F479809
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 765 | 401 | 1530 | 186 |
Family's Representative Sequence
| Representative Sequence | 3300050516|nmdc:mga0sz30_319121_c1|nmdc:mga0sz30_319121_c1_34_660 |
| Length | 208 |
| Sequence | MPDGPPGRDKTRKKRDPMPHPKFCQVCATPLEWIALMEDGGPKERLRCPNCGHTHWNNPTPVLAAIVEYRGQVLLARNAAWPGKMFALITGFMEAGETPEEGIAREVKEETNLDVSAAKIVGAYDFQRMNQVIIAYHVVADGEVKLSPELVDYRLYDLPDLKCWPAGTGYALADWLRTRGHEPVFFTAAENEERRRGLNLPPEPGNAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 16 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 17 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 60 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 61 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 62 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 63 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 64 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 65 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 66 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 73 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 85 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 86 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 96 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 97 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 100 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 101 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 107 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 108 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 110 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 166 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 169 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 171 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 172 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 173 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 174 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 175 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 176 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 177 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 178 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 179 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 182 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 183 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 184 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 185 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 186 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 187 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 188 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 190 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 196 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 197 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 198 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 199 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 200 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 202 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 203 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 206 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 207 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 208 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 209 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 210 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 211 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 212 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 216 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 217 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 218 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 219 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 220 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 221 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 222 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 223 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 224 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 225 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 226 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 227 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 228 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 229 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 230 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 231 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 232 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 233 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 234 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 235 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 236 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 237 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 276 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 277 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 278 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 279 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 280 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 283 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 284 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 285 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 286 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 287 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 288 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 289 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 290 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 291 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 292 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 293 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 294 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 295 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 296 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 298 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 299 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 300 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 301 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 302 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 303 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 304 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 305 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 306 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 307 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 308 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 309 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 310 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 311 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 312 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 313 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 314 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 315 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 316 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 317 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 318 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 319 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 320 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 321 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 322 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 323 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 324 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 325 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 326 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 327 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 328 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 329 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 330 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 331 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 332 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 333 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 334 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 335 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 336 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 337 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 338 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 339 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 340 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 341 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 342 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 343 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 344 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 345 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 346 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 347 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 348 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 349 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 350 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 351 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 352 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 353 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 354 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 355 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 356 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 357 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 358 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 359 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 360 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 361 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 362 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 363 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 364 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 365 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 366 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 367 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 368 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 369 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 370 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 371 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 372 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 373 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 374 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 375 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 376 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 377 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 378 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 379 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 380 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 381 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 382 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 383 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 384 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 385 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 386 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 387 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 388 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 389 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 390 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 391 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 392 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 393 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 394 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 395 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 396 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 397 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 398 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 399 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 400 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 401 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.29 |
| Metatranscriptomes | 0.39 |
| Isolates | 7.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 36.86 |
| Nodule | 0.52 |
| Rhizoplane | 3.53 |
| Rhizosphere | 46.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga0sz30_319121_c1 | 3300050516 | Bacteria | 693 |
| 2 | JGI24740J21852_10030281 | 3300001979 | Bacteria | 1764 |
| 3 | JGI24740J21852_10070441 | 3300001979 | Bacteria | 938 |
| 4 | JGI25155J39150_1000223 | 3300002704 | Bacteria | 22401 |
| 5 | JGI25156J39149_1000045 | 3300002705 | Bacteria | 104173 |
| 6 | JGI25156J39149_1010399 | 3300002705 | Bacteria | 2190 |
| 7 | JGI25154J39366_1000064 | 3300002738 | Bacteria | 104148 |
| 8 | JGI25158J39367_1008558 | 3300002739 | Bacteria | 1419 |
| 9 | JGI25157J39369_1000063 | 3300002741 | Bacteria | 104173 |
| 10 | JGI25152J39213_1009477 | 3300002773 | Bacteria | 2310 |
| 11 | JGI25152J39213_1009835 | 3300002773 | Bacteria | 2235 |
| 12 | JGI25152J39213_1015472 | 3300002773 | Bacteria | 1504 |
| 13 | JGI25150J39212_1002850 | 3300002774 | Bacteria | 4185 |
| 14 | JGI25150J39212_1003825 | 3300002774 | Bacteria | 3459 |
| 15 | JGI25150J39212_1003925 | 3300002774 | Bacteria | 3395 |
| 16 | JGI25150J39212_1014919 | 3300002774 | Bacteria | 1307 |
| 17 | JGI25159J45721_1000798 | 3300002987 | Bacteria | 13721 |
| 18 | JGI25159J45721_1010548 | 3300002987 | Bacteria | 2344 |
| 19 | JGI25159J45721_1013766 | 3300002987 | Bacteria | 1855 |
| 20 | JGI25159J45721_1023019 | 3300002987 | Bacteria | 1139 |
| 21 | JGI25151J46595_10003268 | 3300003187 | Bacteria | 9013 |
| 22 | JGI25151J46595_10005204 | 3300003187 | Bacteria | 6746 |
| 23 | JGI25151J46595_10005490 | 3300003187 | Bacteria | 6540 |
| 24 | JGI25151J46595_10008408 | 3300003187 | Bacteria | 4967 |
| 25 | JGI25151J46595_10024951 | 3300003187 | Bacteria | 2438 |
| 26 | JGI25151J46595_10026989 | 3300003187 | Bacteria | 2310 |
| 27 | JGI25151J46595_10090142 | 3300003187 | Bacteria | 856 |
| 28 | JGI25151J46595_10090161 | 3300003187 | Bacteria | 856 |
| 29 | JGI25153J46596_10022631 | 3300003215 | Bacteria | 2310 |
| 30 | JGI25153J46596_10028099 | 3300003215 | Bacteria | 1958 |
| 31 | rootH1_10036541 | 3300003323 | Bacteria | 2460 |
| 32 | JGI25160J50197_1000316 | 3300003354 | Bacteria | 33601 |
| 33 | JGI25160J50197_1016807 | 3300003354 | Bacteria | 2344 |
| 34 | JGI25160J50197_1022936 | 3300003354 | Bacteria | 1818 |
| 35 | JGI25161J50226_1000236 | 3300003374 | Bacteria | 33595 |
| 36 | JGI25161J50226_1005307 | 3300003374 | Bacteria | 2523 |
| 37 | JGI25161J50226_1009924 | 3300003374 | Bacteria | 1313 |
| 38 | Ga0006562J51391_1018602 | 3300003578 | Bacteria | 3830 |
| 39 | Ga0006562J51391_1018603 | 3300003578 | Bacteria | 2740 |
| 40 | Ga0006562J51391_1039299 | 3300003578 | Bacteria | 1170 |
| 41 | Ga0055535_1000142 | 3300003761 | Bacteria | 75104 |
| 42 | Ga0055542_1000022 | 3300003762 | Bacteria | 302315 |
| 43 | Ga0055526_1001281 | 3300003771 | Bacteria | 18027 |
| 44 | Ga0055526_1002710 | 3300003771 | Bacteria | 11768 |
| 45 | Ga0055526_1020540 | 3300003771 | Bacteria | 2344 |
| 46 | Ga0055526_1021182 | 3300003771 | Bacteria | 2273 |
| 47 | Ga0055537_1000134 | 3300003773 | Bacteria | 56046 |
| 48 | Ga0055537_1000634 | 3300003773 | Bacteria | 18768 |
| 49 | Ga0055537_1008722 | 3300003773 | Bacteria | 2310 |
| 50 | Ga0055524_1000114 | 3300003775 | Bacteria | 94476 |
| 51 | Ga0055524_1019201 | 3300003775 | Bacteria | 2344 |
| 52 | Ga0055524_1019969 | 3300003775 | Bacteria | 2273 |
| 53 | Ga0055536_1000705 | 3300003781 | Bacteria | 22398 |
| 54 | Ga0055536_1004046 | 3300003781 | Bacteria | 7636 |
| 55 | Ga0055536_1008356 | 3300003781 | Bacteria | 4467 |
| 56 | Ga0055536_1019549 | 3300003781 | Bacteria | 2124 |
| 57 | Ga0055536_1041306 | 3300003781 | Bacteria | 1090 |
| 58 | Ga0055534_1000088 | 3300003784 | Bacteria | 72004 |
| 59 | Ga0055534_1002639 | 3300003784 | Bacteria | 6086 |
| 60 | Ga0055534_1003059 | 3300003784 | Bacteria | 5471 |
| 61 | Ga0055534_1008700 | 3300003784 | Bacteria | 2274 |
| 62 | Ga0055528_1000135 | 3300003790 | Bacteria | 59436 |
| 63 | Ga0055528_1000630 | 3300003790 | Bacteria | 26033 |
| 64 | Ga0055528_1011813 | 3300003790 | Bacteria | 3436 |
| 65 | Ga0055528_1018929 | 3300003790 | Bacteria | 2310 |
| 66 | Ga0055530_10000473 | 3300003791 | Bacteria | 35024 |
| 67 | Ga0055530_10000962 | 3300003791 | Bacteria | 23389 |
| 68 | Ga0055530_10043050 | 3300003791 | Bacteria | 1091 |
| 69 | Ga0055530_10044570 | 3300003791 | Bacteria | 1063 |
| 70 | Ga0055540_1000153 | 3300003792 | Bacteria | 68176 |
| 71 | Ga0055540_1000730 | 3300003792 | Bacteria | 22398 |
| 72 | Ga0055540_1003446 | 3300003792 | Bacteria | 7640 |
| 73 | Ga0055540_1008455 | 3300003792 | Bacteria | 3705 |
| 74 | Ga0055540_1023232 | 3300003792 | Bacteria | 1565 |
| 75 | Ga0055531_10002924 | 3300003794 | Bacteria | 11120 |
| 76 | Ga0055531_10007733 | 3300003794 | Bacteria | 5801 |
| 77 | Ga0055531_10023771 | 3300003794 | Bacteria | 2285 |
| 78 | Ga0055531_10029872 | 3300003794 | Bacteria | 1845 |
| 79 | Ga0055531_10048699 | 3300003794 | Bacteria | 1140 |
| 80 | Ga0055543_1000605 | 3300004625 | Bacteria | 19442 |
| 81 | Ga0055543_1007952 | 3300004625 | Bacteria | 2395 |
| 82 | Ga0065165_1020642 | 3300005262 | Bacteria | 2312 |
| 83 | Ga0065165_1025030 | 3300005262 | Bacteria | 1993 |
| 84 | Ga0065165_1025184 | 3300005262 | Bacteria | 1984 |
| 85 | Ga0065165_1029492 | 3300005262 | Bacteria | 1756 |
| 86 | Ga0065165_1031225 | 3300005262 | Bacteria | 1686 |
| 87 | Ga0065165_1050881 | 3300005262 | Bacteria | 1177 |
| 88 | Ga0065165_1084473 | 3300005262 | Bacteria | 818 |
| 89 | Ga0065714_10004149 | 3300005288 | Bacteria | 5915 |
| 90 | Ga0065714_10143273 | 3300005288 | Bacteria | 1156 |
| 91 | Ga0065704_10113056 | 3300005289 | Bacteria | 1920 |
| 92 | Ga0070658_10397971 | 3300005327 | Bacteria | 1183 |
| 93 | Ga0070658_10726101 | 3300005327 | Bacteria | 863 |
| 94 | Ga0068869_100223657 | 3300005334 | Bacteria | 1493 |
| 95 | Ga0070666_10212173 | 3300005335 | Bacteria | 1364 |
| 96 | Ga0068868_100097533 | 3300005338 | Bacteria | 2375 |
| 97 | Ga0070661_100001209 | 3300005344 | Bacteria | 18186 |
| 98 | Ga0070669_100532246 | 3300005353 | Bacteria | 978 |
| 99 | Ga0070669_100823185 | 3300005353 | Bacteria | 790 |
| 100 | Ga0070674_100032006 | 3300005356 | Bacteria | 3490 |
| 101 | Ga0070673_100222023 | 3300005364 | Bacteria | 1636 |
| 102 | Ga0070688_100213909 | 3300005365 | Bacteria | 1355 |
| 103 | Ga0070659_100005054 | 3300005366 | Bacteria | 9458 |
| 104 | Ga0070667_100028787 | 3300005367 | Bacteria | 4625 |
| 105 | Ga0070667_100052972 | 3300005367 | Bacteria | 3424 |
| 106 | Ga0070678_100027689 | 3300005456 | Bacteria | 3852 |
| 107 | Ga0070678_100038770 | 3300005456 | Bacteria | 3357 |
| 108 | Ga0070678_100217469 | 3300005456 | Bacteria | 1586 |
| 109 | Ga0070678_100226206 | 3300005456 | Bacteria | 1557 |
| 110 | Ga0070678_100889913 | 3300005456 | Bacteria | 813 |
| 111 | Ga0070662_100028288 | 3300005457 | Bacteria | 3900 |
| 112 | Ga0070662_100484005 | 3300005457 | Bacteria | 1030 |
| 113 | Ga0070706_100324736 | 3300005467 | Bacteria | 1435 |
| 114 | Ga0070707_100136640 | 3300005468 | Bacteria | 2385 |
| 115 | Ga0070679_100102866 | 3300005530 | Bacteria | 2843 |
| 116 | Ga0068853_100011565 | 3300005539 | Bacteria | 7176 |
| 117 | Ga0070665_100024888 | 3300005548 | Bacteria | 6032 |
| 118 | Ga0070665_100068370 | 3300005548 | Bacteria | 3562 |
| 119 | Ga0070665_100266655 | 3300005548 | Bacteria | 1714 |
| 120 | Ga0068855_100144470 | 3300005563 | Bacteria | 2710 |
| 121 | Ga0070664_100018592 | 3300005564 | Bacteria | 5712 |
| 122 | Ga0070664_100112954 | 3300005564 | Bacteria | 2373 |
| 123 | Ga0068857_100042395 | 3300005577 | Bacteria | 4037 |
| 124 | Ga0068854_100127781 | 3300005578 | Bacteria | 1938 |
| 125 | Ga0068856_100939010 | 3300005614 | Bacteria | 884 |
| 126 | Ga0070702_100780329 | 3300005615 | Bacteria | 737 |
| 127 | Ga0068852_100224588 | 3300005616 | Bacteria | 1787 |
| 128 | Ga0068851_10033206 | 3300005834 | Bacteria | 2571 |
| 129 | Ga0068863_100279554 | 3300005841 | Bacteria | 1617 |
| 130 | Ga0075365_10158975 | 3300006038 | Bacteria | 1574 |
| 131 | Ga0075363_100024393 | 3300006048 | Bacteria | 3074 |
| 132 | Ga0075363_100247420 | 3300006048 | Bacteria | 1026 |
| 133 | Ga0075364_10272887 | 3300006051 | Bacteria | 1150 |
| 134 | Ga0075432_10017603 | 3300006058 | Bacteria | 2436 |
| 135 | Ga0075362_10013049 | 3300006177 | Bacteria | 3316 |
| 136 | Ga0075362_10026340 | 3300006177 | Bacteria | 2482 |
| 137 | Ga0075362_10034297 | 3300006177 | Bacteria | 2212 |
| 138 | Ga0075362_10067001 | 3300006177 | Bacteria | 1633 |
| 139 | Ga0075362_10071724 | 3300006177 | Bacteria | 1583 |
| 140 | Ga0075362_10153702 | 3300006177 | Bacteria | 1105 |
| 141 | Ga0075367_10242048 | 3300006178 | Bacteria | 1131 |
| 142 | Ga0075367_10642940 | 3300006178 | Bacteria | 674 |
| 143 | Ga0075369_10126380 | 3300006186 | Bacteria | 1160 |
| 144 | Ga0075369_10150909 | 3300006186 | Bacteria | 1062 |
| 145 | Ga0075366_10005247 | 3300006195 | Bacteria | 7014 |
| 146 | Ga0075366_10026719 | 3300006195 | Bacteria | 3382 |
| 147 | Ga0075366_10136314 | 3300006195 | Bacteria | 1482 |
| 148 | Ga0075366_10163703 | 3300006195 | Bacteria | 1348 |
| 149 | Ga0075366_10262860 | 3300006195 | Bacteria | 1053 |
| 150 | Ga0075366_10272578 | 3300006195 | Bacteria | 1034 |
| 151 | Ga0097621_100065798 | 3300006237 | Bacteria | 2984 |
| 152 | Ga0097621_100387128 | 3300006237 | Bacteria | 1250 |
| 153 | Ga0097621_100671876 | 3300006237 | Bacteria | 952 |
| 154 | Ga0075370_10002395 | 3300006353 | Bacteria | 8682 |
| 155 | Ga0075370_10004349 | 3300006353 | Bacteria | 6866 |
| 156 | Ga0075370_10026838 | 3300006353 | Bacteria | 3192 |
| 157 | Ga0075370_10058172 | 3300006353 | Bacteria | 2198 |
| 158 | Ga0075370_10117798 | 3300006353 | Bacteria | 1544 |
| 159 | Ga0075370_10168276 | 3300006353 | Bacteria | 1288 |
| 160 | Ga0075370_10428739 | 3300006353 | Bacteria | 795 |
| 161 | Ga0075370_10565707 | 3300006353 | Bacteria | 688 |
| 162 | Ga0075370_10642398 | 3300006353 | Bacteria | 644 |
| 163 | Ga0068871_100083605 | 3300006358 | Bacteria | 2648 |
| 164 | Ga0068865_100100582 | 3300006881 | Bacteria | 2116 |
| 165 | Ga0075436_100210527 | 3300006914 | Bacteria | 1378 |
| 166 | Ga0099826_10001370 | 3300006948 | Bacteria | 14497 |
| 167 | Ga0105244_10012570 | 3300009036 | Bacteria | 4994 |
| 168 | Ga0105244_10108715 | 3300009036 | Bacteria | 1351 |
| 169 | Ga0105240_10126866 | 3300009093 | Bacteria | 3065 |
| 170 | Ga0105245_10441714 | 3300009098 | Bacteria | 1308 |
| 171 | Ga0105245_10702953 | 3300009098 | Bacteria | 1044 |
| 172 | Ga0105245_11475186 | 3300009098 | Bacteria | 731 |
| 173 | Ga0105243_10006758 | 3300009148 | Bacteria | 8850 |
| 174 | Ga0105243_10009873 | 3300009148 | Bacteria | 7260 |
| 175 | Ga0105243_10303192 | 3300009148 | Bacteria | 1449 |
| 176 | Ga0105241_10243307 | 3300009174 | Bacteria | 1522 |
| 177 | Ga0105242_11114671 | 3300009176 | Bacteria | 804 |
| 178 | Ga0105237_10029245 | 3300009545 | Bacteria | 5604 |
| 179 | Ga0105238_10064300 | 3300009551 | Bacteria | 3669 |
| 180 | Ga0105238_10261834 | 3300009551 | Bacteria | 1709 |
| 181 | Ga0105249_11723208 | 3300009553 | Bacteria | 699 |
| 182 | Ga0105239_10349276 | 3300010375 | Bacteria | 1670 |
| 183 | Ga0105246_10053898 | 3300011119 | Bacteria | 2769 |
| 184 | Ga0157320_1017629 | 3300012481 | Bacteria | 623 |
| 185 | Ga0157347_1013284 | 3300012502 | Bacteria | 898 |
| 186 | Ga0157326_1000472 | 3300012513 | Bacteria | 4813 |
| 187 | Ga0157373_10016632 | 3300013100 | Bacteria | 5361 |
| 188 | Ga0157373_10092360 | 3300013100 | Bacteria | 2132 |
| 189 | Ga0157373_10110847 | 3300013100 | Bacteria | 1929 |
| 190 | Ga0157370_10039005 | 3300013104 | Bacteria | 4593 |
| 191 | Ga0157370_10172185 | 3300013104 | Bacteria | 2012 |
| 192 | Ga0157374_11960993 | 3300013296 | Bacteria | 612 |
| 193 | Ga0157378_10024673 | 3300013297 | Bacteria | 5294 |
| 194 | Ga0163162_10027211 | 3300013306 | Bacteria | 5654 |
| 195 | Ga0163162_10238220 | 3300013306 | Bacteria | 1950 |
| 196 | Ga0157375_10066886 | 3300013308 | Bacteria | 3589 |
| 197 | Ga0157375_11443627 | 3300013308 | Bacteria | 811 |
| 198 | Ga0182008_10000215 | 3300014497 | Bacteria | 45361 |
| 199 | Ga0182008_10002427 | 3300014497 | Bacteria | 11696 |
| 200 | Ga0182008_10006865 | 3300014497 | Bacteria | 6333 |
| 201 | Ga0182008_10011104 | 3300014497 | Bacteria | 4805 |
| 202 | Ga0182008_10016496 | 3300014497 | Bacteria | 3838 |
| 203 | Ga0182008_10063964 | 3300014497 | Bacteria | 1811 |
| 204 | Ga0157376_10218149 | 3300014969 | Bacteria | 1765 |
| 205 | Ga0182006_1001570 | 3300015261 | Bacteria | 13642 |
| 206 | Ga0182006_1226165 | 3300015261 | Bacteria | 616 |
| 207 | Ga0182007_10001908 | 3300015262 | Bacteria | 10838 |
| 208 | Ga0182007_10003300 | 3300015262 | Bacteria | 7652 |
| 209 | Ga0182007_10092164 | 3300015262 | Bacteria | 998 |
| 210 | Ga0183362_10005 | 3300015683 | Bacteria | 437616 |
| 211 | Ga0163161_10004047 | 3300017792 | Bacteria | 10254 |
| 212 | Ga0163161_10020171 | 3300017792 | Bacteria | 4676 |
| 213 | Ga0163161_10044139 | 3300017792 | Bacteria | 3211 |
| 214 | Ga0163161_10117515 | 3300017792 | Bacteria | 1995 |
| 215 | Ga0213872_10011488 | 3300021361 | Bacteria | 4187 |
| 216 | Ga0209435_100003 | 3300025206 | Bacteria | 669534 |
| 217 | Ga0209436_103153 | 3300025208 | Bacteria | 4519 |
| 218 | Ga0209436_105965 | 3300025208 | Bacteria | 2726 |
| 219 | Ga0209436_111580 | 3300025208 | Bacteria | 1542 |
| 220 | Ga0209672_101007 | 3300025228 | Bacteria | 12321 |
| 221 | Ga0209147_103626 | 3300025229 | Bacteria | 2897 |
| 222 | Ga0209258_100009 | 3300025242 | Bacteria | 996276 |
| 223 | Ga0207425_1001790 | 3300025245 | Bacteria | 8331 |
| 224 | Ga0207425_1003665 | 3300025245 | Bacteria | 4837 |
| 225 | Ga0207425_1010227 | 3300025245 | Bacteria | 2294 |
| 226 | Ga0207425_1018704 | 3300025245 | Bacteria | 1500 |
| 227 | Ga0209646_1000008 | 3300025246 | Bacteria | 669534 |
| 228 | Ga0209026_1000007 | 3300025250 | Bacteria | 669534 |
| 229 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 230 | Ga0209759_1000019 | 3300025256 | Bacteria | 357908 |
| 231 | Ga0209129_1000024 | 3300025258 | Bacteria | 417268 |
| 232 | Ga0209129_1000085 | 3300025258 | Bacteria | 181765 |
| 233 | Ga0209129_1003741 | 3300025258 | Bacteria | 6426 |
| 234 | Ga0209129_1005702 | 3300025258 | Bacteria | 4294 |
| 235 | Ga0209129_1020873 | 3300025258 | Bacteria | 1210 |
| 236 | Ga0209129_1034832 | 3300025258 | Bacteria | 822 |
| 237 | Ga0209565_1000043 | 3300025263 | Bacteria | 235332 |
| 238 | Ga0209565_1000046 | 3300025263 | Bacteria | 226073 |
| 239 | Ga0209565_1001626 | 3300025263 | Bacteria | 9464 |
| 240 | Ga0209565_1005766 | 3300025263 | Bacteria | 3559 |
| 241 | Ga0209565_1010497 | 3300025263 | Bacteria | 2293 |
| 242 | Ga0209673_1000008 | 3300025273 | Bacteria | 626013 |
| 243 | Ga0209673_1000058 | 3300025273 | Bacteria | 269028 |
| 244 | Ga0209673_1010330 | 3300025273 | Bacteria | 3942 |
| 245 | Ga0209673_1010835 | 3300025273 | Bacteria | 3810 |
| 246 | Ga0209673_1032272 | 3300025273 | Bacteria | 1616 |
| 247 | Ga0209673_1032359 | 3300025273 | Bacteria | 1612 |
| 248 | Ga0209130_1000181 | 3300025284 | Bacteria | 89402 |
| 249 | Ga0209130_1000481 | 3300025284 | Bacteria | 41115 |
| 250 | Ga0209130_1002262 | 3300025284 | Bacteria | 9935 |
| 251 | Ga0209130_1003501 | 3300025284 | Bacteria | 6597 |
| 252 | Ga0209130_1027946 | 3300025284 | Bacteria | 1191 |
| 253 | Ga0209130_1039276 | 3300025284 | Bacteria | 923 |
| 254 | Ga0209675_1000010 | 3300025291 | Bacteria | 541927 |
| 255 | Ga0209675_1000136 | 3300025291 | Bacteria | 99301 |
| 256 | Ga0209675_1003141 | 3300025291 | Bacteria | 8041 |
| 257 | Ga0209675_1005746 | 3300025291 | Bacteria | 5118 |
| 258 | Ga0209675_1005766 | 3300025291 | Bacteria | 5104 |
| 259 | Ga0209675_1014407 | 3300025291 | Bacteria | 2410 |
| 260 | Ga0209675_1015001 | 3300025291 | Bacteria | 2325 |
| 261 | Ga0209676_1000023 | 3300025292 | Bacteria | 589732 |
| 262 | Ga0209676_1000028 | 3300025292 | Bacteria | 559745 |
| 263 | Ga0209676_1000098 | 3300025292 | Bacteria | 234305 |
| 264 | Ga0209676_1000173 | 3300025292 | Bacteria | 153411 |
| 265 | Ga0209676_1000194 | 3300025292 | Bacteria | 136666 |
| 266 | Ga0209676_1006015 | 3300025292 | Bacteria | 6122 |
| 267 | Ga0209676_1006331 | 3300025292 | Bacteria | 5873 |
| 268 | Ga0209676_1015360 | 3300025292 | Bacteria | 2820 |
| 269 | Ga0209676_1077698 | 3300025292 | Bacteria | 766 |
| 270 | Ga0209025_1000122 | 3300025294 | Bacteria | 206064 |
| 271 | Ga0209025_1000404 | 3300025294 | Bacteria | 87744 |
| 272 | Ga0209025_1002394 | 3300025294 | Bacteria | 20027 |
| 273 | Ga0209025_1009104 | 3300025294 | Bacteria | 6995 |
| 274 | Ga0209025_1016764 | 3300025294 | Bacteria | 4288 |
| 275 | Ga0209025_1019136 | 3300025294 | Bacteria | 3826 |
| 276 | Ga0209025_1020502 | 3300025294 | Bacteria | 3613 |
| 277 | Ga0209025_1041131 | 3300025294 | Bacteria | 1986 |
| 278 | Ga0209025_1047888 | 3300025294 | Bacteria | 1740 |
| 279 | Ga0209025_1067826 | 3300025294 | Bacteria | 1286 |
| 280 | Ga0209025_1068034 | 3300025294 | Bacteria | 1283 |
| 281 | Ga0209025_1070815 | 3300025294 | Bacteria | 1239 |
| 282 | Ga0209564_1000183 | 3300025295 | Bacteria | 150409 |
| 283 | Ga0209564_1000198 | 3300025295 | Bacteria | 138511 |
| 284 | Ga0209564_1000279 | 3300025295 | Bacteria | 104927 |
| 285 | Ga0209564_1000478 | 3300025295 | Bacteria | 66586 |
| 286 | Ga0209564_1008404 | 3300025295 | Bacteria | 5096 |
| 287 | Ga0209758_1000049 | 3300025297 | Bacteria | 345104 |
| 288 | Ga0209758_1022895 | 3300025297 | Bacteria | 2845 |
| 289 | Ga0209758_1058085 | 3300025297 | Bacteria | 1296 |
| 290 | Ga0209758_1062437 | 3300025297 | Bacteria | 1220 |
| 291 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 292 | Ga0209050_1000022 | 3300025298 | Bacteria | 565239 |
| 293 | Ga0209050_1000122 | 3300025298 | Bacteria | 195305 |
| 294 | Ga0209050_1000554 | 3300025298 | Bacteria | 61514 |
| 295 | Ga0209050_1005757 | 3300025298 | Bacteria | 7642 |
| 296 | Ga0209050_1007635 | 3300025298 | Bacteria | 5998 |
| 297 | Ga0209050_1015969 | 3300025298 | Bacteria | 3107 |
| 298 | Ga0209050_1040978 | 3300025298 | Bacteria | 1283 |
| 299 | Ga0209050_1059928 | 3300025298 | Bacteria | 905 |
| 300 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 301 | Ga0209256_1000098 | 3300025299 | Bacteria | 204152 |
| 302 | Ga0209256_1000140 | 3300025299 | Bacteria | 152770 |
| 303 | Ga0207426_1000038 | 3300025302 | Bacteria | 441522 |
| 304 | Ga0207426_1000053 | 3300025302 | Bacteria | 384818 |
| 305 | Ga0207426_1000117 | 3300025302 | Bacteria | 224652 |
| 306 | Ga0207426_1020862 | 3300025302 | Bacteria | 2272 |
| 307 | Ga0207426_1104810 | 3300025302 | Bacteria | 723 |
| 308 | Ga0209051_1000013 | 3300025303 | Bacteria | 565239 |
| 309 | Ga0209051_1000015 | 3300025303 | Bacteria | 546798 |
| 310 | Ga0209051_1000159 | 3300025303 | Bacteria | 126836 |
| 311 | Ga0209051_1000194 | 3300025303 | Bacteria | 107213 |
| 312 | Ga0209051_1000282 | 3300025303 | Bacteria | 82787 |
| 313 | Ga0209051_1000597 | 3300025303 | Bacteria | 42565 |
| 314 | Ga0209051_1014777 | 3300025303 | Bacteria | 3625 |
| 315 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 316 | Ga0209257_1000042 | 3300025304 | Bacteria | 537149 |
| 317 | Ga0209257_1004288 | 3300025304 | Bacteria | 11233 |
| 318 | Ga0209257_1010273 | 3300025304 | Bacteria | 4778 |
| 319 | Ga0209257_1020820 | 3300025304 | Bacteria | 2406 |
| 320 | Ga0207697_10010983 | 3300025315 | Bacteria | 3845 |
| 321 | Ga0207656_10010157 | 3300025321 | Bacteria | 3516 |
| 322 | Ga0207655_1002288 | 3300025728 | Bacteria | 15755 |
| 323 | Ga0207682_10002990 | 3300025893 | Bacteria | 7417 |
| 324 | Ga0207642_10764117 | 3300025899 | Bacteria | 613 |
| 325 | Ga0207688_10042052 | 3300025901 | Bacteria | 2543 |
| 326 | Ga0207688_10504478 | 3300025901 | Bacteria | 758 |
| 327 | Ga0207680_10124114 | 3300025903 | Bacteria | 1693 |
| 328 | Ga0207643_10062819 | 3300025908 | Bacteria | 2122 |
| 329 | Ga0207705_10324413 | 3300025909 | Bacteria | 1184 |
| 330 | Ga0207654_10185859 | 3300025911 | Bacteria | 1358 |
| 331 | Ga0207707_10308383 | 3300025912 | Bacteria | 1368 |
| 332 | Ga0207671_10133849 | 3300025914 | Bacteria | 1905 |
| 333 | Ga0207671_10295761 | 3300025914 | Bacteria | 1279 |
| 334 | Ga0207671_10377306 | 3300025914 | Bacteria | 1126 |
| 335 | Ga0207662_10228691 | 3300025918 | Bacteria | 1214 |
| 336 | Ga0207657_10043944 | 3300025919 | Bacteria | 3932 |
| 337 | Ga0207657_10180680 | 3300025919 | Bacteria | 1705 |
| 338 | Ga0207657_10197245 | 3300025919 | Bacteria | 1621 |
| 339 | Ga0207649_10001378 | 3300025920 | Bacteria | 14398 |
| 340 | Ga0207652_10214327 | 3300025921 | Bacteria | 1734 |
| 341 | Ga0207681_10063129 | 3300025923 | Bacteria | 2553 |
| 342 | Ga0207681_10186908 | 3300025923 | Bacteria | 1582 |
| 343 | Ga0207681_10425734 | 3300025923 | Bacteria | 1076 |
| 344 | Ga0207650_10001149 | 3300025925 | Bacteria | 19437 |
| 345 | Ga0207687_10376259 | 3300025927 | Bacteria | 1162 |
| 346 | Ga0207687_10487568 | 3300025927 | Bacteria | 1027 |
| 347 | Ga0207687_10837996 | 3300025927 | Bacteria | 785 |
| 348 | Ga0207644_10001362 | 3300025931 | Bacteria | 15719 |
| 349 | Ga0207690_10159378 | 3300025932 | Bacteria | 1681 |
| 350 | Ga0207690_10721768 | 3300025932 | Bacteria | 820 |
| 351 | Ga0207706_10025112 | 3300025933 | Bacteria | 5342 |
| 352 | Ga0207706_10349535 | 3300025933 | Bacteria | 1286 |
| 353 | Ga0207686_10795342 | 3300025934 | Bacteria | 758 |
| 354 | Ga0207709_10000285 | 3300025935 | Bacteria | 57630 |
| 355 | Ga0207709_10004960 | 3300025935 | Bacteria | 7618 |
| 356 | Ga0207669_10005292 | 3300025937 | Bacteria | 5773 |
| 357 | Ga0207704_10072751 | 3300025938 | Bacteria | 2186 |
| 358 | Ga0207689_10131776 | 3300025942 | Bacteria | 2057 |
| 359 | Ga0207689_10382753 | 3300025942 | Bacteria | 1171 |
| 360 | Ga0207679_10000249 | 3300025945 | Bacteria | 41064 |
| 361 | Ga0207679_10093359 | 3300025945 | Bacteria | 2333 |
| 362 | Ga0207667_10272100 | 3300025949 | Bacteria | 1731 |
| 363 | Ga0207651_10001278 | 3300025960 | Bacteria | 11329 |
| 364 | Ga0207640_10069120 | 3300025981 | Bacteria | 2370 |
| 365 | Ga0207677_10003562 | 3300026023 | Bacteria | 8253 |
| 366 | Ga0207677_10289493 | 3300026023 | Bacteria | 1348 |
| 367 | Ga0207703_10197808 | 3300026035 | Bacteria | 1784 |
| 368 | Ga0207639_10010174 | 3300026041 | Bacteria | 6508 |
| 369 | Ga0207641_10094723 | 3300026088 | Bacteria | 2619 |
| 370 | Ga0207641_10889218 | 3300026088 | Bacteria | 884 |
| 371 | Ga0207648_10048712 | 3300026089 | Bacteria | 3709 |
| 372 | Ga0207676_10046020 | 3300026095 | Bacteria | 3374 |
| 373 | Ga0207674_10059455 | 3300026116 | Bacteria | 3867 |
| 374 | Ga0207674_10560732 | 3300026116 | Bacteria | 1103 |
| 375 | Ga0207674_10579827 | 3300026116 | Bacteria | 1084 |
| 376 | Ga0207674_10598378 | 3300026116 | Bacteria | 1065 |
| 377 | Ga0207683_10040254 | 3300026121 | Bacteria | 4077 |
| 378 | Ga0207683_10176551 | 3300026121 | Bacteria | 1936 |
| 379 | Ga0207683_10187549 | 3300026121 | Bacteria | 1877 |
| 380 | Ga0207683_10208821 | 3300026121 | Bacteria | 1776 |
| 381 | Ga0207683_10838453 | 3300026121 | Bacteria | 853 |
| 382 | Ga0207698_10202836 | 3300026142 | Bacteria | 1777 |
| 383 | Ga0209995_1015707 | 3300027471 | Bacteria | 1241 |
| 384 | Ga0209282_1001079 | 3300027666 | Bacteria | 14459 |
| 385 | Ga0209971_1004611 | 3300027682 | Bacteria | 3269 |
| 386 | Ga0209974_10028969 | 3300027876 | Bacteria | 1834 |
| 387 | Ga0207428_10590739 | 3300027907 | Bacteria | 801 |
| 388 | Ga0268266_10026117 | 3300028379 | Bacteria | 4969 |
| 389 | Ga0268266_10238118 | 3300028379 | Bacteria | 1679 |
| 390 | Ga0307517_10010725 | 3300028786 | Bacteria | 12781 |
| 391 | Ga0307515_10012653 | 3300028794 | Bacteria | 15850 |
| 392 | Ga0307515_10029938 | 3300028794 | Bacteria | 9173 |
| 393 | Ga0307515_10184906 | 3300028794 | Bacteria | 2018 |
| 394 | Ga0307515_10373200 | 3300028794 | Bacteria | 1062 |
| 395 | Ga0307512_10058292 | 3300030522 | Bacteria | 3010 |
| 396 | Ga0316177_1112288 | 3300030731 | Bacteria | 3326 |
| 397 | Ga0316177_1125363 | 3300030731 | Bacteria | 1720 |
| 398 | Ga0314311_1160343 | 3300030733 | Bacteria | 1320 |
| 399 | Ga0316178_1142965 | 3300030735 | Bacteria | 7757 |
| 400 | Ga0316183_1076813 | 3300030742 | Bacteria | 4172 |
| 401 | Ga0316183_1082821 | 3300030742 | Bacteria | 1198 |
| 402 | Ga0316181_1034408 | 3300030744 | Bacteria | 3273 |
| 403 | Ga0316182_1014668 | 3300030745 | Bacteria | 1054 |
| 404 | Ga0316182_1250129 | 3300030745 | Bacteria | 1266 |
| 405 | Ga0265330_10000014 | 3300031235 | Bacteria | 175673 |
| 406 | Ga0265332_10000011 | 3300031238 | Bacteria | 284299 |
| 407 | Ga0265332_10000035 | 3300031238 | Bacteria | 139554 |
| 408 | Ga0265325_10003832 | 3300031241 | Bacteria | 9673 |
| 409 | Ga0265327_10005786 | 3300031251 | Bacteria | 10168 |
| 410 | Ga0265327_10013542 | 3300031251 | Bacteria | 5411 |
| 411 | Ga0307513_10000020 | 3300031456 | Bacteria | 228745 |
| 412 | Ga0307513_10085785 | 3300031456 | Bacteria | 3230 |
| 413 | Ga0307513_10257508 | 3300031456 | Bacteria | 1537 |
| 414 | Ga0307509_10006670 | 3300031507 | Bacteria | 15405 |
| 415 | Ga0307509_10027095 | 3300031507 | Bacteria | 6381 |
| 416 | Ga0307509_10056928 | 3300031507 | Bacteria | 4147 |
| 417 | Ga0307509_10141405 | 3300031507 | Bacteria | 2341 |
| 418 | Ga0307408_100002073 | 3300031548 | Bacteria | 14439 |
| 419 | Ga0307408_100005387 | 3300031548 | Bacteria | 8572 |
| 420 | Ga0307408_100034033 | 3300031548 | Bacteria | 3565 |
| 421 | Ga0307408_100147544 | 3300031548 | Bacteria | 1853 |
| 422 | Ga0307408_100192946 | 3300031548 | Bacteria | 1642 |
| 423 | Ga0307408_100333476 | 3300031548 | Bacteria | 1282 |
| 424 | Ga0307408_100370267 | 3300031548 | Bacteria | 1221 |
| 425 | Ga0307408_100429414 | 3300031548 | Bacteria | 1141 |
| 426 | Ga0307408_100475960 | 3300031548 | Bacteria | 1088 |
| 427 | Ga0307408_100642828 | 3300031548 | Bacteria | 947 |
| 428 | Ga0307508_10053638 | 3300031616 | Bacteria | 3577 |
| 429 | Ga0307514_10072288 | 3300031649 | Bacteria | 2583 |
| 430 | Ga0307514_10384060 | 3300031649 | Bacteria | 727 |
| 431 | Ga0265314_10000026 | 3300031711 | Bacteria | 284299 |
| 432 | Ga0307516_10000311 | 3300031730 | Bacteria | 63197 |
| 433 | Ga0307516_10217770 | 3300031730 | Bacteria | 1620 |
| 434 | Ga0307405_10031768 | 3300031731 | Bacteria | 3112 |
| 435 | Ga0307405_10056743 | 3300031731 | Bacteria | 2457 |
| 436 | Ga0307405_10301009 | 3300031731 | Bacteria | 1216 |
| 437 | Ga0307406_10001422 | 3300031901 | Bacteria | 13270 |
| 438 | Ga0307406_10005238 | 3300031901 | Bacteria | 7086 |
| 439 | Ga0307406_10028541 | 3300031901 | Bacteria | 3372 |
| 440 | Ga0307406_10052872 | 3300031901 | Bacteria | 2585 |
| 441 | Ga0307406_10752138 | 3300031901 | Bacteria | 818 |
| 442 | Ga0307412_10033751 | 3300031911 | Bacteria | 3255 |
| 443 | Ga0307412_10075260 | 3300031911 | Bacteria | 2315 |
| 444 | Ga0307412_10097644 | 3300031911 | Bacteria | 2070 |
| 445 | Ga0307412_10107572 | 3300031911 | Bacteria | 1985 |
| 446 | Ga0307412_10120119 | 3300031911 | Bacteria | 1891 |
| 447 | Ga0307412_10338868 | 3300031911 | Bacteria | 1203 |
| 448 | Ga0307412_10366791 | 3300031911 | Bacteria | 1161 |
| 449 | Ga0307412_10544039 | 3300031911 | Bacteria | 974 |
| 450 | Ga0307412_10630421 | 3300031911 | Bacteria | 912 |
| 451 | Ga0307409_100007440 | 3300031995 | Bacteria | 6550 |
| 452 | Ga0307416_100035298 | 3300032002 | Bacteria | 3817 |
| 453 | Ga0307416_100175226 | 3300032002 | Bacteria | 2002 |
| 454 | Ga0307416_100986728 | 3300032002 | Bacteria | 945 |
| 455 | Ga0307414_10062189 | 3300032004 | Bacteria | 2648 |
| 456 | Ga0307414_10237145 | 3300032004 | Bacteria | 1508 |
| 457 | Ga0307411_10237172 | 3300032005 | Bacteria | 1425 |
| 458 | Ga0307411_10669359 | 3300032005 | Bacteria | 901 |
| 459 | Ga0307415_100071636 | 3300032126 | Bacteria | 2438 |
| 460 | Ga0307415_101090819 | 3300032126 | Bacteria | 747 |
| 461 | Ga0307507_10213669 | 3300033179 | Bacteria | 1310 |
| 462 | Ga0307507_10219951 | 3300033179 | Bacteria | 1278 |
| 463 | Ga0307510_10003147 | 3300033180 | Bacteria | 19133 |
| 464 | Ga0307510_10022531 | 3300033180 | Bacteria | 7314 |
| 465 | Ga0307510_10060349 | 3300033180 | Bacteria | 3904 |
| 466 | Ga0373932_0129161 | 3300035112 | Bacteria | 850 |
| 467 | Ga0373939_0244479 | 3300035114 | Bacteria | 696 |
| 468 | Ga0373962_0097594 | 3300035242 | Bacteria | 913 |
| 469 | Ga0373931_0030402 | 3300035691 | Bacteria | 2780 |
| 470 | Ga0373925_0280968 | 3300037068 | Bacteria | 1341 |
| 471 | Ga0436361_0327114 | 3300039447 | Bacteria | 10222 |
| 472 | Ga0436361_0443915 | 3300039447 | Bacteria | 3900 |
| 473 | Ga0439436_0000382 | 3300041404 | Bacteria | 11010 |
| 474 | Ga0439436_0004185 | 3300041404 | Bacteria | 4419 |
| 475 | Ga0439439_0028565 | 3300041406 | Bacteria | 1413 |
| 476 | Ga0439447_026574 | 3300041407 | Bacteria | 1483 |
| 477 | Ga0439461_0026457 | 3300041410 | Bacteria | 1184 |
| 478 | Ga0439466_0001231 | 3300041411 | Bacteria | 9960 |
| 479 | Ga0439466_0028602 | 3300041411 | Bacteria | 1923 |
| 480 | Ga0439465_0001246 | 3300041413 | Bacteria | 8214 |
| 481 | Ga0439465_0070058 | 3300041413 | Bacteria | 1174 |
| 482 | Ga0439465_0278196 | 3300041413 | Bacteria | 623 |
| 483 | Ga0451791_1627931 | 3300041451 | Bacteria | 727 |
| 484 | Ga0451795_0255321 | 3300041456 | Bacteria | 727 |
| 485 | Ga0451798_0795614 | 3300041458 | Bacteria | 1259 |
| 486 | Ga0451853_2985823 | 3300041512 | Bacteria | 2194 |
| 487 | Ga0439431_0002744 | 3300041997 | Bacteria | 3869 |
| 488 | Ga0439433_0003905 | 3300041999 | Bacteria | 3207 |
| 489 | Ga0439433_0005989 | 3300041999 | Bacteria | 2614 |
| 490 | Ga0439442_002538 | 3300042002 | Bacteria | 3584 |
| 491 | Ga0439442_002770 | 3300042002 | Bacteria | 3442 |
| 492 | Ga0439445_0000223 | 3300042004 | Bacteria | 10550 |
| 493 | Ga0439445_0011709 | 3300042004 | Bacteria | 2096 |
| 494 | Ga0439445_0177880 | 3300042004 | Bacteria | 624 |
| 495 | Ga0439432_001997 | 3300042006 | Bacteria | 7723 |
| 496 | Ga0439432_002220 | 3300042006 | Bacteria | 7326 |
| 497 | Ga0439432_014455 | 3300042006 | Bacteria | 2672 |
| 498 | Ga0439432_082056 | 3300042006 | Bacteria | 976 |
| 499 | Ga0439449_0000209 | 3300042007 | Bacteria | 20674 |
| 500 | Ga0439449_0000215 | 3300042007 | Bacteria | 20490 |
| 501 | Ga0439449_0002802 | 3300042007 | Bacteria | 6773 |
| 502 | Ga0439449_0004098 | 3300042007 | Bacteria | 5642 |
| 503 | Ga0439449_0021863 | 3300042007 | Bacteria | 2394 |
| 504 | Ga0439452_003966 | 3300042010 | Bacteria | 5062 |
| 505 | Ga0439452_063493 | 3300042010 | Bacteria | 823 |
| 506 | Ga0439457_003046 | 3300042014 | Bacteria | 4641 |
| 507 | Ga0439457_056564 | 3300042014 | Bacteria | 885 |
| 508 | Ga0439462_0009717 | 3300042015 | Bacteria | 2432 |
| 509 | Ga0439462_0117488 | 3300042015 | Bacteria | 738 |
| 510 | Ga0450911_000823 | 3300042115 | Bacteria | 8515 |
| 511 | Ga0450912_001174 | 3300042116 | Bacteria | 1535 |
| 512 | Ga0450923_005020 | 3300042125 | Bacteria | 2114 |
| 513 | Ga0450907_005113 | 3300042146 | Bacteria | 2224 |
| 514 | Ga0450908_000697 | 3300042184 | Bacteria | 6439 |
| 515 | Ga0450908_027597 | 3300042184 | Bacteria | 989 |
| 516 | Ga0450909_029739 | 3300042185 | Bacteria | 827 |
| 517 | Ga0439434_0001906 | 3300042435 | Bacteria | 6054 |
| 518 | Ga0450893_0003142 | 3300042532 | Bacteria | 2595 |
| 519 | Ga0453684_0206707 | 3300044712 | Bacteria | 2285 |
| 520 | Ga0466960_0101941 | 3300044901 | Bacteria | 1479 |
| 521 | Ga0466959_0000733 | 3300045049 | Bacteria | 19138 |
| 522 | Ga0451576_0335672 | 3300045051 | Bacteria | 1582 |
| 523 | Ga0451576_1263050 | 3300045051 | Bacteria | 770 |
| 524 | Ga0495627_019753 | 3300046453 | Bacteria | 2254 |
| 525 | Ga0495592_0012833 | 3300046454 | Bacteria | 6370 |
| 526 | Ga0495629_0676626 | 3300046459 | Bacteria | 686 |
| 527 | Ga0495651_0484538 | 3300046462 | Bacteria | 794 |
| 528 | Ga0495651_0493154 | 3300046462 | Bacteria | 785 |
| 529 | Ga0495639_0007320 | 3300046475 | Bacteria | 4736 |
| 530 | Ga0495610_0148848 | 3300046512 | Bacteria | 1001 |
| 531 | Ga0495610_0191142 | 3300046512 | Bacteria | 845 |
| 532 | Ga0495610_0212230 | 3300046512 | Bacteria | 786 |
| 533 | Ga0495616_0003860 | 3300046513 | Bacteria | 9551 |
| 534 | Ga0495620_0004751 | 3300046515 | Bacteria | 7640 |
| 535 | Ga0495620_0098102 | 3300046515 | Bacteria | 1170 |
| 536 | Ga0495628_0606781 | 3300046516 | Bacteria | 781 |
| 537 | Ga0495630_0144677 | 3300046517 | Bacteria | 1808 |
| 538 | Ga0495631_0011741 | 3300046518 | Bacteria | 4297 |
| 539 | Ga0495632_0221853 | 3300046519 | Bacteria | 855 |
| 540 | Ga0495637_0001872 | 3300046520 | Bacteria | 12011 |
| 541 | Ga0495637_0042227 | 3300046520 | Bacteria | 1952 |
| 542 | Ga0495648_0154014 | 3300046524 | Bacteria | 1196 |
| 543 | Ga0495648_0246754 | 3300046524 | Bacteria | 864 |
| 544 | Ga0495648_0304102 | 3300046524 | Bacteria | 746 |
| 545 | Ga0495642_0128795 | 3300046528 | Bacteria | 1089 |
| 546 | Ga0495642_0336927 | 3300046528 | Bacteria | 662 |
| 547 | Ga0495654_0127923 | 3300046530 | Bacteria | 1143 |
| 548 | Ga0495654_0146429 | 3300046530 | Bacteria | 1048 |
| 549 | Ga0495586_0198927 | 3300046535 | Bacteria | 1136 |
| 550 | Ga0495587_0636758 | 3300046536 | Bacteria | 586 |
| 551 | Ga0495598_0163049 | 3300046537 | Bacteria | 786 |
| 552 | Ga0495621_0003571 | 3300046539 | Bacteria | 4293 |
| 553 | Ga0495633_0161198 | 3300046558 | Bacteria | 1035 |
| 554 | Ga0495667_0465036 | 3300046559 | Bacteria | 794 |
| 555 | Ga0495656_0000087 | 3300046615 | Bacteria | 40520 |
| 556 | Ga0495625_0000245 | 3300046660 | Bacteria | 85443 |
| 557 | Ga0495625_0079548 | 3300046660 | Bacteria | 2285 |
| 558 | Ga0495625_0202528 | 3300046660 | Bacteria | 1309 |
| 559 | Ga0495625_0226225 | 3300046660 | Bacteria | 1223 |
| 560 | Ga0495625_0450337 | 3300046660 | Bacteria | 795 |
| 561 | Ga0495635_0251013 | 3300046663 | Bacteria | 1193 |
| 562 | Ga0495588_0007799 | 3300046674 | Bacteria | 4888 |
| 563 | Ga0495588_0083355 | 3300046674 | Bacteria | 1670 |
| 564 | Ga0495588_0162325 | 3300046674 | Bacteria | 1181 |
| 565 | Ga0495599_0123305 | 3300046678 | Bacteria | 1611 |
| 566 | Ga0495613_0202211 | 3300046689 | Bacteria | 1400 |
| 567 | Ga0495613_0292588 | 3300046689 | Bacteria | 1129 |
| 568 | Ga0495624_0425370 | 3300046690 | Bacteria | 796 |
| 569 | Ga0495600_0349808 | 3300046809 | Bacteria | 926 |
| 570 | Ga0495660_0137417 | 3300046810 | Bacteria | 1220 |
| 571 | Ga0495604_0254205 | 3300047317 | Bacteria | 1197 |
| 572 | Ga0495676_0035774 | 3300047321 | Bacteria | 4151 |
| 573 | Ga0495676_0054670 | 3300047321 | Bacteria | 3172 |
| 574 | Ga0495593_0033452 | 3300047673 | Bacteria | 2799 |
| 575 | Ga0495602_0835497 | 3300048088 | Bacteria | 616 |
| 576 | Ga0495614_0040393 | 3300048089 | Bacteria | 2002 |
| 577 | Ga0495614_0155981 | 3300048089 | Bacteria | 1020 |
| 578 | Ga0495614_0361493 | 3300048089 | Bacteria | 678 |
| 579 | Ga0495615_0067105 | 3300048090 | Bacteria | 959 |
| 580 | Ga0495615_0075561 | 3300048090 | Bacteria | 916 |
| 581 | Ga0496101_0006112 | 3300048904 | Bacteria | 7732 |
| 582 | Ga0496101_0034301 | 3300048904 | Bacteria | 3583 |
| 583 | Ga0496102_0024751 | 3300048905 | Bacteria | 5339 |
| 584 | Ga0496102_0557464 | 3300048905 | Bacteria | 1069 |
| 585 | Ga0496102_1080396 | 3300048905 | Bacteria | 722 |
| 586 | Ga0496103_0014373 | 3300048906 | Bacteria | 4702 |
| 587 | Ga0496104_0005753 | 3300048907 | Bacteria | 10852 |
| 588 | Ga0496104_0023014 | 3300048907 | Bacteria | 5726 |
| 589 | Ga0496104_0338251 | 3300048907 | Bacteria | 1418 |
| 590 | Ga0496105_0166483 | 3300048908 | Bacteria | 1808 |
| 591 | Ga0496105_0217888 | 3300048908 | Bacteria | 1554 |
| 592 | Ga0496107_0129413 | 3300048910 | Bacteria | 1863 |
| 593 | Ga0496108_0304054 | 3300048911 | Bacteria | 1389 |
| 594 | Ga0496109_0429837 | 3300048912 | Bacteria | 1247 |
| 595 | Ga0496109_0945999 | 3300048912 | Bacteria | 799 |
| 596 | Ga0496110_0101414 | 3300048913 | Bacteria | 2580 |
| 597 | Ga0496110_0186143 | 3300048913 | Bacteria | 1885 |
| 598 | Ga0496111_0163859 | 3300048914 | Bacteria | 1651 |
| 599 | Ga0496112_0376609 | 3300048915 | Bacteria | 1361 |
| 600 | Ga0496114_0119099 | 3300048917 | Bacteria | 2269 |
| 601 | Ga0496114_0782441 | 3300048917 | Bacteria | 832 |
| 602 | Ga0496116_0031289 | 3300048919 | Bacteria | 3813 |
| 603 | Ga0496117_0091489 | 3300048920 | Bacteria | 1956 |
| 604 | Ga0496117_0104753 | 3300048920 | Bacteria | 1779 |
| 605 | Ga0496117_0323975 | 3300048920 | Bacteria | 806 |
| 606 | Ga0496118_0009792 | 3300048921 | Bacteria | 9607 |
| 607 | Ga0496118_0057847 | 3300048921 | Bacteria | 2902 |
| 608 | Ga0496119_0050596 | 3300048922 | Bacteria | 2560 |
| 609 | Ga0496121_0026608 | 3300048924 | Bacteria | 5442 |
| 610 | Ga0496121_0075961 | 3300048924 | Bacteria | 2681 |
| 611 | Ga0496121_0095100 | 3300048924 | Bacteria | 2316 |
| 612 | Ga0496121_0278411 | 3300048924 | Bacteria | 1146 |
| 613 | Ga0496122_0000063 | 3300048925 | Bacteria | 241378 |
| 614 | Ga0496122_0036508 | 3300048925 | Bacteria | 3972 |
| 615 | Ga0496122_0271500 | 3300048925 | Bacteria | 934 |
| 616 | Ga0496123_0000045 | 3300048926 | Bacteria | 249294 |
| 617 | Ga0496123_0066793 | 3300048926 | Bacteria | 2276 |
| 618 | Ga0496123_0274693 | 3300048926 | Bacteria | 818 |
| 619 | Ga0496124_0025846 | 3300048927 | Bacteria | 5307 |
| 620 | Ga0496124_0027532 | 3300048927 | Bacteria | 5101 |
| 621 | Ga0496124_0052717 | 3300048927 | Bacteria | 3454 |
| 622 | Ga0496125_0015804 | 3300048928 | Bacteria | 7274 |
| 623 | Ga0496125_0018589 | 3300048928 | Bacteria | 6597 |
| 624 | Ga0496125_0026445 | 3300048928 | Bacteria | 5288 |
| 625 | Ga0496125_0034979 | 3300048928 | Bacteria | 4418 |
| 626 | Ga0496125_0045967 | 3300048928 | Bacteria | 3668 |
| 627 | Ga0496126_0086721 | 3300048929 | Bacteria | 2759 |
| 628 | Ga0501034_0513293 | 3300049571 | Bacteria | 1111 |
| 629 | Ga0501034_0580692 | 3300049571 | Bacteria | 1028 |
| 630 | Ga0501249_031273 | 3300049679 | Bacteria | 1187 |
| 631 | Ga0501262_000532 | 3300049759 | Bacteria | 4534 |
| 632 | Ga0501266_000189 | 3300049763 | Bacteria | 7863 |
| 633 | Ga0501268_016851 | 3300049765 | Bacteria | 1214 |
| 634 | Ga0501226_012713 | 3300049853 | Bacteria | 932 |
| 635 | nmdc:mga03683_114549_c1 | 3300050489 | Bacteria | 1195 |
| 636 | nmdc:mga03683_147316_c1 | 3300050489 | Bacteria | 1061 |
| 637 | nmdc:mga03683_47967_c1 | 3300050489 | Bacteria | 1774 |
| 638 | nmdc:mga03683_68271_c1 | 3300050489 | Bacteria | 1515 |
| 639 | nmdc:mga03n38_411859_c1 | 3300050490 | Bacteria | 746 |
| 640 | nmdc:mga03n38_462996_c1 | 3300050490 | Bacteria | 707 |
| 641 | nmdc:mga03n38_75513_c1 | 3300050490 | Bacteria | 1570 |
| 642 | nmdc:mga0yw44_150201_c1 | 3300050492 | Bacteria | 1519 |
| 643 | nmdc:mga0yw44_39841_c1 | 3300050492 | Bacteria | 2788 |
| 644 | nmdc:mga0yw44_755255_c1 | 3300050492 | Bacteria | 661 |
| 645 | nmdc:mga0k408_11179_c1 | 3300050493 | Bacteria | 4880 |
| 646 | nmdc:mga0k408_14507_c1 | 3300050493 | Bacteria | 4344 |
| 647 | nmdc:mga0k408_19690_c1 | 3300050493 | Bacteria | 3774 |
| 648 | nmdc:mga0k408_250955_c1 | 3300050493 | Bacteria | 1056 |
| 649 | nmdc:mga0k408_275230_c1 | 3300050493 | Bacteria | 1005 |
| 650 | nmdc:mga0k408_299329_c1 | 3300050493 | Bacteria | 960 |
| 651 | nmdc:mga06z11_254454_c1 | 3300050494 | Bacteria | 1035 |
| 652 | nmdc:mga06z11_395256_c1 | 3300050494 | Bacteria | 832 |
| 653 | nmdc:mga04h51_137435_c1 | 3300050495 | Bacteria | 924 |
| 654 | nmdc:mga07m45_207634_c1 | 3300050496 | Bacteria | 1139 |
| 655 | nmdc:mga07m45_2078_c1 | 3300050496 | Bacteria | 9300 |
| 656 | nmdc:mga07m45_23737_c1 | 3300050496 | Bacteria | 3355 |
| 657 | nmdc:mga07m45_246781_c1 | 3300050496 | Bacteria | 1039 |
| 658 | nmdc:mga07m45_4305_c1 | 3300050496 | Bacteria | 6966 |
| 659 | nmdc:mga07m45_82066_c1 | 3300050496 | Bacteria | 1841 |
| 660 | nmdc:mga07m45_9105_c1 | 3300050496 | Bacteria | 5129 |
| 661 | nmdc:mga0sz30_141582_c1 | 3300050516 | Bacteria | 1062 |
| 662 | Ga0500610_0003003 | 3300053079 | Bacteria | 6366 |
| 663 | Ga0500610_0004823 | 3300053079 | Bacteria | 5429 |
| 664 | Ga0500643_011596 | 3300053087 | Bacteria | 3204 |
| 665 | Ga0500644_0036663 | 3300053088 | Bacteria | 1597 |
| 666 | Ga0500644_0095159 | 3300053088 | Bacteria | 1122 |
| 667 | Ga0500583_0043952 | 3300053092 | Bacteria | 2043 |
| 668 | Ga0500651_0000125 | 3300053093 | Bacteria | 47146 |
| 669 | Ga0500651_0019235 | 3300053093 | Bacteria | 4240 |
| 670 | Ga0500566_0168782 | 3300053094 | Bacteria | 1133 |
| 671 | Ga0500560_123386 | 3300053107 | Bacteria | 869 |
| 672 | Ga0500569_104439 | 3300053109 | Bacteria | 931 |
| 673 | Ga0500571_000811 | 3300053110 | Bacteria | 13403 |
| 674 | Ga0500593_003399 | 3300053117 | Bacteria | 6008 |
| 675 | Ga0500593_004926 | 3300053117 | Bacteria | 5214 |
| 676 | Ga0500594_0013942 | 3300053118 | Bacteria | 1918 |
| 677 | Ga0500595_105110 | 3300053119 | Bacteria | 806 |
| 678 | Ga0500597_118750 | 3300053120 | Bacteria | 1146 |
| 679 | Ga0500607_004599 | 3300053121 | Bacteria | 9423 |
| 680 | Ga0500607_007247 | 3300053121 | Bacteria | 6879 |
| 681 | Ga0500608_010325 | 3300053122 | Bacteria | 4004 |
| 682 | Ga0500608_089376 | 3300053122 | Bacteria | 1442 |
| 683 | Ga0500608_114052 | 3300053122 | Bacteria | 1235 |
| 684 | Ga0500614_089979 | 3300053123 | Bacteria | 871 |
| 685 | Ga0500618_018192 | 3300053125 | Bacteria | 1740 |
| 686 | Ga0500621_043200 | 3300053126 | Bacteria | 1821 |
| 687 | Ga0500626_015711 | 3300053128 | Bacteria | 3303 |
| 688 | Ga0500628_018756 | 3300053129 | Bacteria | 1368 |
| 689 | Ga0500655_002019 | 3300053133 | Bacteria | 3775 |
| 690 | Ga0500658_0001125 | 3300053134 | Bacteria | 10937 |
| 691 | Ga0500658_0002341 | 3300053134 | Bacteria | 7344 |
| 692 | Ga0500559_0000119 | 3300053136 | Bacteria | 62358 |
| 693 | Ga0500559_0012473 | 3300053136 | Bacteria | 3611 |
| 694 | Ga0500559_0261687 | 3300053136 | Bacteria | 814 |
| 695 | Ga0500561_0080760 | 3300053137 | Bacteria | 947 |
| 696 | Ga0500564_220229 | 3300053138 | Bacteria | 768 |
| 697 | Ga0500568_0002512 | 3300053139 | Bacteria | 10731 |
| 698 | Ga0500573_0190617 | 3300053140 | Bacteria | 1095 |
| 699 | Ga0500574_056806 | 3300053141 | Bacteria | 1129 |
| 700 | Ga0500616_0124057 | 3300053153 | Bacteria | 1229 |
| 701 | Ga0500622_0004359 | 3300053156 | Bacteria | 8936 |
| 702 | Ga0500627_0001087 | 3300053158 | Bacteria | 7417 |
| 703 | Ga0500634_0015330 | 3300053161 | Bacteria | 4068 |
| 704 | Ga0500636_0253279 | 3300053177 | Bacteria | 896 |
| 705 | Ga0500625_058487 | 3300053729 | Bacteria | 1758 |
| 706 | Ga0500645_000687 | 3300053730 | Bacteria | 21134 |
| 707 | Ga0500645_003664 | 3300053730 | Bacteria | 6139 |
| 708 | Ga0500587_016786 | 3300053739 | Bacteria | 936 |
| 709 | Ga0500661_000976 | 3300055283 | Bacteria | 5359 |
| 710 | 2511244359 | 2511231002 | Bacteria | 5042903 |
| 711 | 2513227686 | 2513020051 | Bacteria | 6053213 |
| 712 | 2548497953 | 2547132374 | Bacteria | 5530232 |
| 713 | 2599625617 | 2599185214 | Bacteria | 8209958 |
| 714 | 2599673630 | 2599185226 | Bacteria | 8233575 |
| 715 | 2599683300 | 2599185227 | Bacteria | 8246414 |
| 716 | 2599695212 | 2599185229 | Bacteria | 8216126 |
| 717 | 2643868649 | 2643221570 | Bacteria | 5103772 |
| 718 | 2643991023 | 2643221596 | Bacteria | 5006805 |
| 719 | 2644058816 | 2643221609 | Bacteria | 6756331 |
| 720 | 2644071059 | 2643221611 | Bacteria | 6820941 |
| 721 | 2644162294 | 2643221628 | Bacteria | 5745828 |
| 722 | 2644295838 | 2643221652 | Bacteria | 5140275 |
| 723 | 2644324455 | 2643221658 | Bacteria | 6064537 |
| 724 | 2644396296 | 2643221672 | Bacteria | 6322190 |
| 725 | 2644464662 | 2643221683 | Bacteria | 5749203 |
| 726 | 2644649579 | 2643221717 | Bacteria | 5676132 |
| 727 | 2738719203 | 2738541277 | Bacteria | 7458140 |
| 728 | 2738880224 | 2738541307 | Bacteria | 8606193 |
| 729 | 2739245174 | 2738543012 | Bacteria | 7115078 |
| 730 | 2739248077 | 2738543013 | Bacteria | 5618633 |
| 731 | 2739281965 | 2738543019 | Bacteria | 7459457 |
| 732 | 2816471524 | 2816332133 | Bacteria | 7249298 |
| 733 | 2819599704 | 2818991446 | Bacteria | 7757362 |
| 734 | 2831271763 | 2831265667 | Bacteria | 7184833 |
| 735 | 2838055612 | 2838054893 | Bacteria | 7451788 |
| 736 | 2842682661 | 2842677519 | Bacteria | 5615038 |
| 737 | 2842734236 | 2842733646 | Bacteria | 5716726 |
| 738 | 2842749507 | 2842747753 | Bacteria | 5578255 |
| 739 | 2881102976 | 2881101125 | Bacteria | 4590519 |
| 740 | 2885194775 | 2885192300 | Bacteria | 5882526 |
| 741 | 2885200854 | 2885198086 | Bacteria | 7212419 |
| 742 | 2885214363 | 2885211737 | Bacteria | 7212420 |
| 743 | 2894024665 | 2894023352 | Bacteria | 5167372 |
| 744 | 2899927663 | 2899924645 | Bacteria | 7487985 |
| 745 | 2904450635 | 2904449895 | Bacteria | 6927402 |
| 746 | 2904459865 | 2904456579 | Bacteria | 6819253 |
| 747 | 2904479593 | 2904479285 | Bacteria | 5073931 |
| 748 | 2904549832 | 2904541872 | Bacteria | 8915136 |
| 749 | 2919462836 | 2919462493 | Bacteria | 5817112 |
| 750 | 2928042060 | 2928037797 | Bacteria | 7273642 |
| 751 | 2928049624 | 2928044640 | Bacteria | 7271509 |
| 752 | 2928051702 | 2928051484 | Bacteria | 7773759 |
| 753 | 2928065607 | 2928064002 | Bacteria | 7419480 |
| 754 | 2928073074 | 2928070936 | Bacteria | 8062541 |
| 755 | 2928086861 | 2928084124 | Bacteria | 7159212 |
| 756 | 2928117604 | 2928115317 | Bacteria | 6477646 |
| 757 | 2929161802 | 2929160207 | Bacteria | 9075316 |
| 758 | 2929521352 | 2929520902 | Bacteria | 6765052 |
| 759 | 2939635380 | 2939631187 | Bacteria | 6118131 |
| 760 | 2945913802 | 2945909444 | Bacteria | 7065066 |
| 761 | 2945949365 | 2945945610 | Bacteria | 5951079 |
| 762 | 2945973410 | 2945972063 | Bacteria | 6086495 |
| 763 | 2945990799 | 2945984333 | Bacteria | 7358892 |
| 764 | 2954770988 | 2954767861 | Bacteria | 5535784 |
| 765 | 2990711452 | 2990710928 | Bacteria | 5002431 |
| 766 | nmdc:mga0sz30_319121_c1 | |||
| 767 | JGI24740J21852_10030281 | |||
| 768 | JGI24740J21852_10070441 | |||
| 769 | JGI25155J39150_1000223 | |||
| 770 | JGI25156J39149_1000045 | |||
| 771 | JGI25156J39149_1010399 | |||
| 772 | JGI25154J39366_1000064 | |||
| 773 | JGI25158J39367_1008558 | |||
| 774 | JGI25157J39369_1000063 | |||
| 775 | JGI25152J39213_1009477 | |||
| 776 | JGI25152J39213_1009835 | |||
| 777 | JGI25152J39213_1015472 | |||
| 778 | JGI25150J39212_1002850 | |||
| 779 | JGI25150J39212_1003825 | |||
| 780 | JGI25150J39212_1003925 | |||
| 781 | JGI25150J39212_1014919 | |||
| 782 | JGI25159J45721_1000798 | |||
| 783 | JGI25159J45721_1010548 | |||
| 784 | JGI25159J45721_1013766 | |||
| 785 | JGI25159J45721_1023019 | |||
| 786 | JGI25151J46595_10003268 | |||
| 787 | JGI25151J46595_10005204 | |||
| 788 | JGI25151J46595_10005490 | |||
| 789 | JGI25151J46595_10008408 | |||
| 790 | JGI25151J46595_10024951 | |||
| 791 | JGI25151J46595_10026989 | |||
| 792 | JGI25151J46595_10090142 | |||
| 793 | JGI25151J46595_10090161 | |||
| 794 | JGI25153J46596_10022631 | |||
| 795 | JGI25153J46596_10028099 | |||
| 796 | rootH1_10036541 | |||
| 797 | JGI25160J50197_1000316 | |||
| 798 | JGI25160J50197_1016807 | |||
| 799 | JGI25160J50197_1022936 | |||
| 800 | JGI25161J50226_1000236 | |||
| 801 | JGI25161J50226_1005307 | |||
| 802 | JGI25161J50226_1009924 | |||
| 803 | Ga0006562J51391_1018602 | |||
| 804 | Ga0006562J51391_1018603 | |||
| 805 | Ga0006562J51391_1039299 | |||
| 806 | Ga0055535_1000142 | |||
| 807 | Ga0055542_1000022 | |||
| 808 | Ga0055526_1001281 | |||
| 809 | Ga0055526_1002710 | |||
| 810 | Ga0055526_1020540 | |||
| 811 | Ga0055526_1021182 | |||
| 812 | Ga0055537_1000134 | |||
| 813 | Ga0055537_1000634 | |||
| 814 | Ga0055537_1008722 | |||
| 815 | Ga0055524_1000114 | |||
| 816 | Ga0055524_1019201 | |||
| 817 | Ga0055524_1019969 | |||
| 818 | Ga0055536_1000705 | |||
| 819 | Ga0055536_1004046 | |||
| 820 | Ga0055536_1008356 | |||
| 821 | Ga0055536_1019549 | |||
| 822 | Ga0055536_1041306 | |||
| 823 | Ga0055534_1000088 | |||
| 824 | Ga0055534_1002639 | |||
| 825 | Ga0055534_1003059 | |||
| 826 | Ga0055534_1008700 | |||
| 827 | Ga0055528_1000135 | |||
| 828 | Ga0055528_1000630 | |||
| 829 | Ga0055528_1011813 | |||
| 830 | Ga0055528_1018929 | |||
| 831 | Ga0055530_10000473 | |||
| 832 | Ga0055530_10000962 | |||
| 833 | Ga0055530_10043050 | |||
| 834 | Ga0055530_10044570 | |||
| 835 | Ga0055540_1000153 | |||
| 836 | Ga0055540_1000730 | |||
| 837 | Ga0055540_1003446 | |||
| 838 | Ga0055540_1008455 | |||
| 839 | Ga0055540_1023232 | |||
| 840 | Ga0055531_10002924 | |||
| 841 | Ga0055531_10007733 | |||
| 842 | Ga0055531_10023771 | |||
| 843 | Ga0055531_10029872 | |||
| 844 | Ga0055531_10048699 | |||
| 845 | Ga0055543_1000605 | |||
| 846 | Ga0055543_1007952 | |||
| 847 | Ga0065165_1020642 | |||
| 848 | Ga0065165_1025030 | |||
| 849 | Ga0065165_1025184 | |||
| 850 | Ga0065165_1029492 | |||
| 851 | Ga0065165_1031225 | |||
| 852 | Ga0065165_1050881 | |||
| 853 | Ga0065165_1084473 | |||
| 854 | Ga0065714_10004149 | |||
| 855 | Ga0065714_10143273 | |||
| 856 | Ga0065704_10113056 | |||
| 857 | Ga0070658_10397971 | |||
| 858 | Ga0070658_10726101 | |||
| 859 | Ga0068869_100223657 | |||
| 860 | Ga0070666_10212173 | |||
| 861 | Ga0068868_100097533 | |||
| 862 | Ga0070661_100001209 | |||
| 863 | Ga0070669_100532246 | |||
| 864 | Ga0070669_100823185 | |||
| 865 | Ga0070674_100032006 | |||
| 866 | Ga0070673_100222023 | |||
| 867 | Ga0070688_100213909 | |||
| 868 | Ga0070659_100005054 | |||
| 869 | Ga0070667_100028787 | |||
| 870 | Ga0070667_100052972 | |||
| 871 | Ga0070678_100027689 | |||
| 872 | Ga0070678_100038770 | |||
| 873 | Ga0070678_100217469 | |||
| 874 | Ga0070678_100226206 | |||
| 875 | Ga0070678_100889913 | |||
| 876 | Ga0070662_100028288 | |||
| 877 | Ga0070662_100484005 | |||
| 878 | Ga0070706_100324736 | |||
| 879 | Ga0070707_100136640 | |||
| 880 | Ga0070679_100102866 | |||
| 881 | Ga0068853_100011565 | |||
| 882 | Ga0070665_100024888 | |||
| 883 | Ga0070665_100068370 | |||
| 884 | Ga0070665_100266655 | |||
| 885 | Ga0068855_100144470 | |||
| 886 | Ga0070664_100018592 | |||
| 887 | Ga0070664_100112954 | |||
| 888 | Ga0068857_100042395 | |||
| 889 | Ga0068854_100127781 | |||
| 890 | Ga0068856_100939010 | |||
| 891 | Ga0070702_100780329 | |||
| 892 | Ga0068852_100224588 | |||
| 893 | Ga0068851_10033206 | |||
| 894 | Ga0068863_100279554 | |||
| 895 | Ga0075365_10158975 | |||
| 896 | Ga0075363_100024393 | |||
| 897 | Ga0075363_100247420 | |||
| 898 | Ga0075364_10272887 | |||
| 899 | Ga0075432_10017603 | |||
| 900 | Ga0075362_10013049 | |||
| 901 | Ga0075362_10026340 | |||
| 902 | Ga0075362_10034297 | |||
| 903 | Ga0075362_10067001 | |||
| 904 | Ga0075362_10071724 | |||
| 905 | Ga0075362_10153702 | |||
| 906 | Ga0075367_10242048 | |||
| 907 | Ga0075367_10642940 | |||
| 908 | Ga0075369_10126380 | |||
| 909 | Ga0075369_10150909 | |||
| 910 | Ga0075366_10005247 | |||
| 911 | Ga0075366_10026719 | |||
| 912 | Ga0075366_10136314 | |||
| 913 | Ga0075366_10163703 | |||
| 914 | Ga0075366_10262860 | |||
| 915 | Ga0075366_10272578 | |||
| 916 | Ga0097621_100065798 | |||
| 917 | Ga0097621_100387128 | |||
| 918 | Ga0097621_100671876 | |||
| 919 | Ga0075370_10002395 | |||
| 920 | Ga0075370_10004349 | |||
| 921 | Ga0075370_10026838 | |||
| 922 | Ga0075370_10058172 | |||
| 923 | Ga0075370_10117798 | |||
| 924 | Ga0075370_10168276 | |||
| 925 | Ga0075370_10428739 | |||
| 926 | Ga0075370_10565707 | |||
| 927 | Ga0075370_10642398 | |||
| 928 | Ga0068871_100083605 | |||
| 929 | Ga0068865_100100582 | |||
| 930 | Ga0075436_100210527 | |||
| 931 | Ga0099826_10001370 | |||
| 932 | Ga0105244_10012570 | |||
| 933 | Ga0105244_10108715 | |||
| 934 | Ga0105240_10126866 | |||
| 935 | Ga0105245_10441714 | |||
| 936 | Ga0105245_10702953 | |||
| 937 | Ga0105245_11475186 | |||
| 938 | Ga0105243_10006758 | |||
| 939 | Ga0105243_10009873 | |||
| 940 | Ga0105243_10303192 | |||
| 941 | Ga0105241_10243307 | |||
| 942 | Ga0105242_11114671 | |||
| 943 | Ga0105237_10029245 | |||
| 944 | Ga0105238_10064300 | |||
| 945 | Ga0105238_10261834 | |||
| 946 | Ga0105249_11723208 | |||
| 947 | Ga0105239_10349276 | |||
| 948 | Ga0105246_10053898 | |||
| 949 | Ga0157320_1017629 | |||
| 950 | Ga0157347_1013284 | |||
| 951 | Ga0157326_1000472 | |||
| 952 | Ga0157373_10016632 | |||
| 953 | Ga0157373_10092360 | |||
| 954 | Ga0157373_10110847 | |||
| 955 | Ga0157370_10039005 | |||
| 956 | Ga0157370_10172185 | |||
| 957 | Ga0157374_11960993 | |||
| 958 | Ga0157378_10024673 | |||
| 959 | Ga0163162_10027211 | |||
| 960 | Ga0163162_10238220 | |||
| 961 | Ga0157375_10066886 | |||
| 962 | Ga0157375_11443627 | |||
| 963 | Ga0182008_10000215 | |||
| 964 | Ga0182008_10002427 | |||
| 965 | Ga0182008_10006865 | |||
| 966 | Ga0182008_10011104 | |||
| 967 | Ga0182008_10016496 | |||
| 968 | Ga0182008_10063964 | |||
| 969 | Ga0157376_10218149 | |||
| 970 | Ga0182006_1001570 | |||
| 971 | Ga0182006_1226165 | |||
| 972 | Ga0182007_10001908 | |||
| 973 | Ga0182007_10003300 | |||
| 974 | Ga0182007_10092164 | |||
| 975 | Ga0183362_10005 | |||
| 976 | Ga0163161_10004047 | |||
| 977 | Ga0163161_10020171 | |||
| 978 | Ga0163161_10044139 | |||
| 979 | Ga0163161_10117515 | |||
| 980 | Ga0213872_10011488 | |||
| 981 | Ga0209435_100003 | |||
| 982 | Ga0209436_103153 | |||
| 983 | Ga0209436_105965 | |||
| 984 | Ga0209436_111580 | |||
| 985 | Ga0209672_101007 | |||
| 986 | Ga0209147_103626 | |||
| 987 | Ga0209258_100009 | |||
| 988 | Ga0207425_1001790 | |||
| 989 | Ga0207425_1003665 | |||
| 990 | Ga0207425_1010227 | |||
| 991 | Ga0207425_1018704 | |||
| 992 | Ga0209646_1000008 | |||
| 993 | Ga0209026_1000007 | |||
| 994 | Ga0209148_1000007 | |||
| 995 | Ga0209759_1000019 | |||
| 996 | Ga0209129_1000024 | |||
| 997 | Ga0209129_1000085 | |||
| 998 | Ga0209129_1003741 | |||
| 999 | Ga0209129_1005702 | |||
| 1000 | Ga0209129_1020873 | |||
| 1001 | Ga0209129_1034832 | |||
| 1002 | Ga0209565_1000043 | |||
| 1003 | Ga0209565_1000046 | |||
| 1004 | Ga0209565_1001626 | |||
| 1005 | Ga0209565_1005766 | |||
| 1006 | Ga0209565_1010497 | |||
| 1007 | Ga0209673_1000008 | |||
| 1008 | Ga0209673_1000058 | |||
| 1009 | Ga0209673_1010330 | |||
| 1010 | Ga0209673_1010835 | |||
| 1011 | Ga0209673_1032272 | |||
| 1012 | Ga0209673_1032359 | |||
| 1013 | Ga0209130_1000181 | |||
| 1014 | Ga0209130_1000481 | |||
| 1015 | Ga0209130_1002262 | |||
| 1016 | Ga0209130_1003501 | |||
| 1017 | Ga0209130_1027946 | |||
| 1018 | Ga0209130_1039276 | |||
| 1019 | Ga0209675_1000010 | |||
| 1020 | Ga0209675_1000136 | |||
| 1021 | Ga0209675_1003141 | |||
| 1022 | Ga0209675_1005746 | |||
| 1023 | Ga0209675_1005766 | |||
| 1024 | Ga0209675_1014407 | |||
| 1025 | Ga0209675_1015001 | |||
| 1026 | Ga0209676_1000023 | |||
| 1027 | Ga0209676_1000028 | |||
| 1028 | Ga0209676_1000098 | |||
| 1029 | Ga0209676_1000173 | |||
| 1030 | Ga0209676_1000194 | |||
| 1031 | Ga0209676_1006015 | |||
| 1032 | Ga0209676_1006331 | |||
| 1033 | Ga0209676_1015360 | |||
| 1034 | Ga0209676_1077698 | |||
| 1035 | Ga0209025_1000122 | |||
| 1036 | Ga0209025_1000404 | |||
| 1037 | Ga0209025_1002394 | |||
| 1038 | Ga0209025_1009104 | |||
| 1039 | Ga0209025_1016764 | |||
| 1040 | Ga0209025_1019136 | |||
| 1041 | Ga0209025_1020502 | |||
| 1042 | Ga0209025_1041131 | |||
| 1043 | Ga0209025_1047888 | |||
| 1044 | Ga0209025_1067826 | |||
| 1045 | Ga0209025_1068034 | |||
| 1046 | Ga0209025_1070815 | |||
| 1047 | Ga0209564_1000183 | |||
| 1048 | Ga0209564_1000198 | |||
| 1049 | Ga0209564_1000279 | |||
| 1050 | Ga0209564_1000478 | |||
| 1051 | Ga0209564_1008404 | |||
| 1052 | Ga0209758_1000049 | |||
| 1053 | Ga0209758_1022895 | |||
| 1054 | Ga0209758_1058085 | |||
| 1055 | Ga0209758_1062437 | |||
| 1056 | Ga0209050_1000002 | |||
| 1057 | Ga0209050_1000022 | |||
| 1058 | Ga0209050_1000122 | |||
| 1059 | Ga0209050_1000554 | |||
| 1060 | Ga0209050_1005757 | |||
| 1061 | Ga0209050_1007635 | |||
| 1062 | Ga0209050_1015969 | |||
| 1063 | Ga0209050_1040978 | |||
| 1064 | Ga0209050_1059928 | |||
| 1065 | Ga0209256_1000001 | |||
| 1066 | Ga0209256_1000098 | |||
| 1067 | Ga0209256_1000140 | |||
| 1068 | Ga0207426_1000038 | |||
| 1069 | Ga0207426_1000053 | |||
| 1070 | Ga0207426_1000117 | |||
| 1071 | Ga0207426_1020862 | |||
| 1072 | Ga0207426_1104810 | |||
| 1073 | Ga0209051_1000013 | |||
| 1074 | Ga0209051_1000015 | |||
| 1075 | Ga0209051_1000159 | |||
| 1076 | Ga0209051_1000194 | |||
| 1077 | Ga0209051_1000282 | |||
| 1078 | Ga0209051_1000597 | |||
| 1079 | Ga0209051_1014777 | |||
| 1080 | Ga0209257_1000002 | |||
| 1081 | Ga0209257_1000042 | |||
| 1082 | Ga0209257_1004288 | |||
| 1083 | Ga0209257_1010273 | |||
| 1084 | Ga0209257_1020820 | |||
| 1085 | Ga0207697_10010983 | |||
| 1086 | Ga0207656_10010157 | |||
| 1087 | Ga0207655_1002288 | |||
| 1088 | Ga0207682_10002990 | |||
| 1089 | Ga0207642_10764117 | |||
| 1090 | Ga0207688_10042052 | |||
| 1091 | Ga0207688_10504478 | |||
| 1092 | Ga0207680_10124114 | |||
| 1093 | Ga0207643_10062819 | |||
| 1094 | Ga0207705_10324413 | |||
| 1095 | Ga0207654_10185859 | |||
| 1096 | Ga0207707_10308383 | |||
| 1097 | Ga0207671_10133849 | |||
| 1098 | Ga0207671_10295761 | |||
| 1099 | Ga0207671_10377306 | |||
| 1100 | Ga0207662_10228691 | |||
| 1101 | Ga0207657_10043944 | |||
| 1102 | Ga0207657_10180680 | |||
| 1103 | Ga0207657_10197245 | |||
| 1104 | Ga0207649_10001378 | |||
| 1105 | Ga0207652_10214327 | |||
| 1106 | Ga0207681_10063129 | |||
| 1107 | Ga0207681_10186908 | |||
| 1108 | Ga0207681_10425734 | |||
| 1109 | Ga0207650_10001149 | |||
| 1110 | Ga0207687_10376259 | |||
| 1111 | Ga0207687_10487568 | |||
| 1112 | Ga0207687_10837996 | |||
| 1113 | Ga0207644_10001362 | |||
| 1114 | Ga0207690_10159378 | |||
| 1115 | Ga0207690_10721768 | |||
| 1116 | Ga0207706_10025112 | |||
| 1117 | Ga0207706_10349535 | |||
| 1118 | Ga0207686_10795342 | |||
| 1119 | Ga0207709_10000285 | |||
| 1120 | Ga0207709_10004960 | |||
| 1121 | Ga0207669_10005292 | |||
| 1122 | Ga0207704_10072751 | |||
| 1123 | Ga0207689_10131776 | |||
| 1124 | Ga0207689_10382753 | |||
| 1125 | Ga0207679_10000249 | |||
| 1126 | Ga0207679_10093359 | |||
| 1127 | Ga0207667_10272100 | |||
| 1128 | Ga0207651_10001278 | |||
| 1129 | Ga0207640_10069120 | |||
| 1130 | Ga0207677_10003562 | |||
| 1131 | Ga0207677_10289493 | |||
| 1132 | Ga0207703_10197808 | |||
| 1133 | Ga0207639_10010174 | |||
| 1134 | Ga0207641_10094723 | |||
| 1135 | Ga0207641_10889218 | |||
| 1136 | Ga0207648_10048712 | |||
| 1137 | Ga0207676_10046020 | |||
| 1138 | Ga0207674_10059455 | |||
| 1139 | Ga0207674_10560732 | |||
| 1140 | Ga0207674_10579827 | |||
| 1141 | Ga0207674_10598378 | |||
| 1142 | Ga0207683_10040254 | |||
| 1143 | Ga0207683_10176551 | |||
| 1144 | Ga0207683_10187549 | |||
| 1145 | Ga0207683_10208821 | |||
| 1146 | Ga0207683_10838453 | |||
| 1147 | Ga0207698_10202836 | |||
| 1148 | Ga0209995_1015707 | |||
| 1149 | Ga0209282_1001079 | |||
| 1150 | Ga0209971_1004611 | |||
| 1151 | Ga0209974_10028969 | |||
| 1152 | Ga0207428_10590739 | |||
| 1153 | Ga0268266_10026117 | |||
| 1154 | Ga0268266_10238118 | |||
| 1155 | Ga0307517_10010725 | |||
| 1156 | Ga0307515_10012653 | |||
| 1157 | Ga0307515_10029938 | |||
| 1158 | Ga0307515_10184906 | |||
| 1159 | Ga0307515_10373200 | |||
| 1160 | Ga0307512_10058292 | |||
| 1161 | Ga0316177_1112288 | |||
| 1162 | Ga0316177_1125363 | |||
| 1163 | Ga0314311_1160343 | |||
| 1164 | Ga0316178_1142965 | |||
| 1165 | Ga0316183_1076813 | |||
| 1166 | Ga0316183_1082821 | |||
| 1167 | Ga0316181_1034408 | |||
| 1168 | Ga0316182_1014668 | |||
| 1169 | Ga0316182_1250129 | |||
| 1170 | Ga0265330_10000014 | |||
| 1171 | Ga0265332_10000011 | |||
| 1172 | Ga0265332_10000035 | |||
| 1173 | Ga0265325_10003832 | |||
| 1174 | Ga0265327_10005786 | |||
| 1175 | Ga0265327_10013542 | |||
| 1176 | Ga0307513_10000020 | |||
| 1177 | Ga0307513_10085785 | |||
| 1178 | Ga0307513_10257508 | |||
| 1179 | Ga0307509_10006670 | |||
| 1180 | Ga0307509_10027095 | |||
| 1181 | Ga0307509_10056928 | |||
| 1182 | Ga0307509_10141405 | |||
| 1183 | Ga0307408_100002073 | |||
| 1184 | Ga0307408_100005387 | |||
| 1185 | Ga0307408_100034033 | |||
| 1186 | Ga0307408_100147544 | |||
| 1187 | Ga0307408_100192946 | |||
| 1188 | Ga0307408_100333476 | |||
| 1189 | Ga0307408_100370267 | |||
| 1190 | Ga0307408_100429414 | |||
| 1191 | Ga0307408_100475960 | |||
| 1192 | Ga0307408_100642828 | |||
| 1193 | Ga0307508_10053638 | |||
| 1194 | Ga0307514_10072288 | |||
| 1195 | Ga0307514_10384060 | |||
| 1196 | Ga0265314_10000026 | |||
| 1197 | Ga0307516_10000311 | |||
| 1198 | Ga0307516_10217770 | |||
| 1199 | Ga0307405_10031768 | |||
| 1200 | Ga0307405_10056743 | |||
| 1201 | Ga0307405_10301009 | |||
| 1202 | Ga0307406_10001422 | |||
| 1203 | Ga0307406_10005238 | |||
| 1204 | Ga0307406_10028541 | |||
| 1205 | Ga0307406_10052872 | |||
| 1206 | Ga0307406_10752138 | |||
| 1207 | Ga0307412_10033751 | |||
| 1208 | Ga0307412_10075260 | |||
| 1209 | Ga0307412_10097644 | |||
| 1210 | Ga0307412_10107572 | |||
| 1211 | Ga0307412_10120119 | |||
| 1212 | Ga0307412_10338868 | |||
| 1213 | Ga0307412_10366791 | |||
| 1214 | Ga0307412_10544039 | |||
| 1215 | Ga0307412_10630421 | |||
| 1216 | Ga0307409_100007440 | |||
| 1217 | Ga0307416_100035298 | |||
| 1218 | Ga0307416_100175226 | |||
| 1219 | Ga0307416_100986728 | |||
| 1220 | Ga0307414_10062189 | |||
| 1221 | Ga0307414_10237145 | |||
| 1222 | Ga0307411_10237172 | |||
| 1223 | Ga0307411_10669359 | |||
| 1224 | Ga0307415_100071636 | |||
| 1225 | Ga0307415_101090819 | |||
| 1226 | Ga0307507_10213669 | |||
| 1227 | Ga0307507_10219951 | |||
| 1228 | Ga0307510_10003147 | |||
| 1229 | Ga0307510_10022531 | |||
| 1230 | Ga0307510_10060349 | |||
| 1231 | Ga0373932_0129161 | |||
| 1232 | Ga0373939_0244479 | |||
| 1233 | Ga0373962_0097594 | |||
| 1234 | Ga0373931_0030402 | |||
| 1235 | Ga0373925_0280968 | |||
| 1236 | Ga0436361_0327114 | |||
| 1237 | Ga0436361_0443915 | |||
| 1238 | Ga0439436_0000382 | |||
| 1239 | Ga0439436_0004185 | |||
| 1240 | Ga0439439_0028565 | |||
| 1241 | Ga0439447_026574 | |||
| 1242 | Ga0439461_0026457 | |||
| 1243 | Ga0439466_0001231 | |||
| 1244 | Ga0439466_0028602 | |||
| 1245 | Ga0439465_0001246 | |||
| 1246 | Ga0439465_0070058 | |||
| 1247 | Ga0439465_0278196 | |||
| 1248 | Ga0451791_1627931 | |||
| 1249 | Ga0451795_0255321 | |||
| 1250 | Ga0451798_0795614 | |||
| 1251 | Ga0451853_2985823 | |||
| 1252 | Ga0439431_0002744 | |||
| 1253 | Ga0439433_0003905 | |||
| 1254 | Ga0439433_0005989 | |||
| 1255 | Ga0439442_002538 | |||
| 1256 | Ga0439442_002770 | |||
| 1257 | Ga0439445_0000223 | |||
| 1258 | Ga0439445_0011709 | |||
| 1259 | Ga0439445_0177880 | |||
| 1260 | Ga0439432_001997 | |||
| 1261 | Ga0439432_002220 | |||
| 1262 | Ga0439432_014455 | |||
| 1263 | Ga0439432_082056 | |||
| 1264 | Ga0439449_0000209 | |||
| 1265 | Ga0439449_0000215 | |||
| 1266 | Ga0439449_0002802 | |||
| 1267 | Ga0439449_0004098 | |||
| 1268 | Ga0439449_0021863 | |||
| 1269 | Ga0439452_003966 | |||
| 1270 | Ga0439452_063493 | |||
| 1271 | Ga0439457_003046 | |||
| 1272 | Ga0439457_056564 | |||
| 1273 | Ga0439462_0009717 | |||
| 1274 | Ga0439462_0117488 | |||
| 1275 | Ga0450911_000823 | |||
| 1276 | Ga0450912_001174 | |||
| 1277 | Ga0450923_005020 | |||
| 1278 | Ga0450907_005113 | |||
| 1279 | Ga0450908_000697 | |||
| 1280 | Ga0450908_027597 | |||
| 1281 | Ga0450909_029739 | |||
| 1282 | Ga0439434_0001906 | |||
| 1283 | Ga0450893_0003142 | |||
| 1284 | Ga0453684_0206707 | |||
| 1285 | Ga0466960_0101941 | |||
| 1286 | Ga0466959_0000733 | |||
| 1287 | Ga0451576_0335672 | |||
| 1288 | Ga0451576_1263050 | |||
| 1289 | Ga0495627_019753 | |||
| 1290 | Ga0495592_0012833 | |||
| 1291 | Ga0495629_0676626 | |||
| 1292 | Ga0495651_0484538 | |||
| 1293 | Ga0495651_0493154 | |||
| 1294 | Ga0495639_0007320 | |||
| 1295 | Ga0495610_0148848 | |||
| 1296 | Ga0495610_0191142 | |||
| 1297 | Ga0495610_0212230 | |||
| 1298 | Ga0495616_0003860 | |||
| 1299 | Ga0495620_0004751 | |||
| 1300 | Ga0495620_0098102 | |||
| 1301 | Ga0495628_0606781 | |||
| 1302 | Ga0495630_0144677 | |||
| 1303 | Ga0495631_0011741 | |||
| 1304 | Ga0495632_0221853 | |||
| 1305 | Ga0495637_0001872 | |||
| 1306 | Ga0495637_0042227 | |||
| 1307 | Ga0495648_0154014 | |||
| 1308 | Ga0495648_0246754 | |||
| 1309 | Ga0495648_0304102 | |||
| 1310 | Ga0495642_0128795 | |||
| 1311 | Ga0495642_0336927 | |||
| 1312 | Ga0495654_0127923 | |||
| 1313 | Ga0495654_0146429 | |||
| 1314 | Ga0495586_0198927 | |||
| 1315 | Ga0495587_0636758 | |||
| 1316 | Ga0495598_0163049 | |||
| 1317 | Ga0495621_0003571 | |||
| 1318 | Ga0495633_0161198 | |||
| 1319 | Ga0495667_0465036 | |||
| 1320 | Ga0495656_0000087 | |||
| 1321 | Ga0495625_0000245 | |||
| 1322 | Ga0495625_0079548 | |||
| 1323 | Ga0495625_0202528 | |||
| 1324 | Ga0495625_0226225 | |||
| 1325 | Ga0495625_0450337 | |||
| 1326 | Ga0495635_0251013 | |||
| 1327 | Ga0495588_0007799 | |||
| 1328 | Ga0495588_0083355 | |||
| 1329 | Ga0495588_0162325 | |||
| 1330 | Ga0495599_0123305 | |||
| 1331 | Ga0495613_0202211 | |||
| 1332 | Ga0495613_0292588 | |||
| 1333 | Ga0495624_0425370 | |||
| 1334 | Ga0495600_0349808 | |||
| 1335 | Ga0495660_0137417 | |||
| 1336 | Ga0495604_0254205 | |||
| 1337 | Ga0495676_0035774 | |||
| 1338 | Ga0495676_0054670 | |||
| 1339 | Ga0495593_0033452 | |||
| 1340 | Ga0495602_0835497 | |||
| 1341 | Ga0495614_0040393 | |||
| 1342 | Ga0495614_0155981 | |||
| 1343 | Ga0495614_0361493 | |||
| 1344 | Ga0495615_0067105 | |||
| 1345 | Ga0495615_0075561 | |||
| 1346 | Ga0496101_0006112 | |||
| 1347 | Ga0496101_0034301 | |||
| 1348 | Ga0496102_0024751 | |||
| 1349 | Ga0496102_0557464 | |||
| 1350 | Ga0496102_1080396 | |||
| 1351 | Ga0496103_0014373 | |||
| 1352 | Ga0496104_0005753 | |||
| 1353 | Ga0496104_0023014 | |||
| 1354 | Ga0496104_0338251 | |||
| 1355 | Ga0496105_0166483 | |||
| 1356 | Ga0496105_0217888 | |||
| 1357 | Ga0496107_0129413 | |||
| 1358 | Ga0496108_0304054 | |||
| 1359 | Ga0496109_0429837 | |||
| 1360 | Ga0496109_0945999 | |||
| 1361 | Ga0496110_0101414 | |||
| 1362 | Ga0496110_0186143 | |||
| 1363 | Ga0496111_0163859 | |||
| 1364 | Ga0496112_0376609 | |||
| 1365 | Ga0496114_0119099 | |||
| 1366 | Ga0496114_0782441 | |||
| 1367 | Ga0496116_0031289 | |||
| 1368 | Ga0496117_0091489 | |||
| 1369 | Ga0496117_0104753 | |||
| 1370 | Ga0496117_0323975 | |||
| 1371 | Ga0496118_0009792 | |||
| 1372 | Ga0496118_0057847 | |||
| 1373 | Ga0496119_0050596 | |||
| 1374 | Ga0496121_0026608 | |||
| 1375 | Ga0496121_0075961 | |||
| 1376 | Ga0496121_0095100 | |||
| 1377 | Ga0496121_0278411 | |||
| 1378 | Ga0496122_0000063 | |||
| 1379 | Ga0496122_0036508 | |||
| 1380 | Ga0496122_0271500 | |||
| 1381 | Ga0496123_0000045 | |||
| 1382 | Ga0496123_0066793 | |||
| 1383 | Ga0496123_0274693 | |||
| 1384 | Ga0496124_0025846 | |||
| 1385 | Ga0496124_0027532 | |||
| 1386 | Ga0496124_0052717 | |||
| 1387 | Ga0496125_0015804 | |||
| 1388 | Ga0496125_0018589 | |||
| 1389 | Ga0496125_0026445 | |||
| 1390 | Ga0496125_0034979 | |||
| 1391 | Ga0496125_0045967 | |||
| 1392 | Ga0496126_0086721 | |||
| 1393 | Ga0501034_0513293 | |||
| 1394 | Ga0501034_0580692 | |||
| 1395 | Ga0501249_031273 | |||
| 1396 | Ga0501262_000532 | |||
| 1397 | Ga0501266_000189 | |||
| 1398 | Ga0501268_016851 | |||
| 1399 | Ga0501226_012713 | |||
| 1400 | nmdc:mga03683_114549_c1 | |||
| 1401 | nmdc:mga03683_147316_c1 | |||
| 1402 | nmdc:mga03683_47967_c1 | |||
| 1403 | nmdc:mga03683_68271_c1 | |||
| 1404 | nmdc:mga03n38_411859_c1 | |||
| 1405 | nmdc:mga03n38_462996_c1 | |||
| 1406 | nmdc:mga03n38_75513_c1 | |||
| 1407 | nmdc:mga0yw44_150201_c1 | |||
| 1408 | nmdc:mga0yw44_39841_c1 | |||
| 1409 | nmdc:mga0yw44_755255_c1 | |||
| 1410 | nmdc:mga0k408_11179_c1 | |||
| 1411 | nmdc:mga0k408_14507_c1 | |||
| 1412 | nmdc:mga0k408_19690_c1 | |||
| 1413 | nmdc:mga0k408_250955_c1 | |||
| 1414 | nmdc:mga0k408_275230_c1 | |||
| 1415 | nmdc:mga0k408_299329_c1 | |||
| 1416 | nmdc:mga06z11_254454_c1 | |||
| 1417 | nmdc:mga06z11_395256_c1 | |||
| 1418 | nmdc:mga04h51_137435_c1 | |||
| 1419 | nmdc:mga07m45_207634_c1 | |||
| 1420 | nmdc:mga07m45_2078_c1 | |||
| 1421 | nmdc:mga07m45_23737_c1 | |||
| 1422 | nmdc:mga07m45_246781_c1 | |||
| 1423 | nmdc:mga07m45_4305_c1 | |||
| 1424 | nmdc:mga07m45_82066_c1 | |||
| 1425 | nmdc:mga07m45_9105_c1 | |||
| 1426 | nmdc:mga0sz30_141582_c1 | |||
| 1427 | Ga0500610_0003003 | |||
| 1428 | Ga0500610_0004823 | |||
| 1429 | Ga0500643_011596 | |||
| 1430 | Ga0500644_0036663 | |||
| 1431 | Ga0500644_0095159 | |||
| 1432 | Ga0500583_0043952 | |||
| 1433 | Ga0500651_0000125 | |||
| 1434 | Ga0500651_0019235 | |||
| 1435 | Ga0500566_0168782 | |||
| 1436 | Ga0500560_123386 | |||
| 1437 | Ga0500569_104439 | |||
| 1438 | Ga0500571_000811 | |||
| 1439 | Ga0500593_003399 | |||
| 1440 | Ga0500593_004926 | |||
| 1441 | Ga0500594_0013942 | |||
| 1442 | Ga0500595_105110 | |||
| 1443 | Ga0500597_118750 | |||
| 1444 | Ga0500607_004599 | |||
| 1445 | Ga0500607_007247 | |||
| 1446 | Ga0500608_010325 | |||
| 1447 | Ga0500608_089376 | |||
| 1448 | Ga0500608_114052 | |||
| 1449 | Ga0500614_089979 | |||
| 1450 | Ga0500618_018192 | |||
| 1451 | Ga0500621_043200 | |||
| 1452 | Ga0500626_015711 | |||
| 1453 | Ga0500628_018756 | |||
| 1454 | Ga0500655_002019 | |||
| 1455 | Ga0500658_0001125 | |||
| 1456 | Ga0500658_0002341 | |||
| 1457 | Ga0500559_0000119 | |||
| 1458 | Ga0500559_0012473 | |||
| 1459 | Ga0500559_0261687 | |||
| 1460 | Ga0500561_0080760 | |||
| 1461 | Ga0500564_220229 | |||
| 1462 | Ga0500568_0002512 | |||
| 1463 | Ga0500573_0190617 | |||
| 1464 | Ga0500574_056806 | |||
| 1465 | Ga0500616_0124057 | |||
| 1466 | Ga0500622_0004359 | |||
| 1467 | Ga0500627_0001087 | |||
| 1468 | Ga0500634_0015330 | |||
| 1469 | Ga0500636_0253279 | |||
| 1470 | Ga0500625_058487 | |||
| 1471 | Ga0500645_000687 | |||
| 1472 | Ga0500645_003664 | |||
| 1473 | Ga0500587_016786 | |||
| 1474 | Ga0500661_000976 | |||
| 1475 | 2511244359 | |||
| 1476 | 2513227686 | |||
| 1477 | 2548497953 | |||
| 1478 | 2599625617 | |||
| 1479 | 2599673630 | |||
| 1480 | 2599683300 | |||
| 1481 | 2599695212 | |||
| 1482 | 2643868649 | |||
| 1483 | 2643991023 | |||
| 1484 | 2644058816 | |||
| 1485 | 2644071059 | |||
| 1486 | 2644162294 | |||
| 1487 | 2644295838 | |||
| 1488 | 2644324455 | |||
| 1489 | 2644396296 | |||
| 1490 | 2644464662 | |||
| 1491 | 2644649579 | |||
| 1492 | 2738719203 | |||
| 1493 | 2738880224 | |||
| 1494 | 2739245174 | |||
| 1495 | 2739248077 | |||
| 1496 | 2739281965 | |||
| 1497 | 2816471524 | |||
| 1498 | 2819599704 | |||
| 1499 | 2831271763 | |||
| 1500 | 2838055612 | |||
| 1501 | 2842682661 | |||
| 1502 | 2842734236 | |||
| 1503 | 2842749507 | |||
| 1504 | 2881102976 | |||
| 1505 | 2885194775 | |||
| 1506 | 2885200854 | |||
| 1507 | 2885214363 | |||
| 1508 | 2894024665 | |||
| 1509 | 2899927663 | |||
| 1510 | 2904450635 | |||
| 1511 | 2904459865 | |||
| 1512 | 2904479593 | |||
| 1513 | 2904549832 | |||
| 1514 | 2919462836 | |||
| 1515 | 2928042060 | |||
| 1516 | 2928049624 | |||
| 1517 | 2928051702 | |||
| 1518 | 2928065607 | |||
| 1519 | 2928073074 | |||
| 1520 | 2928086861 | |||
| 1521 | 2928117604 | |||
| 1522 | 2929161802 | |||
| 1523 | 2929521352 | |||
| 1524 | 2939635380 | |||
| 1525 | 2945913802 | |||
| 1526 | 2945949365 | |||
| 1527 | 2945973410 | |||
| 1528 | 2945990799 | |||
| 1529 | 2954770988 | |||
| 1530 | 2990711452 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1r67-assembly1.cif.gz_A | y104a mutant of e.coli ipp isomerase | 0.8554 | 45 | 143 |
| 4v14-assembly2.cif.gz_B | structure and function analysis of mutt from the psychrofile fish pathogen aliivibrio salmonicida and the mesophile vibrio cholerae | 0.8322 | 45 | 144 |
| 3h95-assembly1.cif.gz_A-2 | crystal structure of the nudix domain of nudt6 | 0.7956 | 45 | 162 |
| 8sxs-assembly2.cif.gz_B | crystal structure of a nudix hydrolase effector from magnaporthe oryzae | 0.7925 | 41 | 143 |
| 4jzu-assembly1.cif.gz_A | crystal structure of the bacillus subtilis pyrophosphohydrolase bsrpph bound to a non-hydrolysable triphosphorylated dinucleotide rna (pcp-pgpg) - first guanosine residue in guanosine binding pocket | 0.784 | 40 | 139 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WIX5_169_312_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9225 | 44 | 141 | 3.90.79.10 |
| af_Q19427_210_368_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9107 | 43 | 141 | 3.90.79.10 |
| af_P53164_221_376_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8892 | 44 | 141 | 3.90.79.10 |
| af_Q94A82_242_424_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8464 | 44 | 141 | 3.90.79.10 |
| 2gb5A02 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8414 | 41 | 164 | 3.90.79.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2R5EL96-F1-model_v4 | Nudix hydrolase domain-containing protein | 0.9643 | 44 | 162 |
GO:0016787
|
| AF-A0A3N5FKE5-F1-model_v4 | NUDIX hydrolase | 0.9635 | 74 | 170 |
GO:0016787
|
| AF-A0A847VK60-F1-model_v4 | NUDIX domain-containing protein | 0.9527 | 40 | 169 |
|
| AF-A0A3N5FKE5-F1-model_v4 | NUDIX hydrolase | 0.9263 | 74 | 170 |
GO:0016787
|
| AF-A0A2R5EL96-F1-model_v4 | Nudix hydrolase domain-containing protein | 0.9051 | 44 | 162 |
GO:0016787
|