266822 | 196 |
| 314 | 3300013105 | Ga0157369_10516107 | Ga0157369_105161071 | 196 |
| 315 | 3300013105 | Ga0157369_10540521 | Ga0157369_105405211 | 196 |
| 316 | 3300013296 | Ga0157374_10004632 | Ga0157374_100046326 | 196 |
| 317 | 3300013296 | Ga0157374_10149275 | Ga0157374_101492752 | 196 |
| 318 | 3300013297 | Ga0157378_10031169 | Ga0157378_100311692 | 196 |
| 319 | 3300013297 | Ga0157378_10792627 | Ga0157378_107926271 | 196 |
| 320 | 3300013297 | Ga0157378_10981845 | Ga0157378_109818451 | 196 |
| 321 | 3300013306 | Ga0163162_10015806 | Ga0163162_100158067 | 196 |
| 322 | 3300013306 | Ga0163162_10186822 | Ga0163162_101868222 | 196 |
| 323 | 3300013306 | Ga0163162_10217359 | Ga0163162_102173593 | 196 |
| 324 | 3300013306 | Ga0163162_10334057 | Ga0163162_103340572 | 196 |
| 325 | 3300013306 | Ga0163162_10410185 | Ga0163162_104101851 | 196 |
| 326 | 3300013306 | Ga0163162_10870477 | Ga0163162_108704771 | 196 |
| 327 | 3300013307 | Ga0157372_10199994 | Ga0157372_101999942 | 196 |
| 328 | 3300013307 | Ga0157372_11767797 | Ga0157372_117677971 | 196 |
| 329 | 3300013308 | Ga0157375_10184239 | Ga0157375_101842393 | 196 |
| 330 | 3300013308 | Ga0157375_10423925 | Ga0157375_104239252 | 196 |
| 331 | 3300013308 | Ga0157375_10480094 | Ga0157375_104800942 | 196 |
| 332 | 3300014325 | Ga0163163_10002661 | Ga0163163_1000266111 | 196 |
| 333 | 3300014325 | Ga0163163_10044505 | Ga0163163_100445053 | 196 |
| 334 | 3300014325 | Ga0163163_10069006 | Ga0163163_100690064 | 196 |
| 335 | 3300014326 | Ga0157380_10268008 | Ga0157380_102680081 | 196 |
| 336 | 3300014326 | Ga0157380_10313916 | Ga0157380_103139162 | 196 |
| 337 | 3300014326 | Ga0157380_10803615 | Ga0157380_108036151 | 196 |
| 338 | 3300014326 | Ga0157380_11531070 | Ga0157380_115310701 | 196 |
| 339 | 3300014968 | Ga0157379_10050930 | Ga0157379_100509303 | 196 |
| 340 | 3300014968 | Ga0157379_10153593 | Ga0157379_101535932 | 196 |
| 341 | 3300014968 | Ga0157379_10793632 | Ga0157379_107936321 | 196 |
| 342 | 3300014969 | Ga0157376_10142716 | Ga0157376_101427162 | 196 |
| 343 | 3300014969 | Ga0157376_10166202 | Ga0157376_101662022 | 196 |
| 344 | 3300014969 | Ga0157376_10280747 | Ga0157376_102807472 | 196 |
| 345 | 3300017792 | Ga0163161_10074398 | Ga0163161_100743984 | 196 |
| 346 | 3300017792 | Ga0163161_10330622 | Ga0163161_103306222 | 196 |
| 347 | 3300020070 | Ga0206356_11851354 | Ga0206356_118513541 | 196 |
| 348 | 3300025297 | Ga0209758_1004341 | Ga0209758_10043412 | 196 |
| 349 | 3300025302 | Ga0207426_1029550 | Ga0207426_10295502 | 196 |
| 350 | 3300025711 | Ga0207696_1022535 | Ga0207696_10225352 | 196 |
| 351 | 3300025893 | Ga0207682_10058557 | Ga0207682_100585571 | 196 |
| 352 | 3300025893 | Ga0207682_10119786 | Ga0207682_101197862 | 196 |
| 353 | 3300025900 | Ga0207710_10358433 | Ga0207710_103584331 | 196 |
| 354 | 3300025901 | Ga0207688_10027816 | Ga0207688_100278163 | 196 |
| 355 | 3300025903 | Ga0207680_10005653 | Ga0207680_100056536 | 196 |
| 356 | 3300025903 | Ga0207680_10405432 | Ga0207680_104054321 | 196 |
| 357 | 3300025904 | Ga0207647_10157200 | Ga0207647_101572001 | 196 |
| 358 | 3300025908 | Ga0207643_10058362 | Ga0207643_100583622 | 196 |
| 359 | 3300025908 | Ga0207643_10060125 | Ga0207643_100601252 | 196 |
| 360 | 3300025911 | Ga0207654_10008634 | Ga0207654_100086345 | 196 |
| 361 | 3300025912 | Ga0207707_10001660 | Ga0207707_1000166011 | 196 |
| 362 | 3300025912 | Ga0207707_10015879 | Ga0207707_100158798 | 196 |
| 363 | 3300025912 | Ga0207707_10394135 | Ga0207707_103941352 | 196 |
| 364 | 3300025912 | Ga0207707_10597119 | Ga0207707_105971191 | 196 |
| 365 | 3300025913 | Ga0207695_10151168 | Ga0207695_101511682 | 196 |
| 366 | 3300025913 | Ga0207695_10332619 | Ga0207695_103326192 | 196 |
| 367 | 3300025914 | Ga0207671_10216444 | Ga0207671_102164443 | 196 |
| 368 | 3300025914 | Ga0207671_10599692 | Ga0207671_105996921 | 196 |
| 369 | 3300025916 | Ga0207663_10550677 | Ga0207663_105506771 | 196 |
| 370 | 3300025917 | Ga0207660_10218833 | Ga0207660_102188332 | 196 |
| 371 | 3300025918 | Ga0207662_10115789 | Ga0207662_101157893 | 196 |
| 372 | 3300025921 | Ga0207652_10010980 | Ga0207652_100109801 | 196 |
| 373 | 3300025921 | Ga0207652_10032578 | Ga0207652_100325783 | 196 |
| 374 | 3300025922 | Ga0207646_10129621 | Ga0207646_101296213 | 196 |
| 375 | 3300025923 | Ga0207681_10129706 | Ga0207681_101297063 | 196 |
| 376 | 3300025923 | Ga0207681_10156311 | Ga0207681_101563112 | 196 |
| 377 | 3300025923 | Ga0207681_10350734 | Ga0207681_103507341 | 196 |
| 378 | 3300025923 | Ga0207681_10595574 | Ga0207681_105955743 | 196 |
| 379 | 3300025924 | Ga0207694_10095565 | Ga0207694_100955652 | 196 |
| 380 | 3300025924 | Ga0207694_10211011 | Ga0207694_102110112 | 196 |
| 381 | 3300025924 | Ga0207694_10441783 | Ga0207694_104417832 | 196 |
| 382 | 3300025925 | Ga0207650_10103167 | Ga0207650_101031672 | 196 |
| 383 | 3300025926 | Ga0207659_10002563 | Ga0207659_1000256310 | 196 |
| 384 | 3300025931 | Ga0207644_10089818 | Ga0207644_100898182 | 196 |
| 385 | 3300025931 | Ga0207644_10287175 | Ga0207644_102871752 | 196 |
| 386 | 3300025931 | Ga0207644_10818499 | Ga0207644_108184991 | 196 |
| 387 | 3300025933 | Ga0207706_10026350 | Ga0207706_100263504 | 196 |
| 388 | 3300025933 | Ga0207706_10091005 | Ga0207706_100910052 | 196 |
| 389 | 3300025933 | Ga0207706_10271770 | Ga0207706_102717702 | 196 |
| 390 | 3300025934 | Ga0207686_10143974 | Ga0207686_101439742 | 196 |
| 391 | 3300025935 | Ga0207709_10058106 | Ga0207709_100581062 | 196 |
| 392 | 3300025936 | Ga0207670_10024373 | Ga0207670_100243734 | 196 |
| 393 | 3300025938 | Ga0207704_10081930 | Ga0207704_100819302 | 196 |
| 394 | 3300025938 | Ga0207704_10583100 | Ga0207704_105831001 | 196 |
| 395 | 3300025939 | Ga0207665_10657500 | Ga0207665_106575001 | 196 |
| 396 | 3300025940 | Ga0207691_10017874 | Ga0207691_100178746 | 196 |
| 397 | 3300025941 | Ga0207711_10006607 | Ga0207711_100066073 | 196 |
| 398 | 3300025942 | Ga0207689_10035700 | Ga0207689_100357004 | 196 |
| 399 | 3300025942 | Ga0207689_10043430 | Ga0207689_100434302 | 196 |
| 400 | 3300025942 | Ga0207689_10045810 | Ga0207689_100458102 | 196 |
| 401 | 3300025942 | Ga0207689_10089402 | Ga0207689_100894023 | 196 |
| 402 | 3300025944 | Ga0207661_10002756 | Ga0207661_100027564 | 196 |
| 403 | 3300025944 | Ga0207661_10462469 | Ga0207661_104624692 | 196 |
| 404 | 3300025945 | Ga0207679_10124908 | Ga0207679_101249081 | 196 |
| 405 | 3300025945 | Ga0207679_10296276 | Ga0207679_102962762 | 196 |
| 406 | 3300025945 | Ga0207679_10718905 | Ga0207679_107189051 | 196 |
| 407 | 3300025949 | Ga0207667_10088183 | Ga0207667_100881835 | 196 |
| 408 | 3300025949 | Ga0207667_10205767 | Ga0207667_102057674 | 196 |
| 409 | 3300025949 | Ga0207667_10423973 | Ga0207667_104239732 | 196 |
| 410 | 3300025949 | Ga0207667_10878329 | Ga0207667_108783291 | 196 |
| 411 | 3300025960 | Ga0207651_10000121 | Ga0207651_100001218 | 196 |
| 412 | 3300025960 | Ga0207651_10240513 | Ga0207651_102405132 | 196 |
| 413 | 3300025961 | Ga0207712_10194454 | Ga0207712_101944542 | 196 |
| 414 | 3300025961 | Ga0207712_10217730 | Ga0207712_102177302 | 196 |
| 415 | 3300025961 | Ga0207712_10486238 | Ga0207712_104862382 | 196 |
| 416 | 3300025972 | Ga0207668_10022231 | Ga0207668_100222313 | 196 |
| 417 | 3300025972 | Ga0207668_10058829 | Ga0207668_100588292 | 196 |
| 418 | 3300025972 | Ga0207668_10100477 | Ga0207668_101004771 | 196 |
| 419 | 3300025972 | Ga0207668_10240126 | Ga0207668_102401262 | 196 |
| 420 | 3300025981 | Ga0207640_10113733 | Ga0207640_101137332 | 196 |
| 421 | 3300025986 | Ga0207658_10000984 | Ga0207658_1000098422 | 196 |
| 422 | 3300025986 | Ga0207658_10181495 | Ga0207658_101814952 | 196 |
| 423 | 3300026023 | Ga0207677_10055045 | Ga0207677_100550452 | 196 |
| 424 | 3300026023 | Ga0207677_10854007 | Ga0207677_108540071 | 196 |
| 425 | 3300026035 | Ga0207703_10002258 | Ga0207703_100022586 | 196 |
| 426 | 3300026035 | Ga0207703_10023501 | Ga0207703_100235013 | 196 |
| 427 | 3300026035 | Ga0207703_10102794 | Ga0207703_101027942 | 196 |
| 428 | 3300026035 | Ga0207703_10530675 | Ga0207703_105306752 | 196 |
| 429 | 3300026035 | Ga0207703_10660512 | Ga0207703_106605122 | 196 |
| 430 | 3300026041 | Ga0207639_10180677 | Ga0207639_101806772 | 196 |
| 431 | 3300026067 | Ga0207678_10002185 | Ga0207678_1000218510 | 196 |
| 432 | 3300026067 | Ga0207678_10088427 | Ga0207678_100884272 | 196 |
| 433 | 3300026067 | Ga0207678_10091352 | Ga0207678_100913522 | 196 |
| 434 | 3300026067 | Ga0207678_10157606 | Ga0207678_101576063 | 196 |
| 435 | 3300026067 | Ga0207678_10236692 | Ga0207678_102366921 | 196 |
| 436 | 3300026075 | Ga0207708_10224149 | Ga0207708_102241492 | 196 |
| 437 | 3300026075 | Ga0207708_10386140 | Ga0207708_103861401 | 196 |
| 438 | 3300026078 | Ga0207702_10225436 | Ga0207702_102254363 | 196 |
| 439 | 3300026088 | Ga0207641_10002109 | Ga0207641_1000210915 | 196 |
| 440 | 3300026088 | Ga0207641_10232595 | Ga0207641_102325952 | 196 |
| 441 | 3300026088 | Ga0207641_11078432 | Ga0207641_110784321 | 196 |
| 442 | 3300026089 | Ga0207648_10096093 | Ga0207648_100960932 | 196 |
| 443 | 3300026089 | Ga0207648_11409865 | Ga0207648_114098651 | 196 |
| 444 | 3300026095 | Ga0207676_10000749 | Ga0207676_1000074922 | 196 |
| 445 | 3300026095 | Ga0207676_10235579 | Ga0207676_102355792 | 196 |
| 446 | 3300026116 | Ga0207674_10444670 | Ga0207674_104446702 | 196 |
| 447 | 3300026116 | Ga0207674_10750387 | Ga0207674_107503871 | 196 |
| 448 | 3300026118 | Ga0207675_100030553 | Ga0207675_1000305532 | 196 |
| 449 | 3300026118 | Ga0207675_100041965 | Ga0207675_1000419654 | 196 |
| 450 | 3300026118 | Ga0207675_100236907 | Ga0207675_1002369071 | 196 |
| 451 | 3300026121 | Ga0207683_10009422 | Ga0207683_100094223 | 196 |
| 452 | 3300026142 | Ga0207698_10014518 | Ga0207698_100145185 | 196 |
| 453 | 3300028379 | Ga0268266_10000519 | Ga0268266_1000051912 | 196 |
| 454 | 3300028379 | Ga0268266_10002731 | Ga0268266_100027314 | 196 |
| 455 | 3300028379 | Ga0268266_10007858 | Ga0268266_100078583 | 196 |
| 456 | 3300028379 | Ga0268266_10026561 | Ga0268266_100265613 | 196 |
| 457 | 3300028379 | Ga0268266_10074305 | Ga0268266_100743053 | 196 |
| 458 | 3300028379 | Ga0268266_10086191 | Ga0268266_100861911 | 196 |
| 459 | 3300028380 | Ga0268265_10053362 | Ga0268265_100533622 | 196 |
| 460 | 3300028380 | Ga0268265_10053798 | Ga0268265_100537981 | 196 |
| 461 | 3300028380 | Ga0268265_10100132 | Ga0268265_101001322 | 196 |
| 462 | 3300028380 | Ga0268265_10132120 | Ga0268265_101321203 | 196 |
| 463 | 3300028381 | Ga0268264_10070247 | Ga0268264_100702474 | 196 |
| 464 | 3300028381 | Ga0268264_10454260 | Ga0268264_104542602 | 196 |
| 465 | 3300028786 | Ga0307517_10060854 | Ga0307517_100608543 | 196 |
| 466 | 3300028786 | Ga0307517_10141324 | Ga0307517_101413242 | 196 |
| 467 | 3300028794 | Ga0307515_10427340 | Ga0307515_104273402 | 196 |
| 468 | 3300031456 | Ga0307513_10505722 | Ga0307513_105057221 | 196 |
| 469 | 3300031507 | Ga0307509_10480983 | Ga0307509_104809831 | 196 |
| 470 | 3300031548 | Ga0307408_100067665 | Ga0307408_1000676651 | 196 |
| 471 | 3300031548 | Ga0307408_100467751 | Ga0307408_1004677512 | 196 |
| 472 | 3300031731 | Ga0307405_10134132 | Ga0307405_101341322 | 196 |
| 473 | 3300031901 | Ga0307406_10286014 | Ga0307406_102860142 | 196 |
| 474 | 3300031911 | Ga0307412_10156211 | Ga0307412_101562112 | 196 |
| 475 | 3300031995 | Ga0307409_100938726 | Ga0307409_1009387262 | 196 |
| 476 | 3300032002 | Ga0307416_100038819 | Ga0307416_1000388193 | 196 |
| 477 | 3300032002 | Ga0307416_100104574 | Ga0307416_1001045743 | 196 |
| 478 | 3300032005 | Ga0307411_10594902 | Ga0307411_105949022 | 196 |
| 479 | 3300032005 | Ga0307411_10878037 | Ga0307411_108780372 | 196 |
| 480 | 3300032126 | Ga0307415_100230503 | Ga0307415_1002305031 | 196 |
| 481 | 3300033180 | Ga0307510_10021151 | Ga0307510_100211512 | 196 |
| 482 | 3300035083 | Ga0373926_0079621 | Ga0373926_0079621_24_629 | 196 |
| 483 | 3300035111 | Ga0373923_0042926 | Ga0373923_0042926_412_1017 | 196 |
| 484 | 3300035113 | Ga0373936_0007126 | Ga0373936_0007126_531_1136 | 196 |
| 485 | 3300035115 | Ga0373941_0000361 | Ga0373941_0000361_485_1084 | 196 |
| 486 | 3300035117 | Ga0373953_0040133 | Ga0373953_0040133_33_638 | 196 |
| 487 | 3300035119 | Ga0373956_0055632 | Ga0373956_0055632_785_1390 | 196 |
| 488 | 3300035120 | Ga0373957_0041614 | Ga0373957_0041614_322_927 | 196 |
| 489 | 3300035170 | Ga0373943_0019457 | Ga0373943_0019457_1345_1950 | 196 |
| 490 | 3300035172 | Ga0373955_0023658 | Ga0373955_0023658_319_924 | 196 |
| 491 | 3300035692 | Ga0373935_0277950 | Ga0373935_0277950_302_907 | 196 |
| 492 | 3300035695 | Ga0373927_0120591 | Ga0373927_0120591_87_692 | 196 |
| 493 | 3300035695 | Ga0373927_0304961 | Ga0373927_0304961_53_658 | 196 |
| 494 | 3300035724 | Ga0373933_0103308 | Ga0373933_0103308_989_1594 | 196 |
| 495 | 3300035725 | Ga0373947_0014281 | Ga0373947_0014281_3643_4248 | 196 |
| 496 | 3300039437 | Ga0436365_0014507 | Ga0436365_0014507_94_699 | 196 |
| 497 | 3300041441 | Ga0451787_018577 | Ga0451787_018577_247_852 | 196 |
| 498 | 3300041451 | Ga0451791_1804937 | Ga0451791_1804937_187_792 | 196 |
| 499 | 3300041452 | Ga0451793_1582537 | Ga0451793_1582537_205_810 | 196 |
| 500 | 3300041460 | Ga0451802_0401890 | Ga0451802_0401890_192_797 | 196 |
| 501 | 3300041491 | Ga0451833_1416861 | Ga0451833_1416861_88_693 | 196 |
| 502 | 3300044706 | Ga0466964_0078768 | Ga0466964_0078768_31_636 | 196 |
| 503 | 3300044735 | Ga0466968_0240140 | Ga0466968_0240140_86_691 | 196 |
| 504 | 3300044901 | Ga0466960_0030018 | Ga0466960_0030018_1405_2010 | 196 |
| 505 | 3300045976 | Ga0466967_0156569 | Ga0466967_0156569_1100_1705 | 196 |
| 506 | 3300045976 | Ga0466967_0449259 | Ga0466967_0449259_566_1171 | 196 |
| 507 | 3300046452 | Ga0495617_003959 | Ga0495617_003959_814_1416 | 196 |
| 508 | 3300046454 | Ga0495592_0123300 | Ga0495592_0123300_1147_1752 | 196 |
| 509 | 3300046455 | Ga0495603_0081307 | Ga0495603_0081307_298_903 | 196 |
| 510 | 3300046457 | Ga0495590_0024119 | Ga0495590_0024119_1425_2039 | 196 |
| 511 | 3300046457 | Ga0495590_0133332 | Ga0495590_0133332_30_635 | 196 |
| 512 | 3300046459 | Ga0495629_0180734 | Ga0495629_0180734_538_1143 | 196 |
| 513 | 3300046460 | Ga0495638_0063518 | Ga0495638_0063518_431_1036 | 196 |
| 514 | 3300046460 | Ga0495638_0084450 | Ga0495638_0084450_738_1343 | 196 |
| 515 | 3300046460 | Ga0495638_0240574 | Ga0495638_0240574_357_962 | 196 |
| 516 | 3300046461 | Ga0495641_0248538 | Ga0495641_0248538_141_746 | 196 |
| 517 | 3300046472 | Ga0495580_0013708 | Ga0495580_0013708_4991_5596 | 196 |
| 518 | 3300046472 | Ga0495580_0091517 | Ga0495580_0091517_1461_2066 | 196 |
| 519 | 3300046473 | Ga0495582_0006519 | Ga0495582_0006519_5708_6313 | 196 |
| 520 | 3300046475 | Ga0495639_0020308 | Ga0495639_0020308_917_1522 | 196 |
| 521 | 3300046477 | Ga0495664_0029189 | Ga0495664_0029189_1147_1752 | 196 |
| 522 | 3300046491 | Ga0495584_0075589 | Ga0495584_0075589_311_916 | 196 |
| 523 | 3300046491 | Ga0495584_0163924 | Ga0495584_0163924_417_1022 | 196 |
| 524 | 3300046491 | Ga0495584_0166094 | Ga0495584_0166094_469_1074 | 196 |
| 525 | 3300046491 | Ga0495584_0223075 | Ga0495584_0223075_244_849 | 196 |
| 526 | 3300046492 | Ga0495585_0020146 | Ga0495585_0020146_2302_2904 | 196 |
| 527 | 3300046492 | Ga0495585_0046373 | Ga0495585_0046373_967_1557 | 196 |
| 528 | 3300046492 | Ga0495585_0240730 | Ga0495585_0240730_190_795 | 196 |
| 529 | 3300046499 | Ga0495594_0138672 | Ga0495594_0138672_96_701 | 196 |
| 530 | 3300046499 | Ga0495594_0506421 | Ga0495594_0506421_49_654 | 196 |
| 531 | 3300046515 | Ga0495620_0063470 | Ga0495620_0063470_812_1429 | 196 |
| 532 | 3300046517 | Ga0495630_0119700 | Ga0495630_0119700_1335_1940 | 196 |
| 533 | 3300046518 | Ga0495631_0295888 | Ga0495631_0295888_24_629 | 196 |
| 534 | 3300046519 | Ga0495632_0097215 | Ga0495632_0097215_486_1091 | 196 |
| 535 | 3300046519 | Ga0495632_0138796 | Ga0495632_0138796_509_1111 | 196 |
| 536 | 3300046523 | Ga0495644_0085306 | Ga0495644_0085306_41_646 | 196 |
| 537 | 3300046523 | Ga0495644_0150758 | Ga0495644_0150758_115_720 | 196 |
| 538 | 3300046524 | Ga0495648_0124300 | Ga0495648_0124300_753_1355 | 196 |
| 539 | 3300046526 | Ga0495666_0038861 | Ga0495666_0038861_603_1208 | 196 |
| 540 | 3300046528 | Ga0495642_0098596 | Ga0495642_0098596_217_834 | 196 |
| 541 | 3300046529 | Ga0495652_0416821 | Ga0495652_0416821_304_909 | 196 |
| 542 | 3300046530 | Ga0495654_0080369 | Ga0495654_0080369_654_1271 | 196 |
| 543 | 3300046531 | Ga0495665_0016908 | Ga0495665_0016908_2208_2813 | 196 |
| 544 | 3300046531 | Ga0495665_0423981 | Ga0495665_0423981_31_636 | 196 |
| 545 | 3300046533 | Ga0495640_0217704 | Ga0495640_0217704_306_911 | 196 |
| 546 | 3300046537 | Ga0495598_0002622 | Ga0495598_0002622_1962_2552 | 196 |
| 547 | 3300046538 | Ga0495609_0227615 | Ga0495609_0227615_129_734 | 196 |
| 548 | 3300046539 | Ga0495621_0103155 | Ga0495621_0103155_321_926 | 196 |
| 549 | 3300046543 | Ga0495645_0113695 | Ga0495645_0113695_1150_1755 | 196 |
| 550 | 3300046557 | Ga0495622_0043851 | Ga0495622_0043851_1122_1727 | 196 |
| 551 | 3300046557 | Ga0495622_0182444 | Ga0495622_0182444_222_827 | 196 |
| 552 | 3300046558 | Ga0495633_0126629 | Ga0495633_0126629_111_716 | 196 |
| 553 | 3300046615 | Ga0495656_0000977 | Ga0495656_0000977_7380_7970 | 196 |
| 554 | 3300046616 | Ga0495668_0135783 | Ga0495668_0135783_433_1038 | 196 |
| 555 | 3300046616 | Ga0495668_0368834 | Ga0495668_0368834_45_650 | 196 |
| 556 | 3300046642 | Ga0495634_0059476 | Ga0495634_0059476_1245_1850 | 196 |
| 557 | 3300046648 | Ga0495611_0066551 | Ga0495611_0066551_371_976 | 196 |
| 558 | 3300046660 | Ga0495625_0072881 | Ga0495625_0072881_761_1363 | 196 |
| 559 | 3300046660 | Ga0495625_0149424 | Ga0495625_0149424_740_1345 | 196 |
| 560 | 3300046674 | Ga0495588_0006542 | Ga0495588_0006542_2996_3601 | 196 |
| 561 | 3300046680 | Ga0495646_0057485 | Ga0495646_0057485_324_929 | 196 |
| 562 | 3300046681 | Ga0495647_0077745 | Ga0495647_0077745_63_668 | 196 |
| 563 | 3300046689 | Ga0495613_0060056 | Ga0495613_0060056_1141_1746 | 196 |
| 564 | 3300046690 | Ga0495624_0024501 | Ga0495624_0024501_176_781 | 196 |
| 565 | 3300046691 | Ga0495670_0101018 | Ga0495670_0101018_439_1029 | 196 |
| 566 | 3300046794 | Ga0495589_0380027 | Ga0495589_0380027_10_627 | 196 |
| 567 | 3300046810 | Ga0495660_0200610 | Ga0495660_0200610_11_601 | 196 |
| 568 | 3300047315 | Ga0495581_0009697 | Ga0495581_0009697_2612_3217 | 196 |
| 569 | 3300047318 | Ga0495636_0024287 | Ga0495636_0024287_1768_2358 | 196 |
| 570 | 3300047319 | Ga0495674_0006663 | Ga0495674_0006663_6588_7193 | 196 |
| 571 | 3300047321 | Ga0495676_0061833 | Ga0495676_0061833_303_908 | 196 |
| 572 | 3300047321 | Ga0495676_0355225 | Ga0495676_0355225_308_913 | 196 |
| 573 | 3300047323 | Ga0495683_0056095 | Ga0495683_0056095_762_1379 | 196 |
| 574 | 3300047323 | Ga0495683_0151357 | Ga0495683_0151357_17_622 | 196 |
| 575 | 3300047445 | Ga0495677_0069383 | Ga0495677_0069383_133_738 | 196 |
| 576 | 3300047469 | Ga0495673_0097114 | Ga0495673_0097114_345_935 | 196 |
| 577 | 3300047469 | Ga0495673_0102314 | Ga0495673_0102314_77_679 | 196 |
| 578 | 3300047471 | Ga0495684_0056700 | Ga0495684_0056700_2158_2763 | 196 |
| 579 | 3300047673 | Ga0495593_0054390 | Ga0495593_0054390_172_777 | 196 |
| 580 | 3300048088 | Ga0495602_0638478 | Ga0495602_0638478_20_634 | 196 |
| 581 | 3300048091 | Ga0495626_0248536 | Ga0495626_0248536_38_643 | 196 |
| 582 | 3300048904 | Ga0496101_0187069 | Ga0496101_0187069_781_1386 | 196 |
| 583 | 3300048905 | Ga0496102_0201748 | Ga0496102_0201748_1178_1783 | 196 |
| 584 | 3300048905 | Ga0496102_0216857 | Ga0496102_0216857_704_1309 | 196 |
| 585 | 3300048905 | Ga0496102_0255196 | Ga0496102_0255196_610_1215 | 196 |
| 586 | 3300048905 | Ga0496102_0413524 | Ga0496102_0413524_389_994 | 196 |
| 587 | 3300048905 | Ga0496102_0785450 | Ga0496102_0785450_257_862 | 196 |
| 588 | 3300048907 | Ga0496104_0000455 | Ga0496104_0000455_5952_6557 | 196 |
| 589 | 3300048907 | Ga0496104_0005057 | Ga0496104_0005057_836_1441 | 196 |
| 590 | 3300048907 | Ga0496104_0117619 | Ga0496104_0117619_147_752 | 196 |
| 591 | 3300048908 | Ga0496105_0010776 | Ga0496105_0010776_451_1056 | 196 |
| 592 | 3300048908 | Ga0496105_0037670 | Ga0496105_0037670_621_1226 | 196 |
| 593 | 3300048908 | Ga0496105_0178759 | Ga0496105_0178759_800_1405 | 196 |
| 594 | 3300048909 | Ga0496106_0044738 | Ga0496106_0044738_2685_3290 | 196 |
| 595 | 3300048909 | Ga0496106_0107800 | Ga0496106_0107800_1409_2014 | 196 |
| 596 | 3300048910 | Ga0496107_0305367 | Ga0496107_0305367_509_1114 | 196 |
| 597 | 3300048910 | Ga0496107_0313363 | Ga0496107_0313363_354_959 | 196 |
| 598 | 3300048911 | Ga0496108_0015938 | Ga0496108_0015938_11_616 | 196 |
| 599 | 3300048911 | Ga0496108_0112420 | Ga0496108_0112420_1332_1922 | 196 |
| 600 | 3300048911 | Ga0496108_0180704 | Ga0496108_0180704_251_856 | 196 |
| 601 | 3300048911 | Ga0496108_0566748 | Ga0496108_0566748_259_864 | 196 |
| 602 | 3300048912 | Ga0496109_0121071 | Ga0496109_0121071_881_1486 | 196 |
| 603 | 3300048912 | Ga0496109_0272678 | Ga0496109_0272678_651_1256 | 196 |
| 604 | 3300048912 | Ga0496109_0401789 | Ga0496109_0401789_382_987 | 196 |
| 605 | 3300048912 | Ga0496109_0579740 | Ga0496109_0579740_456_1046 | 196 |
| 606 | 3300048912 | Ga0496109_0965424 | Ga0496109_0965424_139_744 | 196 |
| 607 | 3300048913 | Ga0496110_0230430 | Ga0496110_0230430_217_822 | 196 |
| 608 | 3300048913 | Ga0496110_0253616 | Ga0496110_0253616_872_1477 | 196 |
| 609 | 3300048913 | Ga0496110_0453813 | Ga0496110_0453813_62_667 | 196 |
| 610 | 3300048914 | Ga0496111_0024078 | Ga0496111_0024078_404_1009 | 196 |
| 611 | 3300048915 | Ga0496112_0027379 | Ga0496112_0027379_3779_4384 | 196 |
| 612 | 3300048915 | Ga0496112_0046407 | Ga0496112_0046407_248_853 | 196 |
| 613 | 3300048915 | Ga0496112_0384768 | Ga0496112_0384768_586_1188 | 196 |
| 614 | 3300048915 | Ga0496112_0447924 | Ga0496112_0447924_354_959 | 196 |
| 615 | 3300048915 | Ga0496112_0858151 | Ga0496112_0858151_206_811 | 196 |
| 616 | 3300048916 | Ga0496113_0140581 | Ga0496113_0140581_378_983 | 196 |
| 617 | 3300048916 | Ga0496113_0313108 | Ga0496113_0313108_397_987 | 196 |
| 618 | 3300048916 | Ga0496113_0445439 | Ga0496113_0445439_316_921 | 196 |
| 619 | 3300048918 | Ga0496115_0339519 | Ga0496115_0339519_154_759 | 196 |
| 620 | 3300048920 | Ga0496117_0072127 | Ga0496117_0072127_1538_2143 | 196 |
| 621 | 3300048921 | Ga0496118_0124538 | Ga0496118_0124538_53_658 | 196 |
| 622 | 3300048924 | Ga0496121_0021902 | Ga0496121_0021902_5061_5666 | 196 |
| 623 | 3300048924 | Ga0496121_0032181 | Ga0496121_0032181_3457_4047 | 196 |
| 624 | 3300048924 | Ga0496121_0071645 | Ga0496121_0071645_496_1101 | 196 |
| 625 | 3300048924 | Ga0496121_0115929 | Ga0496121_0115929_1230_1835 | 196 |
| 626 | 3300048924 | Ga0496121_0119366 | Ga0496121_0119366_1009_1614 | 196 |
| 627 | 3300048924 | Ga0496121_0219012 | Ga0496121_0219012_277_882 | 196 |
| 628 | 3300048927 | Ga0496124_0031707 | Ga0496124_0031707_291_896 | 196 |
| 629 | 3300048927 | Ga0496124_0166271 | Ga0496124_0166271_1070_1675 | 196 |
| 630 | 3300048928 | Ga0496125_0118463 | Ga0496125_0118463_1123_1728 | 196 |
| 631 | 3300048928 | Ga0496125_0272969 | Ga0496125_0272969_424_1029 | 196 |
| 632 | 3300048929 | Ga0496126_0002882 | Ga0496126_0002882_13443_14033 | 196 |
| 633 | 3300048929 | Ga0496126_0024138 | Ga0496126_0024138_1304_1909 | 196 |
| 634 | 3300048929 | Ga0496126_0161527 | Ga0496126_0161527_1050_1655 | 196 |
| 635 | 3300048929 | Ga0496126_0351515 | Ga0496126_0351515_486_1091 | 196 |
| 636 | 3300048929 | Ga0496126_0503416 | Ga0496126_0503416_265_870 | 196 |
| 637 | 3300049459 | Ga0495678_125067 | Ga0495678_125067_29_634 | 196 |
| 638 | 3300049460 | Ga0495682_0032150 | Ga0495682_0032150_414_1019 | 196 |
| 639 | 3300049460 | Ga0495682_0133133 | Ga0495682_0133133_94_699 | 196 |
| 640 | 3300049569 | Ga0501032_0035101 | Ga0501032_0035101_1853_2452 | 196 |
| 641 | 3300049569 | Ga0501032_0075834 | Ga0501032_0075834_259_858 | 196 |
| 642 | 3300049569 | Ga0501032_0230429 | Ga0501032_0230429_408_1007 | 196 |
| 643 | 3300049570 | Ga0501033_0061106 | Ga0501033_0061106_1628_2227 | 196 |
| 644 | 3300049570 | Ga0501033_0143980 | Ga0501033_0143980_463_1062 | 196 |
| 645 | 3300049571 | Ga0501034_0002613 | Ga0501034_0002613_16560_17153 | 196 |
| 646 | 3300049571 | Ga0501034_0003588 | Ga0501034_0003588_9904_10503 | 196 |
| 647 | 3300049571 | Ga0501034_0035068 | Ga0501034_0035068_222_821 | 196 |
| 648 | 3300049571 | Ga0501034_0044712 | Ga0501034_0044712_1814_2413 | 196 |
| 649 | 3300049571 | Ga0501034_0055314 | Ga0501034_0055314_1004_1603 | 196 |
| 650 | 3300049571 | Ga0501034_0400357 | Ga0501034_0400357_94_693 | 196 |
| 651 | 3300049571 | Ga0501034_0413124 | Ga0501034_0413124_548_1141 | 196 |
| 652 | 3300049572 | Ga0501036_0006215 | Ga0501036_0006215_6518_7117 | 196 |
| 653 | 3300049572 | Ga0501036_0015237 | Ga0501036_0015237_3707_4306 | 196 |
| 654 | 3300049572 | Ga0501036_0026976 | Ga0501036_0026976_1865_2464 | 196 |
| 655 | 3300049572 | Ga0501036_0073361 | Ga0501036_0073361_312_911 | 196 |
| 656 | 3300049573 | Ga0501037_0028060 | Ga0501037_0028060_1615_2310 | 196 |
| 657 | 3300049573 | Ga0501037_0187236 | Ga0501037_0187236_423_1022 | 196 |
| 658 | 3300049574 | Ga0501038_0014508 | Ga0501038_0014508_1481_2176 | 196 |
| 659 | 3300049574 | Ga0501038_0086235 | Ga0501038_0086235_1888_2487 | 196 |
| 660 | 3300049574 | Ga0501038_0271682 | Ga0501038_0271682_325_924 | 196 |
| 661 | 3300049575 | Ga0501039_0022224 | Ga0501039_0022224_400_999 | 196 |
| 662 | 3300049575 | Ga0501039_0056203 | Ga0501039_0056203_90_689 | 196 |
| 663 | 3300049579 | Ga0501043_0009776 | Ga0501043_0009776_2864_3559 | 196 |
| 664 | 3300049579 | Ga0501043_0036285 | Ga0501043_0036285_1775_2374 | 196 |
| 665 | 3300049579 | Ga0501043_0146092 | Ga0501043_0146092_488_1087 | 196 |
| 666 | 3300049579 | Ga0501043_0256329 | Ga0501043_0256329_611_1210 | 196 |
| 667 | 3300049580 | Ga0501046_0051901 | Ga0501046_0051901_1320_2015 | 196 |
| 668 | 3300049581 | Ga0501047_0001425 | Ga0501047_0001425_19936_20535 | 196 |
| 669 | 3300049581 | Ga0501047_0021891 | Ga0501047_0021891_3286_3885 | 196 |
| 670 | 3300049581 | Ga0501047_0132514 | Ga0501047_0132514_1057_1752 | 196 |
| 671 | 3300049582 | Ga0501048_0006813 | Ga0501048_0006813_7362_7961 | 196 |
| 672 | 3300049583 | Ga0501067_0154817 | Ga0501067_0154817_583_1188 | 196 |
| 673 | 3300049584 | Ga0501068_0005284 | Ga0501068_0005284_4458_5153 | 196 |
| 674 | 3300049584 | Ga0501068_0295408 | Ga0501068_0295408_222_821 | 196 |
| 675 | 3300049585 | Ga0501069_0161095 | Ga0501069_0161095_382_987 | 196 |
| 676 | 3300049585 | Ga0501069_0344071 | Ga0501069_0344071_29_628 | 196 |
| 677 | 3300049586 | Ga0501070_0244203 | Ga0501070_0244203_268_867 | 196 |
| 678 | 3300049586 | Ga0501070_0796118 | Ga0501070_0796118_66_665 | 196 |
| 679 | 3300049589 | Ga0501073_0024463 | Ga0501073_0024463_127_726 | 196 |
| 680 | 3300049589 | Ga0501073_0051937 | Ga0501073_0051937_978_1673 | 196 |
| 681 | 3300049589 | Ga0501073_0084566 | Ga0501073_0084566_58_657 | 196 |
| 682 | 3300049590 | Ga0501074_0001697 | Ga0501074_0001697_5681_6280 | 196 |
| 683 | 3300049590 | Ga0501074_0073026 | Ga0501074_0073026_591_1190 | 196 |
| 684 | 3300049590 | Ga0501074_0245042 | Ga0501074_0245042_93_692 | 196 |
| 685 | 3300049590 | Ga0501074_0295137 | Ga0501074_0295137_317_916 | 196 |
| 686 | 3300049592 | Ga0501076_0224333 | Ga0501076_0224333_799_1398 | 196 |
| 687 | 3300049741 | Ga0501079_0511221 | Ga0501079_0511221_253_852 | 196 |
| 688 | 3300049742 | Ga0501080_0002496 | Ga0501080_0002496_1185_1784 | 196 |
| 689 | 3300049742 | Ga0501080_0372394 | Ga0501080_0372394_441_1040 | 196 |
| 690 | 3300049742 | Ga0501080_0807337 | Ga0501080_0807337_70_669 | 196 |
| 691 | 3300049743 | Ga0501081_0084008 | Ga0501081_0084008_13_612 | 196 |
| 692 | 3300049744 | Ga0501083_0000907 | Ga0501083_0000907_18828_19427 | 196 |
| 693 | 3300049744 | Ga0501083_0107294 | Ga0501083_0107294_226_921 | 196 |
| 694 | 3300049822 | Ga0501035_0027957 | Ga0501035_0027957_2391_2990 | 196 |
| 695 | 3300049822 | Ga0501035_0073122 | Ga0501035_0073122_2350_2949 | 196 |
| 696 | 3300049822 | Ga0501035_0204363 | Ga0501035_0204363_13_612 | 196 |
| 697 | 3300049823 | Ga0501044_0026561 | Ga0501044_0026561_1221_1820 | 196 |
| 698 | 3300049823 | Ga0501044_0098785 | Ga0501044_0098785_175_774 | 196 |
| 699 | 3300049823 | Ga0501044_0174599 | Ga0501044_0174599_812_1411 | 196 |
| 700 | 3300049823 | Ga0501044_0217238 | Ga0501044_0217238_797_1396 | 196 |
| 701 | 3300049823 | Ga0501044_0700303 | Ga0501044_0700303_257_856 | 196 |
| 702 | 3300050489 | nmdc:mga03683_141433_c1 | nmdc:mga03683_141433_c1_452_1057 | 196 |
| 703 | 3300050490 | nmdc:mga03n38_2816_c1 | nmdc:mga03n38_2816_c1_3547_4152 | 196 |
| 704 | 3300050490 | nmdc:mga03n38_357505_c1 | nmdc:mga03n38_357505_c1_65_670 | 196 |
| 705 | 3300050491 | nmdc:mga00v17_105962_c1 | nmdc:mga00v17_105962_c1_326_931 | 196 |
| 706 | 3300050491 | nmdc:mga00v17_376480_c1 | nmdc:mga00v17_376480_c1_80_685 | 196 |
| 707 | 3300050491 | nmdc:mga00v17_619266_c1 | nmdc:mga00v17_619266_c1_23_628 | 196 |
| 708 | 3300050492 | nmdc:mga0yw44_107934_c1 | nmdc:mga0yw44_107934_c1_806_1411 | 196 |
| 709 | 3300050492 | nmdc:mga0yw44_367753_c1 | nmdc:mga0yw44_367753_c1_42_647 | 196 |
| 710 | 3300050492 | nmdc:mga0yw44_46341_c1 | nmdc:mga0yw44_46341_c1_920_1525 | 196 |
| 711 | 3300050492 | nmdc:mga0yw44_56354_c1 | nmdc:mga0yw44_56354_c1_1498_2103 | 196 |
| 712 | 3300050494 | nmdc:mga06z11_116256_c1 | nmdc:mga06z11_116256_c1_374_979 | 196 |
| 713 | 3300050494 | nmdc:mga06z11_212962_c1 | nmdc:mga06z11_212962_c1_100_705 | 196 |
| 714 | 3300050496 | nmdc:mga07m45_12747_c1 | nmdc:mga07m45_12747_c1_194_799 | 196 |
| 715 | 3300050496 | nmdc:mga07m45_7177_c1 | nmdc:mga07m45_7177_c1_1925_2530 | 196 |
| 716 | 3300050507 | nmdc:mga05p37_933068_c1 | nmdc:mga05p37_933068_c1_59_664 | 196 |
| 717 | 3300050509 | nmdc:mga0qj67_533065_c1 | nmdc:mga0qj67_533065_c1_21_698 | 196 |
| 718 | 3300050511 | nmdc:mga08y16_653652_c1 | nmdc:mga08y16_653652_c1_59_664 | 196 |
| 719 | 3300050512 | nmdc:mga0n895_2683_c1 | nmdc:mga0n895_2683_c1_2795_3400 | 196 |
| 720 | 3300050512 | nmdc:mga0n895_828236_c1 | nmdc:mga0n895_828236_c1_70_675 | 196 |
| 721 | 3300050513 | nmdc:mga0rr50_202335_c1 | nmdc:mga0rr50_202335_c1_666_1271 | 196 |
| 722 | 3300053077 | Ga0495601_0508923 | Ga0495601_0508923_70_675 | 196 |
| 723 | 3300053083 | Ga0495655_0122076 | Ga0495655_0122076_136_750 | 196 |
| 724 | 3300053087 | Ga0500643_057111 | Ga0500643_057111_116_721 | 196 |
| 725 | 3300053092 | Ga0500583_0002146 | Ga0500583_0002146_4175_4780 | 196 |
| 726 | 3300053096 | Ga0500641_0010909 | Ga0500641_0010909_782_1387 | 196 |
| 727 | 3300053096 | Ga0500641_0032132 | Ga0500641_0032132_513_1118 | 196 |
| 728 | 3300053098 | Ga0500650_0102599 | Ga0500650_0102599_473_1078 | 196 |
| 729 | 3300053108 | Ga0500562_062741 | Ga0500562_062741_64_669 | 196 |
| 730 | 3300053119 | Ga0500595_026500 | Ga0500595_026500_1351_1956 | 196 |
| 731 | 3300053130 | Ga0500642_0042665 | Ga0500642_0042665_680_1285 | 196 |
| 732 | 3300053133 | Ga0500655_007057 | Ga0500655_007057_705_1307 | 196 |
| 733 | 3300053134 | Ga0500658_0108904 | Ga0500658_0108904_242_847 | 196 |
| 734 | 3300053137 | Ga0500561_0032548 | Ga0500561_0032548_595_1200 | 196 |
| 735 | 3300053137 | Ga0500561_0035092 | Ga0500561_0035092_501_1106 | 196 |
| 736 | 3300053138 | Ga0500564_224132 | Ga0500564_224132_13_603 | 196 |
| 737 | 3300053142 | Ga0500577_0041332 | Ga0500577_0041332_389_994 | 196 |
| 738 | 3300053142 | Ga0500577_0101939 | Ga0500577_0101939_491_1108 | 196 |
| 739 | 3300053146 | Ga0500588_0046310 | Ga0500588_0046310_720_1325 | 196 |
| 740 | 3300053146 | Ga0500588_0062429 | Ga0500588_0062429_80_685 | 196 |
| 741 | 3300053151 | Ga0500604_0029032 | Ga0500604_0029032_429_1034 | 196 |
| 742 | 3300053158 | Ga0500627_0082880 | Ga0500627_0082880_464_1069 | 196 |
| 743 | 3300053161 | Ga0500634_0088424 | Ga0500634_0088424_18_623 | 196 |
| 744 | 3300053161 | Ga0500634_0112562 | Ga0500634_0112562_521_1126 | 196 |
| 745 | 3300053162 | Ga0500638_204173 | Ga0500638_204173_128_733 | 196 |
| 746 | 3300053178 | Ga0500637_0061432 | Ga0500637_0061432_647_1252 | 196 |
| 747 | 3300053731 | Ga0500609_018439 | Ga0500609_018439_193_798 | 196 |
| 748 | 3300053732 | Ga0500656_016602 | Ga0500656_016602_236_841 | 196 |
| 749 | 3300054114 | Ga0501084_0818165 | Ga0501084_0818165_107_706 | 196 |
| 750 | 3300060353 | Ga0501082_0110947 | Ga0501082_0110947_408_1007 | 196 |
| 751 | 3300060353 | Ga0501082_0366631 | Ga0501082_0366631_267_866 | 196 |
| 752 | iso_pu_bacteria | 2513237101 | 2513693407 | 196 |
| 753 | iso_pu_bacteria | 2513237104 | 2513715202 | 196 |
| 754 | iso_pu_bacteria | 2721755755 | 2723848320 | 196 |
| 755 | iso_pu_bacteria | 2791355199 | 2793079597 | 196 |
| 756 | iso_pu_bacteria | 2874604998 | 2874607466 | 196 |
| 757 | iso_pu_bacteria | 2876808645 | 2876814805 | 196 |
| 758 | iso_pu_bacteria | 2879110137 | 2879111053 | 196 |
| 759 | iso_pu_bacteria | 2889033259 | 2889037155 | 196 |
| 760 | iso_pu_bacteria | 2922386360 | 2922392916 | 196 |
| 761 | iso_pu_bacteria | 8006926726 | 8006928425 | 196 |
| 762 | iso_pu_bacteria | 8006964411 | 8006969624 | 196 |
| 763 | iso_pu_bacteria | 8006984368 | 8006990673 | 196 |
| 764 | iso_pu_bacteria | 8006994254 | 8006998701 | 196 |
| 765 | iso_pu_bacteria | 8056673599 | 8056676666 | 196 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3awh-assembly1.cif.gz_B | e13k mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) | 0.807 | 38 | 149 |
| 2htd-assembly1.cif.gz_A | crystal structure of a putative pyridoxamine 5'-phosphate oxidase (ldb0262) from lactobacillus delbrueckii subsp. at 1.60 a resolution | 0.8059 | 28 | 146 |
| 7kpz-assembly1.cif.gz_A | 1.70 a resolution crystal structure of group a streptococcus hupz-v5-his6 | 0.8052 | 31 | 147 |
| 1wli-assembly1.cif.gz_B | l122y mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) | 0.7991 | 44 | 149 |
| 2e83-assembly1.cif.gz_B | t31v mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) | 0.7961 | 44 | 149 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5escD00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8176 | 31 | 149 | 2.30.110.10 |
| 5escD00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8052 | 31 | 149 | 2.30.110.10 |
| 2htdA00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8007 | 28 | 146 | 2.30.110.10 |
| 1wliA00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.7964 | 44 | 149 | 2.30.110.10 |
| af_Q54YS6_26_227_2.30.110.10 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.7938 | 43 | 130 | 2.30.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537QQE2-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase family protein | 0.9692 | 2 | 193 |
|
| AF-A0A4Y9RLZ5-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase family protein | 0.9604 | 2 | 172 |
|
| AF-A0A433B166-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase | 0.9597 | 2 | 188 |
|
| AF-A0A0B7IS50-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase-related FMN-binding protein | 0.9579 | 2 | 189 |
|
| AF-A0A3N5H7Z0-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase family protein | 0.9569 | 2 | 188 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar