F479809

General Info

Members Datasets Scaffolds Average Seq Length
765 401 1530 186

Family's Representative Sequence

Representative Sequence 3300050516|nmdc:mga0sz30_319121_c1|nmdc:mga0sz30_319121_c1_34_660
Length 208
Sequence MPDGPPGRDKTRKKRDPMPHPKFCQVCATPLEWIALMEDGGPKERLRCPNCGHTHWNNPTPVLAAIVEYRGQVLLARNAAWPGKMFALITGFMEAGETPEEGIAREVKEETNLDVSAAKIVGAYDFQRMNQVIIAYHVVADGEVKLSPELVDYRLYDLPDLKCWPAGTGYALADWLRTRGHEPVFFTAAENEERRRGLNLPPEPGNAS

Samples

Sample ID Description Type Environment
1 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
73 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
85 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
86 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
100 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
101 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
102 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
106 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
107 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
108 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
110 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
111 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
166 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
173 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
174 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
175 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
176 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
177 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
178 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
179 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
180 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
181 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
182 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
187 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
188 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
189 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
199 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
200 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
201 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
202 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
206 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
207 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
208 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
209 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
210 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
211 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
212 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
213 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
214 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
215 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
216 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
217 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
218 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
219 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
220 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
221 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
222 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
223 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
224 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
225 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
226 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
227 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
228 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
229 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
230 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
231 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
232 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
233 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
234 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
235 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
238 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
241 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
242 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
243 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
244 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
247 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
248 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
249 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
250 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
251 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
252 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
253 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
254 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
255 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
256 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
257 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
258 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
259 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
261 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
262 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
263 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
266 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
267 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
268 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
269 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
270 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
271 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
272 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
273 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
274 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
275 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
276 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
277 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
278 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
279 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
286 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
287 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
288 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
289 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
290 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
291 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
292 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
293 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
294 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
295 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
296 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
298 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
299 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
300 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
301 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
302 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
303 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
304 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
305 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
306 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
307 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
308 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
309 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
310 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
311 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
312 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
313 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
314 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
315 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
316 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
317 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
318 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
319 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
320 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
321 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
322 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
323 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
324 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
325 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
326 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
327 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
328 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
329 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
330 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
331 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
332 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
333 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
334 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
335 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
336 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
337 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
338 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
339 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
340 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
341 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
342 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
343 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
344 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
345 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
346 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
347 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
348 2547132374 Acidovorax radicis N35 Isolate Unclassified
349 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
350 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
351 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
352 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
353 2643221570 Acidovorax sp. Root568 Isolate Unclassified
354 2643221596 Acidovorax sp. Root70 Isolate Unclassified
355 2643221609 Acidovorax sp. Root217 Isolate Unclassified
356 2643221611 Acidovorax sp. Root219 Isolate Unclassified
357 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
358 2643221652 Acidovorax sp. Root402 Isolate Unclassified
359 2643221658 Variovorax sp. Root411 Isolate Unclassified
360 2643221672 Variovorax sp. Root434 Isolate Unclassified
361 2643221683 Variovorax sp. Root473 Isolate Unclassified
362 2643221717 Acidovorax sp. Root267 Isolate Unclassified
363 2738541277 Variovorax sp. GV051 Isolate Unclassified
364 2738541307 Variovorax sp. GV008 Isolate Unclassified
365 2738543012 Acidovorax sp. CF301 Isolate Unclassified
366 2738543013 Variovorax sp. BT01 Isolate Unclassified
367 2738543019 Variovorax sp. GV040 Isolate Unclassified
368 2816332133 Acidovorax radicis 2721A Isolate Unclassified
369 2818991446 Variovorax sp. 1180 Isolate Unclassified
370 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
371 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
372 2842677519 Variovorax sp. R-72495 Isolate Unclassified
373 2842733646 Variovorax sp. R-72446 Isolate Unclassified
374 2842747753 Variovorax sp. R-72060 Isolate Unclassified
375 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
376 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
377 2885198086 Variovorax sp. 679 Isolate Unclassified
378 2885211737 Variovorax sp. 553 Isolate Unclassified
379 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
380 2899924645 Variovorax sp. 369 Isolate Unclassified
381 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
382 2904456579 Variovorax sp. 2002 Isolate Unclassified
383 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
384 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
385 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
386 2928037797 Variovorax sp. 1126 Isolate Unclassified
387 2928044640 Variovorax sp. 1128 Isolate Unclassified
388 2928051484 Variovorax sp. 1133 Isolate Unclassified
389 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
390 2928070936 Variovorax gossypii 1167 Isolate Unclassified
391 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
392 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
393 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
394 2929520902 Variovorax beijingensis 502 Isolate Unclassified
395 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
396 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
397 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
398 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
399 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
400 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
401 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.29
Metatranscriptomes 0.39
Isolates 7.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 36.86
Nodule 0.52
Rhizoplane 3.53
Rhizosphere 46.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0sz30_319121_c1 3300050516 Bacteria 693
2 JGI24740J21852_10030281 3300001979 Bacteria 1764
3 JGI24740J21852_10070441 3300001979 Bacteria 938
4 JGI25155J39150_1000223 3300002704 Bacteria 22401
5 JGI25156J39149_1000045 3300002705 Bacteria 104173
6 JGI25156J39149_1010399 3300002705 Bacteria 2190
7 JGI25154J39366_1000064 3300002738 Bacteria 104148
8 JGI25158J39367_1008558 3300002739 Bacteria 1419
9 JGI25157J39369_1000063 3300002741 Bacteria 104173
10 JGI25152J39213_1009477 3300002773 Bacteria 2310
11 JGI25152J39213_1009835 3300002773 Bacteria 2235
12 JGI25152J39213_1015472 3300002773 Bacteria 1504
13 JGI25150J39212_1002850 3300002774 Bacteria 4185
14 JGI25150J39212_1003825 3300002774 Bacteria 3459
15 JGI25150J39212_1003925 3300002774 Bacteria 3395
16 JGI25150J39212_1014919 3300002774 Bacteria 1307
17 JGI25159J45721_1000798 3300002987 Bacteria 13721
18 JGI25159J45721_1010548 3300002987 Bacteria 2344
19 JGI25159J45721_1013766 3300002987 Bacteria 1855
20 JGI25159J45721_1023019 3300002987 Bacteria 1139
21 JGI25151J46595_10003268 3300003187 Bacteria 9013
22 JGI25151J46595_10005204 3300003187 Bacteria 6746
23 JGI25151J46595_10005490 3300003187 Bacteria 6540
24 JGI25151J46595_10008408 3300003187 Bacteria 4967
25 JGI25151J46595_10024951 3300003187 Bacteria 2438
26 JGI25151J46595_10026989 3300003187 Bacteria 2310
27 JGI25151J46595_10090142 3300003187 Bacteria 856
28 JGI25151J46595_10090161 3300003187 Bacteria 856
29 JGI25153J46596_10022631 3300003215 Bacteria 2310
30 JGI25153J46596_10028099 3300003215 Bacteria 1958
31 rootH1_10036541 3300003323 Bacteria 2460
32 JGI25160J50197_1000316 3300003354 Bacteria 33601
33 JGI25160J50197_1016807 3300003354 Bacteria 2344
34 JGI25160J50197_1022936 3300003354 Bacteria 1818
35 JGI25161J50226_1000236 3300003374 Bacteria 33595
36 JGI25161J50226_1005307 3300003374 Bacteria 2523
37 JGI25161J50226_1009924 3300003374 Bacteria 1313
38 Ga0006562J51391_1018602 3300003578 Bacteria 3830
39 Ga0006562J51391_1018603 3300003578 Bacteria 2740
40 Ga0006562J51391_1039299 3300003578 Bacteria 1170
41 Ga0055535_1000142 3300003761 Bacteria 75104
42 Ga0055542_1000022 3300003762 Bacteria 302315
43 Ga0055526_1001281 3300003771 Bacteria 18027
44 Ga0055526_1002710 3300003771 Bacteria 11768
45 Ga0055526_1020540 3300003771 Bacteria 2344
46 Ga0055526_1021182 3300003771 Bacteria 2273
47 Ga0055537_1000134 3300003773 Bacteria 56046
48 Ga0055537_1000634 3300003773 Bacteria 18768
49 Ga0055537_1008722 3300003773 Bacteria 2310
50 Ga0055524_1000114 3300003775 Bacteria 94476
51 Ga0055524_1019201 3300003775 Bacteria 2344
52 Ga0055524_1019969 3300003775 Bacteria 2273
53 Ga0055536_1000705 3300003781 Bacteria 22398
54 Ga0055536_1004046 3300003781 Bacteria 7636
55 Ga0055536_1008356 3300003781 Bacteria 4467
56 Ga0055536_1019549 3300003781 Bacteria 2124
57 Ga0055536_1041306 3300003781 Bacteria 1090
58 Ga0055534_1000088 3300003784 Bacteria 72004
59 Ga0055534_1002639 3300003784 Bacteria 6086
60 Ga0055534_1003059 3300003784 Bacteria 5471
61 Ga0055534_1008700 3300003784 Bacteria 2274
62 Ga0055528_1000135 3300003790 Bacteria 59436
63 Ga0055528_1000630 3300003790 Bacteria 26033
64 Ga0055528_1011813 3300003790 Bacteria 3436
65 Ga0055528_1018929 3300003790 Bacteria 2310
66 Ga0055530_10000473 3300003791 Bacteria 35024
67 Ga0055530_10000962 3300003791 Bacteria 23389
68 Ga0055530_10043050 3300003791 Bacteria 1091
69 Ga0055530_10044570 3300003791 Bacteria 1063
70 Ga0055540_1000153 3300003792 Bacteria 68176
71 Ga0055540_1000730 3300003792 Bacteria 22398
72 Ga0055540_1003446 3300003792 Bacteria 7640
73 Ga0055540_1008455 3300003792 Bacteria 3705
74 Ga0055540_1023232 3300003792 Bacteria 1565
75 Ga0055531_10002924 3300003794 Bacteria 11120
76 Ga0055531_10007733 3300003794 Bacteria 5801
77 Ga0055531_10023771 3300003794 Bacteria 2285
78 Ga0055531_10029872 3300003794 Bacteria 1845
79 Ga0055531_10048699 3300003794 Bacteria 1140
80 Ga0055543_1000605 3300004625 Bacteria 19442
81 Ga0055543_1007952 3300004625 Bacteria 2395
82 Ga0065165_1020642 3300005262 Bacteria 2312
83 Ga0065165_1025030 3300005262 Bacteria 1993
84 Ga0065165_1025184 3300005262 Bacteria 1984
85 Ga0065165_1029492 3300005262 Bacteria 1756
86 Ga0065165_1031225 3300005262 Bacteria 1686
87 Ga0065165_1050881 3300005262 Bacteria 1177
88 Ga0065165_1084473 3300005262 Bacteria 818
89 Ga0065714_10004149 3300005288 Bacteria 5915
90 Ga0065714_10143273 3300005288 Bacteria 1156
91 Ga0065704_10113056 3300005289 Bacteria 1920
92 Ga0070658_10397971 3300005327 Bacteria 1183
93 Ga0070658_10726101 3300005327 Bacteria 863
94 Ga0068869_100223657 3300005334 Bacteria 1493
95 Ga0070666_10212173 3300005335 Bacteria 1364
96 Ga0068868_100097533 3300005338 Bacteria 2375
97 Ga0070661_100001209 3300005344 Bacteria 18186
98 Ga0070669_100532246 3300005353 Bacteria 978
99 Ga0070669_100823185 3300005353 Bacteria 790
100 Ga0070674_100032006 3300005356 Bacteria 3490
101 Ga0070673_100222023 3300005364 Bacteria 1636
102 Ga0070688_100213909 3300005365 Bacteria 1355
103 Ga0070659_100005054 3300005366 Bacteria 9458
104 Ga0070667_100028787 3300005367 Bacteria 4625
105 Ga0070667_100052972 3300005367 Bacteria 3424
106 Ga0070678_100027689 3300005456 Bacteria 3852
107 Ga0070678_100038770 3300005456 Bacteria 3357
108 Ga0070678_100217469 3300005456 Bacteria 1586
109 Ga0070678_100226206 3300005456 Bacteria 1557
110 Ga0070678_100889913 3300005456 Bacteria 813
111 Ga0070662_100028288 3300005457 Bacteria 3900
112 Ga0070662_100484005 3300005457 Bacteria 1030
113 Ga0070706_100324736 3300005467 Bacteria 1435
114 Ga0070707_100136640 3300005468 Bacteria 2385
115 Ga0070679_100102866 3300005530 Bacteria 2843
116 Ga0068853_100011565 3300005539 Bacteria 7176
117 Ga0070665_100024888 3300005548 Bacteria 6032
118 Ga0070665_100068370 3300005548 Bacteria 3562
119 Ga0070665_100266655 3300005548 Bacteria 1714
120 Ga0068855_100144470 3300005563 Bacteria 2710
121 Ga0070664_100018592 3300005564 Bacteria 5712
122 Ga0070664_100112954 3300005564 Bacteria 2373
123 Ga0068857_100042395 3300005577 Bacteria 4037
124 Ga0068854_100127781 3300005578 Bacteria 1938
125 Ga0068856_100939010 3300005614 Bacteria 884
126 Ga0070702_100780329 3300005615 Bacteria 737
127 Ga0068852_100224588 3300005616 Bacteria 1787
128 Ga0068851_10033206 3300005834 Bacteria 2571
129 Ga0068863_100279554 3300005841 Bacteria 1617
130 Ga0075365_10158975 3300006038 Bacteria 1574
131 Ga0075363_100024393 3300006048 Bacteria 3074
132 Ga0075363_100247420 3300006048 Bacteria 1026
133 Ga0075364_10272887 3300006051 Bacteria 1150
134 Ga0075432_10017603 3300006058 Bacteria 2436
135 Ga0075362_10013049 3300006177 Bacteria 3316
136 Ga0075362_10026340 3300006177 Bacteria 2482
137 Ga0075362_10034297 3300006177 Bacteria 2212
138 Ga0075362_10067001 3300006177 Bacteria 1633
139 Ga0075362_10071724 3300006177 Bacteria 1583
140 Ga0075362_10153702 3300006177 Bacteria 1105
141 Ga0075367_10242048 3300006178 Bacteria 1131
142 Ga0075367_10642940 3300006178 Bacteria 674
143 Ga0075369_10126380 3300006186 Bacteria 1160
144 Ga0075369_10150909 3300006186 Bacteria 1062
145 Ga0075366_10005247 3300006195 Bacteria 7014
146 Ga0075366_10026719 3300006195 Bacteria 3382
147 Ga0075366_10136314 3300006195 Bacteria 1482
148 Ga0075366_10163703 3300006195 Bacteria 1348
149 Ga0075366_10262860 3300006195 Bacteria 1053
150 Ga0075366_10272578 3300006195 Bacteria 1034
151 Ga0097621_100065798 3300006237 Bacteria 2984
152 Ga0097621_100387128 3300006237 Bacteria 1250
153 Ga0097621_100671876 3300006237 Bacteria 952
154 Ga0075370_10002395 3300006353 Bacteria 8682
155 Ga0075370_10004349 3300006353 Bacteria 6866
156 Ga0075370_10026838 3300006353 Bacteria 3192
157 Ga0075370_10058172 3300006353 Bacteria 2198
158 Ga0075370_10117798 3300006353 Bacteria 1544
159 Ga0075370_10168276 3300006353 Bacteria 1288
160 Ga0075370_10428739 3300006353 Bacteria 795
161 Ga0075370_10565707 3300006353 Bacteria 688
162 Ga0075370_10642398 3300006353 Bacteria 644
163 Ga0068871_100083605 3300006358 Bacteria 2648
164 Ga0068865_100100582 3300006881 Bacteria 2116
165 Ga0075436_100210527 3300006914 Bacteria 1378
166 Ga0099826_10001370 3300006948 Bacteria 14497
167 Ga0105244_10012570 3300009036 Bacteria 4994
168 Ga0105244_10108715 3300009036 Bacteria 1351
169 Ga0105240_10126866 3300009093 Bacteria 3065
170 Ga0105245_10441714 3300009098 Bacteria 1308
171 Ga0105245_10702953 3300009098 Bacteria 1044
172 Ga0105245_11475186 3300009098 Bacteria 731
173 Ga0105243_10006758 3300009148 Bacteria 8850
174 Ga0105243_10009873 3300009148 Bacteria 7260
175 Ga0105243_10303192 3300009148 Bacteria 1449
176 Ga0105241_10243307 3300009174 Bacteria 1522
177 Ga0105242_11114671 3300009176 Bacteria 804
178 Ga0105237_10029245 3300009545 Bacteria 5604
179 Ga0105238_10064300 3300009551 Bacteria 3669
180 Ga0105238_10261834 3300009551 Bacteria 1709
181 Ga0105249_11723208 3300009553 Bacteria 699
182 Ga0105239_10349276 3300010375 Bacteria 1670
183 Ga0105246_10053898 3300011119 Bacteria 2769
184 Ga0157320_1017629 3300012481 Bacteria 623
185 Ga0157347_1013284 3300012502 Bacteria 898
186 Ga0157326_1000472 3300012513 Bacteria 4813
187 Ga0157373_10016632 3300013100 Bacteria 5361
188 Ga0157373_10092360 3300013100 Bacteria 2132
189 Ga0157373_10110847 3300013100 Bacteria 1929
190 Ga0157370_10039005 3300013104 Bacteria 4593
191 Ga0157370_10172185 3300013104 Bacteria 2012
192 Ga0157374_11960993 3300013296 Bacteria 612
193 Ga0157378_10024673 3300013297 Bacteria 5294
194 Ga0163162_10027211 3300013306 Bacteria 5654
195 Ga0163162_10238220 3300013306 Bacteria 1950
196 Ga0157375_10066886 3300013308 Bacteria 3589
197 Ga0157375_11443627 3300013308 Bacteria 811
198 Ga0182008_10000215 3300014497 Bacteria 45361
199 Ga0182008_10002427 3300014497 Bacteria 11696
200 Ga0182008_10006865 3300014497 Bacteria 6333
201 Ga0182008_10011104 3300014497 Bacteria 4805
202 Ga0182008_10016496 3300014497 Bacteria 3838
203 Ga0182008_10063964 3300014497 Bacteria 1811
204 Ga0157376_10218149 3300014969 Bacteria 1765
205 Ga0182006_1001570 3300015261 Bacteria 13642
206 Ga0182006_1226165 3300015261 Bacteria 616
207 Ga0182007_10001908 3300015262 Bacteria 10838
208 Ga0182007_10003300 3300015262 Bacteria 7652
209 Ga0182007_10092164 3300015262 Bacteria 998
210 Ga0183362_10005 3300015683 Bacteria 437616
211 Ga0163161_10004047 3300017792 Bacteria 10254
212 Ga0163161_10020171 3300017792 Bacteria 4676
213 Ga0163161_10044139 3300017792 Bacteria 3211
214 Ga0163161_10117515 3300017792 Bacteria 1995
215 Ga0213872_10011488 3300021361 Bacteria 4187
216 Ga0209435_100003 3300025206 Bacteria 669534
217 Ga0209436_103153 3300025208 Bacteria 4519
218 Ga0209436_105965 3300025208 Bacteria 2726
219 Ga0209436_111580 3300025208 Bacteria 1542
220 Ga0209672_101007 3300025228 Bacteria 12321
221 Ga0209147_103626 3300025229 Bacteria 2897
222 Ga0209258_100009 3300025242 Bacteria 996276
223 Ga0207425_1001790 3300025245 Bacteria 8331
224 Ga0207425_1003665 3300025245 Bacteria 4837
225 Ga0207425_1010227 3300025245 Bacteria 2294
226 Ga0207425_1018704 3300025245 Bacteria 1500
227 Ga0209646_1000008 3300025246 Bacteria 669534
228 Ga0209026_1000007 3300025250 Bacteria 669534
229 Ga0209148_1000007 3300025254 Bacteria 1592273
230 Ga0209759_1000019 3300025256 Bacteria 357908
231 Ga0209129_1000024 3300025258 Bacteria 417268
232 Ga0209129_1000085 3300025258 Bacteria 181765
233 Ga0209129_1003741 3300025258 Bacteria 6426
234 Ga0209129_1005702 3300025258 Bacteria 4294
235 Ga0209129_1020873 3300025258 Bacteria 1210
236 Ga0209129_1034832 3300025258 Bacteria 822
237 Ga0209565_1000043 3300025263 Bacteria 235332
238 Ga0209565_1000046 3300025263 Bacteria 226073
239 Ga0209565_1001626 3300025263 Bacteria 9464
240 Ga0209565_1005766 3300025263 Bacteria 3559
241 Ga0209565_1010497 3300025263 Bacteria 2293
242 Ga0209673_1000008 3300025273 Bacteria 626013
243 Ga0209673_1000058 3300025273 Bacteria 269028
244 Ga0209673_1010330 3300025273 Bacteria 3942
245 Ga0209673_1010835 3300025273 Bacteria 3810
246 Ga0209673_1032272 3300025273 Bacteria 1616
247 Ga0209673_1032359 3300025273 Bacteria 1612
248 Ga0209130_1000181 3300025284 Bacteria 89402
249 Ga0209130_1000481 3300025284 Bacteria 41115
250 Ga0209130_1002262 3300025284 Bacteria 9935
251 Ga0209130_1003501 3300025284 Bacteria 6597
252 Ga0209130_1027946 3300025284 Bacteria 1191
253 Ga0209130_1039276 3300025284 Bacteria 923
254 Ga0209675_1000010 3300025291 Bacteria 541927
255 Ga0209675_1000136 3300025291 Bacteria 99301
256 Ga0209675_1003141 3300025291 Bacteria 8041
257 Ga0209675_1005746 3300025291 Bacteria 5118
258 Ga0209675_1005766 3300025291 Bacteria 5104
259 Ga0209675_1014407 3300025291 Bacteria 2410
260 Ga0209675_1015001 3300025291 Bacteria 2325
261 Ga0209676_1000023 3300025292 Bacteria 589732
262 Ga0209676_1000028 3300025292 Bacteria 559745
263 Ga0209676_1000098 3300025292 Bacteria 234305
264 Ga0209676_1000173 3300025292 Bacteria 153411
265 Ga0209676_1000194 3300025292 Bacteria 136666
266 Ga0209676_1006015 3300025292 Bacteria 6122
267 Ga0209676_1006331 3300025292 Bacteria 5873
268 Ga0209676_1015360 3300025292 Bacteria 2820
269 Ga0209676_1077698 3300025292 Bacteria 766
270 Ga0209025_1000122 3300025294 Bacteria 206064
271 Ga0209025_1000404 3300025294 Bacteria 87744
272 Ga0209025_1002394 3300025294 Bacteria 20027
273 Ga0209025_1009104 3300025294 Bacteria 6995
274 Ga0209025_1016764 3300025294 Bacteria 4288
275 Ga0209025_1019136 3300025294 Bacteria 3826
276 Ga0209025_1020502 3300025294 Bacteria 3613
277 Ga0209025_1041131 3300025294 Bacteria 1986
278 Ga0209025_1047888 3300025294 Bacteria 1740
279 Ga0209025_1067826 3300025294 Bacteria 1286
280 Ga0209025_1068034 3300025294 Bacteria 1283
281 Ga0209025_1070815 3300025294 Bacteria 1239
282 Ga0209564_1000183 3300025295 Bacteria 150409
283 Ga0209564_1000198 3300025295 Bacteria 138511
284 Ga0209564_1000279 3300025295 Bacteria 104927
285 Ga0209564_1000478 3300025295 Bacteria 66586
286 Ga0209564_1008404 3300025295 Bacteria 5096
287 Ga0209758_1000049 3300025297 Bacteria 345104
288 Ga0209758_1022895 3300025297 Bacteria 2845
289 Ga0209758_1058085 3300025297 Bacteria 1296
290 Ga0209758_1062437 3300025297 Bacteria 1220
291 Ga0209050_1000002 3300025298 Bacteria 1792849
292 Ga0209050_1000022 3300025298 Bacteria 565239
293 Ga0209050_1000122 3300025298 Bacteria 195305
294 Ga0209050_1000554 3300025298 Bacteria 61514
295 Ga0209050_1005757 3300025298 Bacteria 7642
296 Ga0209050_1007635 3300025298 Bacteria 5998
297 Ga0209050_1015969 3300025298 Bacteria 3107
298 Ga0209050_1040978 3300025298 Bacteria 1283
299 Ga0209050_1059928 3300025298 Bacteria 905
300 Ga0209256_1000001 3300025299 Bacteria 2166974
301 Ga0209256_1000098 3300025299 Bacteria 204152
302 Ga0209256_1000140 3300025299 Bacteria 152770
303 Ga0207426_1000038 3300025302 Bacteria 441522
304 Ga0207426_1000053 3300025302 Bacteria 384818
305 Ga0207426_1000117 3300025302 Bacteria 224652
306 Ga0207426_1020862 3300025302 Bacteria 2272
307 Ga0207426_1104810 3300025302 Bacteria 723
308 Ga0209051_1000013 3300025303 Bacteria 565239
309 Ga0209051_1000015 3300025303 Bacteria 546798
310 Ga0209051_1000159 3300025303 Bacteria 126836
311 Ga0209051_1000194 3300025303 Bacteria 107213
312 Ga0209051_1000282 3300025303 Bacteria 82787
313 Ga0209051_1000597 3300025303 Bacteria 42565
314 Ga0209051_1014777 3300025303 Bacteria 3625
315 Ga0209257_1000002 3300025304 Bacteria 1767052
316 Ga0209257_1000042 3300025304 Bacteria 537149
317 Ga0209257_1004288 3300025304 Bacteria 11233
318 Ga0209257_1010273 3300025304 Bacteria 4778
319 Ga0209257_1020820 3300025304 Bacteria 2406
320 Ga0207697_10010983 3300025315 Bacteria 3845
321 Ga0207656_10010157 3300025321 Bacteria 3516
322 Ga0207655_1002288 3300025728 Bacteria 15755
323 Ga0207682_10002990 3300025893 Bacteria 7417
324 Ga0207642_10764117 3300025899 Bacteria 613
325 Ga0207688_10042052 3300025901 Bacteria 2543
326 Ga0207688_10504478 3300025901 Bacteria 758
327 Ga0207680_10124114 3300025903 Bacteria 1693
328 Ga0207643_10062819 3300025908 Bacteria 2122
329 Ga0207705_10324413 3300025909 Bacteria 1184
330 Ga0207654_10185859 3300025911 Bacteria 1358
331 Ga0207707_10308383 3300025912 Bacteria 1368
332 Ga0207671_10133849 3300025914 Bacteria 1905
333 Ga0207671_10295761 3300025914 Bacteria 1279
334 Ga0207671_10377306 3300025914 Bacteria 1126
335 Ga0207662_10228691 3300025918 Bacteria 1214
336 Ga0207657_10043944 3300025919 Bacteria 3932
337 Ga0207657_10180680 3300025919 Bacteria 1705
338 Ga0207657_10197245 3300025919 Bacteria 1621
339 Ga0207649_10001378 3300025920 Bacteria 14398
340 Ga0207652_10214327 3300025921 Bacteria 1734
341 Ga0207681_10063129 3300025923 Bacteria 2553
342 Ga0207681_10186908 3300025923 Bacteria 1582
343 Ga0207681_10425734 3300025923 Bacteria 1076
344 Ga0207650_10001149 3300025925 Bacteria 19437
345 Ga0207687_10376259 3300025927 Bacteria 1162
346 Ga0207687_10487568 3300025927 Bacteria 1027
347 Ga0207687_10837996 3300025927 Bacteria 785
348 Ga0207644_10001362 3300025931 Bacteria 15719
349 Ga0207690_10159378 3300025932 Bacteria 1681
350 Ga0207690_10721768 3300025932 Bacteria 820
351 Ga0207706_10025112 3300025933 Bacteria 5342
352 Ga0207706_10349535 3300025933 Bacteria 1286
353 Ga0207686_10795342 3300025934 Bacteria 758
354 Ga0207709_10000285 3300025935 Bacteria 57630
355 Ga0207709_10004960 3300025935 Bacteria 7618
356 Ga0207669_10005292 3300025937 Bacteria 5773
357 Ga0207704_10072751 3300025938 Bacteria 2186
358 Ga0207689_10131776 3300025942 Bacteria 2057
359 Ga0207689_10382753 3300025942 Bacteria 1171
360 Ga0207679_10000249 3300025945 Bacteria 41064
361 Ga0207679_10093359 3300025945 Bacteria 2333
362 Ga0207667_10272100 3300025949 Bacteria 1731
363 Ga0207651_10001278 3300025960 Bacteria 11329
364 Ga0207640_10069120 3300025981 Bacteria 2370
365 Ga0207677_10003562 3300026023 Bacteria 8253
366 Ga0207677_10289493 3300026023 Bacteria 1348
367 Ga0207703_10197808 3300026035 Bacteria 1784
368 Ga0207639_10010174 3300026041 Bacteria 6508
369 Ga0207641_10094723 3300026088 Bacteria 2619
370 Ga0207641_10889218 3300026088 Bacteria 884
371 Ga0207648_10048712 3300026089 Bacteria 3709
372 Ga0207676_10046020 3300026095 Bacteria 3374
373 Ga0207674_10059455 3300026116 Bacteria 3867
374 Ga0207674_10560732 3300026116 Bacteria 1103
375 Ga0207674_10579827 3300026116 Bacteria 1084
376 Ga0207674_10598378 3300026116 Bacteria 1065
377 Ga0207683_10040254 3300026121 Bacteria 4077
378 Ga0207683_10176551 3300026121 Bacteria 1936
379 Ga0207683_10187549 3300026121 Bacteria 1877
380 Ga0207683_10208821 3300026121 Bacteria 1776
381 Ga0207683_10838453 3300026121 Bacteria 853
382 Ga0207698_10202836 3300026142 Bacteria 1777
383 Ga0209995_1015707 3300027471 Bacteria 1241
384 Ga0209282_1001079 3300027666 Bacteria 14459
385 Ga0209971_1004611 3300027682 Bacteria 3269
386 Ga0209974_10028969 3300027876 Bacteria 1834
387 Ga0207428_10590739 3300027907 Bacteria 801
388 Ga0268266_10026117 3300028379 Bacteria 4969
389 Ga0268266_10238118 3300028379 Bacteria 1679
390 Ga0307517_10010725 3300028786 Bacteria 12781
391 Ga0307515_10012653 3300028794 Bacteria 15850
392 Ga0307515_10029938 3300028794 Bacteria 9173
393 Ga0307515_10184906 3300028794 Bacteria 2018
394 Ga0307515_10373200 3300028794 Bacteria 1062
395 Ga0307512_10058292 3300030522 Bacteria 3010
396 Ga0316177_1112288 3300030731 Bacteria 3326
397 Ga0316177_1125363 3300030731 Bacteria 1720
398 Ga0314311_1160343 3300030733 Bacteria 1320
399 Ga0316178_1142965 3300030735 Bacteria 7757
400 Ga0316183_1076813 3300030742 Bacteria 4172
401 Ga0316183_1082821 3300030742 Bacteria 1198
402 Ga0316181_1034408 3300030744 Bacteria 3273
403 Ga0316182_1014668 3300030745 Bacteria 1054
404 Ga0316182_1250129 3300030745 Bacteria 1266
405 Ga0265330_10000014 3300031235 Bacteria 175673
406 Ga0265332_10000011 3300031238 Bacteria 284299
407 Ga0265332_10000035 3300031238 Bacteria 139554
408 Ga0265325_10003832 3300031241 Bacteria 9673
409 Ga0265327_10005786 3300031251 Bacteria 10168
410 Ga0265327_10013542 3300031251 Bacteria 5411
411 Ga0307513_10000020 3300031456 Bacteria 228745
412 Ga0307513_10085785 3300031456 Bacteria 3230
413 Ga0307513_10257508 3300031456 Bacteria 1537
414 Ga0307509_10006670 3300031507 Bacteria 15405
415 Ga0307509_10027095 3300031507 Bacteria 6381
416 Ga0307509_10056928 3300031507 Bacteria 4147
417 Ga0307509_10141405 3300031507 Bacteria 2341
418 Ga0307408_100002073 3300031548 Bacteria 14439
419 Ga0307408_100005387 3300031548 Bacteria 8572
420 Ga0307408_100034033 3300031548 Bacteria 3565
421 Ga0307408_100147544 3300031548 Bacteria 1853
422 Ga0307408_100192946 3300031548 Bacteria 1642
423 Ga0307408_100333476 3300031548 Bacteria 1282
424 Ga0307408_100370267 3300031548 Bacteria 1221
425 Ga0307408_100429414 3300031548 Bacteria 1141
426 Ga0307408_100475960 3300031548 Bacteria 1088
427 Ga0307408_100642828 3300031548 Bacteria 947
428 Ga0307508_10053638 3300031616 Bacteria 3577
429 Ga0307514_10072288 3300031649 Bacteria 2583
430 Ga0307514_10384060 3300031649 Bacteria 727
431 Ga0265314_10000026 3300031711 Bacteria 284299
432 Ga0307516_10000311 3300031730 Bacteria 63197
433 Ga0307516_10217770 3300031730 Bacteria 1620
434 Ga0307405_10031768 3300031731 Bacteria 3112
435 Ga0307405_10056743 3300031731 Bacteria 2457
436 Ga0307405_10301009 3300031731 Bacteria 1216
437 Ga0307406_10001422 3300031901 Bacteria 13270
438 Ga0307406_10005238 3300031901 Bacteria 7086
439 Ga0307406_10028541 3300031901 Bacteria 3372
440 Ga0307406_10052872 3300031901 Bacteria 2585
441 Ga0307406_10752138 3300031901 Bacteria 818
442 Ga0307412_10033751 3300031911 Bacteria 3255
443 Ga0307412_10075260 3300031911 Bacteria 2315
444 Ga0307412_10097644 3300031911 Bacteria 2070
445 Ga0307412_10107572 3300031911 Bacteria 1985
446 Ga0307412_10120119 3300031911 Bacteria 1891
447 Ga0307412_10338868 3300031911 Bacteria 1203
448 Ga0307412_10366791 3300031911 Bacteria 1161
449 Ga0307412_10544039 3300031911 Bacteria 974
450 Ga0307412_10630421 3300031911 Bacteria 912
451 Ga0307409_100007440 3300031995 Bacteria 6550
452 Ga0307416_100035298 3300032002 Bacteria 3817
453 Ga0307416_100175226 3300032002 Bacteria 2002
454 Ga0307416_100986728 3300032002 Bacteria 945
455 Ga0307414_10062189 3300032004 Bacteria 2648
456 Ga0307414_10237145 3300032004 Bacteria 1508
457 Ga0307411_10237172 3300032005 Bacteria 1425
458 Ga0307411_10669359 3300032005 Bacteria 901
459 Ga0307415_100071636 3300032126 Bacteria 2438
460 Ga0307415_101090819 3300032126 Bacteria 747
461 Ga0307507_10213669 3300033179 Bacteria 1310
462 Ga0307507_10219951 3300033179 Bacteria 1278
463 Ga0307510_10003147 3300033180 Bacteria 19133
464 Ga0307510_10022531 3300033180 Bacteria 7314
465 Ga0307510_10060349 3300033180 Bacteria 3904
466 Ga0373932_0129161 3300035112 Bacteria 850
467 Ga0373939_0244479 3300035114 Bacteria 696
468 Ga0373962_0097594 3300035242 Bacteria 913
469 Ga0373931_0030402 3300035691 Bacteria 2780
470 Ga0373925_0280968 3300037068 Bacteria 1341
471 Ga0436361_0327114 3300039447 Bacteria 10222
472 Ga0436361_0443915 3300039447 Bacteria 3900
473 Ga0439436_0000382 3300041404 Bacteria 11010
474 Ga0439436_0004185 3300041404 Bacteria 4419
475 Ga0439439_0028565 3300041406 Bacteria 1413
476 Ga0439447_026574 3300041407 Bacteria 1483
477 Ga0439461_0026457 3300041410 Bacteria 1184
478 Ga0439466_0001231 3300041411 Bacteria 9960
479 Ga0439466_0028602 3300041411 Bacteria 1923
480 Ga0439465_0001246 3300041413 Bacteria 8214
481 Ga0439465_0070058 3300041413 Bacteria 1174
482 Ga0439465_0278196 3300041413 Bacteria 623
483 Ga0451791_1627931 3300041451 Bacteria 727
484 Ga0451795_0255321 3300041456 Bacteria 727
485 Ga0451798_0795614 3300041458 Bacteria 1259
486 Ga0451853_2985823 3300041512 Bacteria 2194
487 Ga0439431_0002744 3300041997 Bacteria 3869
488 Ga0439433_0003905 3300041999 Bacteria 3207
489 Ga0439433_0005989 3300041999 Bacteria 2614
490 Ga0439442_002538 3300042002 Bacteria 3584
491 Ga0439442_002770 3300042002 Bacteria 3442
492 Ga0439445_0000223 3300042004 Bacteria 10550
493 Ga0439445_0011709 3300042004 Bacteria 2096
494 Ga0439445_0177880 3300042004 Bacteria 624
495 Ga0439432_001997 3300042006 Bacteria 7723
496 Ga0439432_002220 3300042006 Bacteria 7326
497 Ga0439432_014455 3300042006 Bacteria 2672
498 Ga0439432_082056 3300042006 Bacteria 976
499 Ga0439449_0000209 3300042007 Bacteria 20674
500 Ga0439449_0000215 3300042007 Bacteria 20490
501 Ga0439449_0002802 3300042007 Bacteria 6773
502 Ga0439449_0004098 3300042007 Bacteria 5642
503 Ga0439449_0021863 3300042007 Bacteria 2394
504 Ga0439452_003966 3300042010 Bacteria 5062
505 Ga0439452_063493 3300042010 Bacteria 823
506 Ga0439457_003046 3300042014 Bacteria 4641
507 Ga0439457_056564 3300042014 Bacteria 885
508 Ga0439462_0009717 3300042015 Bacteria 2432
509 Ga0439462_0117488 3300042015 Bacteria 738
510 Ga0450911_000823 3300042115 Bacteria 8515
511 Ga0450912_001174 3300042116 Bacteria 1535
512 Ga0450923_005020 3300042125 Bacteria 2114
513 Ga0450907_005113 3300042146 Bacteria 2224
514 Ga0450908_000697 3300042184 Bacteria 6439
515 Ga0450908_027597 3300042184 Bacteria 989
516 Ga0450909_029739 3300042185 Bacteria 827
517 Ga0439434_0001906 3300042435 Bacteria 6054
518 Ga0450893_0003142 3300042532 Bacteria 2595
519 Ga0453684_0206707 3300044712 Bacteria 2285
520 Ga0466960_0101941 3300044901 Bacteria 1479
521 Ga0466959_0000733 3300045049 Bacteria 19138
522 Ga0451576_0335672 3300045051 Bacteria 1582
523 Ga0451576_1263050 3300045051 Bacteria 770
524 Ga0495627_019753 3300046453 Bacteria 2254
525 Ga0495592_0012833 3300046454 Bacteria 6370
526 Ga0495629_0676626 3300046459 Bacteria 686
527 Ga0495651_0484538 3300046462 Bacteria 794
528 Ga0495651_0493154 3300046462 Bacteria 785
529 Ga0495639_0007320 3300046475 Bacteria 4736
530 Ga0495610_0148848 3300046512 Bacteria 1001
531 Ga0495610_0191142 3300046512 Bacteria 845
532 Ga0495610_0212230 3300046512 Bacteria 786
533 Ga0495616_0003860 3300046513 Bacteria 9551
534 Ga0495620_0004751 3300046515 Bacteria 7640
535 Ga0495620_0098102 3300046515 Bacteria 1170
536 Ga0495628_0606781 3300046516 Bacteria 781
537 Ga0495630_0144677 3300046517 Bacteria 1808
538 Ga0495631_0011741 3300046518 Bacteria 4297
539 Ga0495632_0221853 3300046519 Bacteria 855
540 Ga0495637_0001872 3300046520 Bacteria 12011
541 Ga0495637_0042227 3300046520 Bacteria 1952
542 Ga0495648_0154014 3300046524 Bacteria 1196
543 Ga0495648_0246754 3300046524 Bacteria 864
544 Ga0495648_0304102 3300046524 Bacteria 746
545 Ga0495642_0128795 3300046528 Bacteria 1089
546 Ga0495642_0336927 3300046528 Bacteria 662
547 Ga0495654_0127923 3300046530 Bacteria 1143
548 Ga0495654_0146429 3300046530 Bacteria 1048
549 Ga0495586_0198927 3300046535 Bacteria 1136
550 Ga0495587_0636758 3300046536 Bacteria 586
551 Ga0495598_0163049 3300046537 Bacteria 786
552 Ga0495621_0003571 3300046539 Bacteria 4293
553 Ga0495633_0161198 3300046558 Bacteria 1035
554 Ga0495667_0465036 3300046559 Bacteria 794
555 Ga0495656_0000087 3300046615 Bacteria 40520
556 Ga0495625_0000245 3300046660 Bacteria 85443
557 Ga0495625_0079548 3300046660 Bacteria 2285
558 Ga0495625_0202528 3300046660 Bacteria 1309
559 Ga0495625_0226225 3300046660 Bacteria 1223
560 Ga0495625_0450337 3300046660 Bacteria 795
561 Ga0495635_0251013 3300046663 Bacteria 1193
562 Ga0495588_0007799 3300046674 Bacteria 4888
563 Ga0495588_0083355 3300046674 Bacteria 1670
564 Ga0495588_0162325 3300046674 Bacteria 1181
565 Ga0495599_0123305 3300046678 Bacteria 1611
566 Ga0495613_0202211 3300046689 Bacteria 1400
567 Ga0495613_0292588 3300046689 Bacteria 1129
568 Ga0495624_0425370 3300046690 Bacteria 796
569 Ga0495600_0349808 3300046809 Bacteria 926
570 Ga0495660_0137417 3300046810 Bacteria 1220
571 Ga0495604_0254205 3300047317 Bacteria 1197
572 Ga0495676_0035774 3300047321 Bacteria 4151
573 Ga0495676_0054670 3300047321 Bacteria 3172
574 Ga0495593_0033452 3300047673 Bacteria 2799
575 Ga0495602_0835497 3300048088 Bacteria 616
576 Ga0495614_0040393 3300048089 Bacteria 2002
577 Ga0495614_0155981 3300048089 Bacteria 1020
578 Ga0495614_0361493 3300048089 Bacteria 678
579 Ga0495615_0067105 3300048090 Bacteria 959
580 Ga0495615_0075561 3300048090 Bacteria 916
581 Ga0496101_0006112 3300048904 Bacteria 7732
582 Ga0496101_0034301 3300048904 Bacteria 3583
583 Ga0496102_0024751 3300048905 Bacteria 5339
584 Ga0496102_0557464 3300048905 Bacteria 1069
585 Ga0496102_1080396 3300048905 Bacteria 722
586 Ga0496103_0014373 3300048906 Bacteria 4702
587 Ga0496104_0005753 3300048907 Bacteria 10852
588 Ga0496104_0023014 3300048907 Bacteria 5726
589 Ga0496104_0338251 3300048907 Bacteria 1418
590 Ga0496105_0166483 3300048908 Bacteria 1808
591 Ga0496105_0217888 3300048908 Bacteria 1554
592 Ga0496107_0129413 3300048910 Bacteria 1863
593 Ga0496108_0304054 3300048911 Bacteria 1389
594 Ga0496109_0429837 3300048912 Bacteria 1247
595 Ga0496109_0945999 3300048912 Bacteria 799
596 Ga0496110_0101414 3300048913 Bacteria 2580
597 Ga0496110_0186143 3300048913 Bacteria 1885
598 Ga0496111_0163859 3300048914 Bacteria 1651
599 Ga0496112_0376609 3300048915 Bacteria 1361
600 Ga0496114_0119099 3300048917 Bacteria 2269
601 Ga0496114_0782441 3300048917 Bacteria 832
602 Ga0496116_0031289 3300048919 Bacteria 3813
603 Ga0496117_0091489 3300048920 Bacteria 1956
604 Ga0496117_0104753 3300048920 Bacteria 1779
605 Ga0496117_0323975 3300048920 Bacteria 806
606 Ga0496118_0009792 3300048921 Bacteria 9607
607 Ga0496118_0057847 3300048921 Bacteria 2902
608 Ga0496119_0050596 3300048922 Bacteria 2560
609 Ga0496121_0026608 3300048924 Bacteria 5442
610 Ga0496121_0075961 3300048924 Bacteria 2681
611 Ga0496121_0095100 3300048924 Bacteria 2316
612 Ga0496121_0278411 3300048924 Bacteria 1146
613 Ga0496122_0000063 3300048925 Bacteria 241378
614 Ga0496122_0036508 3300048925 Bacteria 3972
615 Ga0496122_0271500 3300048925 Bacteria 934
616 Ga0496123_0000045 3300048926 Bacteria 249294
617 Ga0496123_0066793 3300048926 Bacteria 2276
618 Ga0496123_0274693 3300048926 Bacteria 818
619 Ga0496124_0025846 3300048927 Bacteria 5307
620 Ga0496124_0027532 3300048927 Bacteria 5101
621 Ga0496124_0052717 3300048927 Bacteria 3454
622 Ga0496125_0015804 3300048928 Bacteria 7274
623 Ga0496125_0018589 3300048928 Bacteria 6597
624 Ga0496125_0026445 3300048928 Bacteria 5288
625 Ga0496125_0034979 3300048928 Bacteria 4418
626 Ga0496125_0045967 3300048928 Bacteria 3668
627 Ga0496126_0086721 3300048929 Bacteria 2759
628 Ga0501034_0513293 3300049571 Bacteria 1111
629 Ga0501034_0580692 3300049571 Bacteria 1028
630 Ga0501249_031273 3300049679 Bacteria 1187
631 Ga0501262_000532 3300049759 Bacteria 4534
632 Ga0501266_000189 3300049763 Bacteria 7863
633 Ga0501268_016851 3300049765 Bacteria 1214
634 Ga0501226_012713 3300049853 Bacteria 932
635 nmdc:mga03683_114549_c1 3300050489 Bacteria 1195
636 nmdc:mga03683_147316_c1 3300050489 Bacteria 1061
637 nmdc:mga03683_47967_c1 3300050489 Bacteria 1774
638 nmdc:mga03683_68271_c1 3300050489 Bacteria 1515
639 nmdc:mga03n38_411859_c1 3300050490 Bacteria 746
640 nmdc:mga03n38_462996_c1 3300050490 Bacteria 707
641 nmdc:mga03n38_75513_c1 3300050490 Bacteria 1570
642 nmdc:mga0yw44_150201_c1 3300050492 Bacteria 1519
643 nmdc:mga0yw44_39841_c1 3300050492 Bacteria 2788
644 nmdc:mga0yw44_755255_c1 3300050492 Bacteria 661
645 nmdc:mga0k408_11179_c1 3300050493 Bacteria 4880
646 nmdc:mga0k408_14507_c1 3300050493 Bacteria 4344
647 nmdc:mga0k408_19690_c1 3300050493 Bacteria 3774
648 nmdc:mga0k408_250955_c1 3300050493 Bacteria 1056
649 nmdc:mga0k408_275230_c1 3300050493 Bacteria 1005
650 nmdc:mga0k408_299329_c1 3300050493 Bacteria 960
651 nmdc:mga06z11_254454_c1 3300050494 Bacteria 1035
652 nmdc:mga06z11_395256_c1 3300050494 Bacteria 832
653 nmdc:mga04h51_137435_c1 3300050495 Bacteria 924
654 nmdc:mga07m45_207634_c1 3300050496 Bacteria 1139
655 nmdc:mga07m45_2078_c1 3300050496 Bacteria 9300
656 nmdc:mga07m45_23737_c1 3300050496 Bacteria 3355
657 nmdc:mga07m45_246781_c1 3300050496 Bacteria 1039
658 nmdc:mga07m45_4305_c1 3300050496 Bacteria 6966
659 nmdc:mga07m45_82066_c1 3300050496 Bacteria 1841
660 nmdc:mga07m45_9105_c1 3300050496 Bacteria 5129
661 nmdc:mga0sz30_141582_c1 3300050516 Bacteria 1062
662 Ga0500610_0003003 3300053079 Bacteria 6366
663 Ga0500610_0004823 3300053079 Bacteria 5429
664 Ga0500643_011596 3300053087 Bacteria 3204
665 Ga0500644_0036663 3300053088 Bacteria 1597
666 Ga0500644_0095159 3300053088 Bacteria 1122
667 Ga0500583_0043952 3300053092 Bacteria 2043
668 Ga0500651_0000125 3300053093 Bacteria 47146
669 Ga0500651_0019235 3300053093 Bacteria 4240
670 Ga0500566_0168782 3300053094 Bacteria 1133
671 Ga0500560_123386 3300053107 Bacteria 869
672 Ga0500569_104439 3300053109 Bacteria 931
673 Ga0500571_000811 3300053110 Bacteria 13403
674 Ga0500593_003399 3300053117 Bacteria 6008
675 Ga0500593_004926 3300053117 Bacteria 5214
676 Ga0500594_0013942 3300053118 Bacteria 1918
677 Ga0500595_105110 3300053119 Bacteria 806
678 Ga0500597_118750 3300053120 Bacteria 1146
679 Ga0500607_004599 3300053121 Bacteria 9423
680 Ga0500607_007247 3300053121 Bacteria 6879
681 Ga0500608_010325 3300053122 Bacteria 4004
682 Ga0500608_089376 3300053122 Bacteria 1442
683 Ga0500608_114052 3300053122 Bacteria 1235
684 Ga0500614_089979 3300053123 Bacteria 871
685 Ga0500618_018192 3300053125 Bacteria 1740
686 Ga0500621_043200 3300053126 Bacteria 1821
687 Ga0500626_015711 3300053128 Bacteria 3303
688 Ga0500628_018756 3300053129 Bacteria 1368
689 Ga0500655_002019 3300053133 Bacteria 3775
690 Ga0500658_0001125 3300053134 Bacteria 10937
691 Ga0500658_0002341 3300053134 Bacteria 7344
692 Ga0500559_0000119 3300053136 Bacteria 62358
693 Ga0500559_0012473 3300053136 Bacteria 3611
694 Ga0500559_0261687 3300053136 Bacteria 814
695 Ga0500561_0080760 3300053137 Bacteria 947
696 Ga0500564_220229 3300053138 Bacteria 768
697 Ga0500568_0002512 3300053139 Bacteria 10731
698 Ga0500573_0190617 3300053140 Bacteria 1095
699 Ga0500574_056806 3300053141 Bacteria 1129
700 Ga0500616_0124057 3300053153 Bacteria 1229
701 Ga0500622_0004359 3300053156 Bacteria 8936
702 Ga0500627_0001087 3300053158 Bacteria 7417
703 Ga0500634_0015330 3300053161 Bacteria 4068
704 Ga0500636_0253279 3300053177 Bacteria 896
705 Ga0500625_058487 3300053729 Bacteria 1758
706 Ga0500645_000687 3300053730 Bacteria 21134
707 Ga0500645_003664 3300053730 Bacteria 6139
708 Ga0500587_016786 3300053739 Bacteria 936
709 Ga0500661_000976 3300055283 Bacteria 5359
710 2511244359 2511231002 Bacteria 5042903
711 2513227686 2513020051 Bacteria 6053213
712 2548497953 2547132374 Bacteria 5530232
713 2599625617 2599185214 Bacteria 8209958
714 2599673630 2599185226 Bacteria 8233575
715 2599683300 2599185227 Bacteria 8246414
716 2599695212 2599185229 Bacteria 8216126
717 2643868649 2643221570 Bacteria 5103772
718 2643991023 2643221596 Bacteria 5006805
719 2644058816 2643221609 Bacteria 6756331
720 2644071059 2643221611 Bacteria 6820941
721 2644162294 2643221628 Bacteria 5745828
722 2644295838 2643221652 Bacteria 5140275
723 2644324455 2643221658 Bacteria 6064537
724 2644396296 2643221672 Bacteria 6322190
725 2644464662 2643221683 Bacteria 5749203
726 2644649579 2643221717 Bacteria 5676132
727 2738719203 2738541277 Bacteria 7458140
728 2738880224 2738541307 Bacteria 8606193
729 2739245174 2738543012 Bacteria 7115078
730 2739248077 2738543013 Bacteria 5618633
731 2739281965 2738543019 Bacteria 7459457
732 2816471524 2816332133 Bacteria 7249298
733 2819599704 2818991446 Bacteria 7757362
734 2831271763 2831265667 Bacteria 7184833
735 2838055612 2838054893 Bacteria 7451788
736 2842682661 2842677519 Bacteria 5615038
737 2842734236 2842733646 Bacteria 5716726
738 2842749507 2842747753 Bacteria 5578255
739 2881102976 2881101125 Bacteria 4590519
740 2885194775 2885192300 Bacteria 5882526
741 2885200854 2885198086 Bacteria 7212419
742 2885214363 2885211737 Bacteria 7212420
743 2894024665 2894023352 Bacteria 5167372
744 2899927663 2899924645 Bacteria 7487985
745 2904450635 2904449895 Bacteria 6927402
746 2904459865 2904456579 Bacteria 6819253
747 2904479593 2904479285 Bacteria 5073931
748 2904549832 2904541872 Bacteria 8915136
749 2919462836 2919462493 Bacteria 5817112
750 2928042060 2928037797 Bacteria 7273642
751 2928049624 2928044640 Bacteria 7271509
752 2928051702 2928051484 Bacteria 7773759
753 2928065607 2928064002 Bacteria 7419480
754 2928073074 2928070936 Bacteria 8062541
755 2928086861 2928084124 Bacteria 7159212
756 2928117604 2928115317 Bacteria 6477646
757 2929161802 2929160207 Bacteria 9075316
758 2929521352 2929520902 Bacteria 6765052
759 2939635380 2939631187 Bacteria 6118131
760 2945913802 2945909444 Bacteria 7065066
761 2945949365 2945945610 Bacteria 5951079
762 2945973410 2945972063 Bacteria 6086495
763 2945990799 2945984333 Bacteria 7358892
764 2954770988 2954767861 Bacteria 5535784
765 2990711452 2990710928 Bacteria 5002431
766 nmdc:mga0sz30_319121_c1
767 JGI24740J21852_10030281
768 JGI24740J21852_10070441
769 JGI25155J39150_1000223
770 JGI25156J39149_1000045
771 JGI25156J39149_1010399
772 JGI25154J39366_1000064
773 JGI25158J39367_1008558
774 JGI25157J39369_1000063
775 JGI25152J39213_1009477
776 JGI25152J39213_1009835
777 JGI25152J39213_1015472
778 JGI25150J39212_1002850
779 JGI25150J39212_1003825
780 JGI25150J39212_1003925
781 JGI25150J39212_1014919
782 JGI25159J45721_1000798
783 JGI25159J45721_1010548
784 JGI25159J45721_1013766
785 JGI25159J45721_1023019
786 JGI25151J46595_10003268
787 JGI25151J46595_10005204
788 JGI25151J46595_10005490
789 JGI25151J46595_10008408
790 JGI25151J46595_10024951
791 JGI25151J46595_10026989
792 JGI25151J46595_10090142
793 JGI25151J46595_10090161
794 JGI25153J46596_10022631
795 JGI25153J46596_10028099
796 rootH1_10036541
797 JGI25160J50197_1000316
798 JGI25160J50197_1016807
799 JGI25160J50197_1022936
800 JGI25161J50226_1000236
801 JGI25161J50226_1005307
802 JGI25161J50226_1009924
803 Ga0006562J51391_1018602
804 Ga0006562J51391_1018603
805 Ga0006562J51391_1039299
806 Ga0055535_1000142
807 Ga0055542_1000022
808 Ga0055526_1001281
809 Ga0055526_1002710
810 Ga0055526_1020540
811 Ga0055526_1021182
812 Ga0055537_1000134
813 Ga0055537_1000634
814 Ga0055537_1008722
815 Ga0055524_1000114
816 Ga0055524_1019201
817 Ga0055524_1019969
818 Ga0055536_1000705
819 Ga0055536_1004046
820 Ga0055536_1008356
821 Ga0055536_1019549
822 Ga0055536_1041306
823 Ga0055534_1000088
824 Ga0055534_1002639
825 Ga0055534_1003059
826 Ga0055534_1008700
827 Ga0055528_1000135
828 Ga0055528_1000630
829 Ga0055528_1011813
830 Ga0055528_1018929
831 Ga0055530_10000473
832 Ga0055530_10000962
833 Ga0055530_10043050
834 Ga0055530_10044570
835 Ga0055540_1000153
836 Ga0055540_1000730
837 Ga0055540_1003446
838 Ga0055540_1008455
839 Ga0055540_1023232
840 Ga0055531_10002924
841 Ga0055531_10007733
842 Ga0055531_10023771
843 Ga0055531_10029872
844 Ga0055531_10048699
845 Ga0055543_1000605
846 Ga0055543_1007952
847 Ga0065165_1020642
848 Ga0065165_1025030
849 Ga0065165_1025184
850 Ga0065165_1029492
851 Ga0065165_1031225
852 Ga0065165_1050881
853 Ga0065165_1084473
854 Ga0065714_10004149
855 Ga0065714_10143273
856 Ga0065704_10113056
857 Ga0070658_10397971
858 Ga0070658_10726101
859 Ga0068869_100223657
860 Ga0070666_10212173
861 Ga0068868_100097533
862 Ga0070661_100001209
863 Ga0070669_100532246
864 Ga0070669_100823185
865 Ga0070674_100032006
866 Ga0070673_100222023
867 Ga0070688_100213909
868 Ga0070659_100005054
869 Ga0070667_100028787
870 Ga0070667_100052972
871 Ga0070678_100027689
872 Ga0070678_100038770
873 Ga0070678_100217469
874 Ga0070678_100226206
875 Ga0070678_100889913
876 Ga0070662_100028288
877 Ga0070662_100484005
878 Ga0070706_100324736
879 Ga0070707_100136640
880 Ga0070679_100102866
881 Ga0068853_100011565
882 Ga0070665_100024888
883 Ga0070665_100068370
884 Ga0070665_100266655
885 Ga0068855_100144470
886 Ga0070664_100018592
887 Ga0070664_100112954
888 Ga0068857_100042395
889 Ga0068854_100127781
890 Ga0068856_100939010
891 Ga0070702_100780329
892 Ga0068852_100224588
893 Ga0068851_10033206
894 Ga0068863_100279554
895 Ga0075365_10158975
896 Ga0075363_100024393
897 Ga0075363_100247420
898 Ga0075364_10272887
899 Ga0075432_10017603
900 Ga0075362_10013049
901 Ga0075362_10026340
902 Ga0075362_10034297
903 Ga0075362_10067001
904 Ga0075362_10071724
905 Ga0075362_10153702
906 Ga0075367_10242048
907 Ga0075367_10642940
908 Ga0075369_10126380
909 Ga0075369_10150909
910 Ga0075366_10005247
911 Ga0075366_10026719
912 Ga0075366_10136314
913 Ga0075366_10163703
914 Ga0075366_10262860
915 Ga0075366_10272578
916 Ga0097621_100065798
917 Ga0097621_100387128
918 Ga0097621_100671876
919 Ga0075370_10002395
920 Ga0075370_10004349
921 Ga0075370_10026838
922 Ga0075370_10058172
923 Ga0075370_10117798
924 Ga0075370_10168276
925 Ga0075370_10428739
926 Ga0075370_10565707
927 Ga0075370_10642398
928 Ga0068871_100083605
929 Ga0068865_100100582
930 Ga0075436_100210527
931 Ga0099826_10001370
932 Ga0105244_10012570
933 Ga0105244_10108715
934 Ga0105240_10126866
935 Ga0105245_10441714
936 Ga0105245_10702953
937 Ga0105245_11475186
938 Ga0105243_10006758
939 Ga0105243_10009873
940 Ga0105243_10303192
941 Ga0105241_10243307
942 Ga0105242_11114671
943 Ga0105237_10029245
944 Ga0105238_10064300
945 Ga0105238_10261834
946 Ga0105249_11723208
947 Ga0105239_10349276
948 Ga0105246_10053898
949 Ga0157320_1017629
950 Ga0157347_1013284
951 Ga0157326_1000472
952 Ga0157373_10016632
953 Ga0157373_10092360
954 Ga0157373_10110847
955 Ga0157370_10039005
956 Ga0157370_10172185
957 Ga0157374_11960993
958 Ga0157378_10024673
959 Ga0163162_10027211
960 Ga0163162_10238220
961 Ga0157375_10066886
962 Ga0157375_11443627
963 Ga0182008_10000215
964 Ga0182008_10002427
965 Ga0182008_10006865
966 Ga0182008_10011104
967 Ga0182008_10016496
968 Ga0182008_10063964
969 Ga0157376_10218149
970 Ga0182006_1001570
971 Ga0182006_1226165
972 Ga0182007_10001908
973 Ga0182007_10003300
974 Ga0182007_10092164
975 Ga0183362_10005
976 Ga0163161_10004047
977 Ga0163161_10020171
978 Ga0163161_10044139
979 Ga0163161_10117515
980 Ga0213872_10011488
981 Ga0209435_100003
982 Ga0209436_103153
983 Ga0209436_105965
984 Ga0209436_111580
985 Ga0209672_101007
986 Ga0209147_103626
987 Ga0209258_100009
988 Ga0207425_1001790
989 Ga0207425_1003665
990 Ga0207425_1010227
991 Ga0207425_1018704
992 Ga0209646_1000008
993 Ga0209026_1000007
994 Ga0209148_1000007
995 Ga0209759_1000019
996 Ga0209129_1000024
997 Ga0209129_1000085
998 Ga0209129_1003741
999 Ga0209129_1005702
1000 Ga0209129_1020873
1001 Ga0209129_1034832
1002 Ga0209565_1000043
1003 Ga0209565_1000046
1004 Ga0209565_1001626
1005 Ga0209565_1005766
1006 Ga0209565_1010497
1007 Ga0209673_1000008
1008 Ga0209673_1000058
1009 Ga0209673_1010330
1010 Ga0209673_1010835
1011 Ga0209673_1032272
1012 Ga0209673_1032359
1013 Ga0209130_1000181
1014 Ga0209130_1000481
1015 Ga0209130_1002262
1016 Ga0209130_1003501
1017 Ga0209130_1027946
1018 Ga0209130_1039276
1019 Ga0209675_1000010
1020 Ga0209675_1000136
1021 Ga0209675_1003141
1022 Ga0209675_1005746
1023 Ga0209675_1005766
1024 Ga0209675_1014407
1025 Ga0209675_1015001
1026 Ga0209676_1000023
1027 Ga0209676_1000028
1028 Ga0209676_1000098
1029 Ga0209676_1000173
1030 Ga0209676_1000194
1031 Ga0209676_1006015
1032 Ga0209676_1006331
1033 Ga0209676_1015360
1034 Ga0209676_1077698
1035 Ga0209025_1000122
1036 Ga0209025_1000404
1037 Ga0209025_1002394
1038 Ga0209025_1009104
1039 Ga0209025_1016764
1040 Ga0209025_1019136
1041 Ga0209025_1020502
1042 Ga0209025_1041131
1043 Ga0209025_1047888
1044 Ga0209025_1067826
1045 Ga0209025_1068034
1046 Ga0209025_1070815
1047 Ga0209564_1000183
1048 Ga0209564_1000198
1049 Ga0209564_1000279
1050 Ga0209564_1000478
1051 Ga0209564_1008404
1052 Ga0209758_1000049
1053 Ga0209758_1022895
1054 Ga0209758_1058085
1055 Ga0209758_1062437
1056 Ga0209050_1000002
1057 Ga0209050_1000022
1058 Ga0209050_1000122
1059 Ga0209050_1000554
1060 Ga0209050_1005757
1061 Ga0209050_1007635
1062 Ga0209050_1015969
1063 Ga0209050_1040978
1064 Ga0209050_1059928
1065 Ga0209256_1000001
1066 Ga0209256_1000098
1067 Ga0209256_1000140
1068 Ga0207426_1000038
1069 Ga0207426_1000053
1070 Ga0207426_1000117
1071 Ga0207426_1020862
1072 Ga0207426_1104810
1073 Ga0209051_1000013
1074 Ga0209051_1000015
1075 Ga0209051_1000159
1076 Ga0209051_1000194
1077 Ga0209051_1000282
1078 Ga0209051_1000597
1079 Ga0209051_1014777
1080 Ga0209257_1000002
1081 Ga0209257_1000042
1082 Ga0209257_1004288
1083 Ga0209257_1010273
1084 Ga0209257_1020820
1085 Ga0207697_10010983
1086 Ga0207656_10010157
1087 Ga0207655_1002288
1088 Ga0207682_10002990
1089 Ga0207642_10764117
1090 Ga0207688_10042052
1091 Ga0207688_10504478
1092 Ga0207680_10124114
1093 Ga0207643_10062819
1094 Ga0207705_10324413
1095 Ga0207654_10185859
1096 Ga0207707_10308383
1097 Ga0207671_10133849
1098 Ga0207671_10295761
1099 Ga0207671_10377306
1100 Ga0207662_10228691
1101 Ga0207657_10043944
1102 Ga0207657_10180680
1103 Ga0207657_10197245
1104 Ga0207649_10001378
1105 Ga0207652_10214327
1106 Ga0207681_10063129
1107 Ga0207681_10186908
1108 Ga0207681_10425734
1109 Ga0207650_10001149
1110 Ga0207687_10376259
1111 Ga0207687_10487568
1112 Ga0207687_10837996
1113 Ga0207644_10001362
1114 Ga0207690_10159378
1115 Ga0207690_10721768
1116 Ga0207706_10025112
1117 Ga0207706_10349535
1118 Ga0207686_10795342
1119 Ga0207709_10000285
1120 Ga0207709_10004960
1121 Ga0207669_10005292
1122 Ga0207704_10072751
1123 Ga0207689_10131776
1124 Ga0207689_10382753
1125 Ga0207679_10000249
1126 Ga0207679_10093359
1127 Ga0207667_10272100
1128 Ga0207651_10001278
1129 Ga0207640_10069120
1130 Ga0207677_10003562
1131 Ga0207677_10289493
1132 Ga0207703_10197808
1133 Ga0207639_10010174
1134 Ga0207641_10094723
1135 Ga0207641_10889218
1136 Ga0207648_10048712
1137 Ga0207676_10046020
1138 Ga0207674_10059455
1139 Ga0207674_10560732
1140 Ga0207674_10579827
1141 Ga0207674_10598378
1142 Ga0207683_10040254
1143 Ga0207683_10176551
1144 Ga0207683_10187549
1145 Ga0207683_10208821
1146 Ga0207683_10838453
1147 Ga0207698_10202836
1148 Ga0209995_1015707
1149 Ga0209282_1001079
1150 Ga0209971_1004611
1151 Ga0209974_10028969
1152 Ga0207428_10590739
1153 Ga0268266_10026117
1154 Ga0268266_10238118
1155 Ga0307517_10010725
1156 Ga0307515_10012653
1157 Ga0307515_10029938
1158 Ga0307515_10184906
1159 Ga0307515_10373200
1160 Ga0307512_10058292
1161 Ga0316177_1112288
1162 Ga0316177_1125363
1163 Ga0314311_1160343
1164 Ga0316178_1142965
1165 Ga0316183_1076813
1166 Ga0316183_1082821
1167 Ga0316181_1034408
1168 Ga0316182_1014668
1169 Ga0316182_1250129
1170 Ga0265330_10000014
1171 Ga0265332_10000011
1172 Ga0265332_10000035
1173 Ga0265325_10003832
1174 Ga0265327_10005786
1175 Ga0265327_10013542
1176 Ga0307513_10000020
1177 Ga0307513_10085785
1178 Ga0307513_10257508
1179 Ga0307509_10006670
1180 Ga0307509_10027095
1181 Ga0307509_10056928
1182 Ga0307509_10141405
1183 Ga0307408_100002073
1184 Ga0307408_100005387
1185 Ga0307408_100034033
1186 Ga0307408_100147544
1187 Ga0307408_100192946
1188 Ga0307408_100333476
1189 Ga0307408_100370267
1190 Ga0307408_100429414
1191 Ga0307408_100475960
1192 Ga0307408_100642828
1193 Ga0307508_10053638
1194 Ga0307514_10072288
1195 Ga0307514_10384060
1196 Ga0265314_10000026
1197 Ga0307516_10000311
1198 Ga0307516_10217770
1199 Ga0307405_10031768
1200 Ga0307405_10056743
1201 Ga0307405_10301009
1202 Ga0307406_10001422
1203 Ga0307406_10005238
1204 Ga0307406_10028541
1205 Ga0307406_10052872
1206 Ga0307406_10752138
1207 Ga0307412_10033751
1208 Ga0307412_10075260
1209 Ga0307412_10097644
1210 Ga0307412_10107572
1211 Ga0307412_10120119
1212 Ga0307412_10338868
1213 Ga0307412_10366791
1214 Ga0307412_10544039
1215 Ga0307412_10630421
1216 Ga0307409_100007440
1217 Ga0307416_100035298
1218 Ga0307416_100175226
1219 Ga0307416_100986728
1220 Ga0307414_10062189
1221 Ga0307414_10237145
1222 Ga0307411_10237172
1223 Ga0307411_10669359
1224 Ga0307415_100071636
1225 Ga0307415_101090819
1226 Ga0307507_10213669
1227 Ga0307507_10219951
1228 Ga0307510_10003147
1229 Ga0307510_10022531
1230 Ga0307510_10060349
1231 Ga0373932_0129161
1232 Ga0373939_0244479
1233 Ga0373962_0097594
1234 Ga0373931_0030402
1235 Ga0373925_0280968
1236 Ga0436361_0327114
1237 Ga0436361_0443915
1238 Ga0439436_0000382
1239 Ga0439436_0004185
1240 Ga0439439_0028565
1241 Ga0439447_026574
1242 Ga0439461_0026457
1243 Ga0439466_0001231
1244 Ga0439466_0028602
1245 Ga0439465_0001246
1246 Ga0439465_0070058
1247 Ga0439465_0278196
1248 Ga0451791_1627931
1249 Ga0451795_0255321
1250 Ga0451798_0795614
1251 Ga0451853_2985823
1252 Ga0439431_0002744
1253 Ga0439433_0003905
1254 Ga0439433_0005989
1255 Ga0439442_002538
1256 Ga0439442_002770
1257 Ga0439445_0000223
1258 Ga0439445_0011709
1259 Ga0439445_0177880
1260 Ga0439432_001997
1261 Ga0439432_002220
1262 Ga0439432_014455
1263 Ga0439432_082056
1264 Ga0439449_0000209
1265 Ga0439449_0000215
1266 Ga0439449_0002802
1267 Ga0439449_0004098
1268 Ga0439449_0021863
1269 Ga0439452_003966
1270 Ga0439452_063493
1271 Ga0439457_003046
1272 Ga0439457_056564
1273 Ga0439462_0009717
1274 Ga0439462_0117488
1275 Ga0450911_000823
1276 Ga0450912_001174
1277 Ga0450923_005020
1278 Ga0450907_005113
1279 Ga0450908_000697
1280 Ga0450908_027597
1281 Ga0450909_029739
1282 Ga0439434_0001906
1283 Ga0450893_0003142
1284 Ga0453684_0206707
1285 Ga0466960_0101941
1286 Ga0466959_0000733
1287 Ga0451576_0335672
1288 Ga0451576_1263050
1289 Ga0495627_019753
1290 Ga0495592_0012833
1291 Ga0495629_0676626
1292 Ga0495651_0484538
1293 Ga0495651_0493154
1294 Ga0495639_0007320
1295 Ga0495610_0148848
1296 Ga0495610_0191142
1297 Ga0495610_0212230
1298 Ga0495616_0003860
1299 Ga0495620_0004751
1300 Ga0495620_0098102
1301 Ga0495628_0606781
1302 Ga0495630_0144677
1303 Ga0495631_0011741
1304 Ga0495632_0221853
1305 Ga0495637_0001872
1306 Ga0495637_0042227
1307 Ga0495648_0154014
1308 Ga0495648_0246754
1309 Ga0495648_0304102
1310 Ga0495642_0128795
1311 Ga0495642_0336927
1312 Ga0495654_0127923
1313 Ga0495654_0146429
1314 Ga0495586_0198927
1315 Ga0495587_0636758
1316 Ga0495598_0163049
1317 Ga0495621_0003571
1318 Ga0495633_0161198
1319 Ga0495667_0465036
1320 Ga0495656_0000087
1321 Ga0495625_0000245
1322 Ga0495625_0079548
1323 Ga0495625_0202528
1324 Ga0495625_0226225
1325 Ga0495625_0450337
1326 Ga0495635_0251013
1327 Ga0495588_0007799
1328 Ga0495588_0083355
1329 Ga0495588_0162325
1330 Ga0495599_0123305
1331 Ga0495613_0202211
1332 Ga0495613_0292588
1333 Ga0495624_0425370
1334 Ga0495600_0349808
1335 Ga0495660_0137417
1336 Ga0495604_0254205
1337 Ga0495676_0035774
1338 Ga0495676_0054670
1339 Ga0495593_0033452
1340 Ga0495602_0835497
1341 Ga0495614_0040393
1342 Ga0495614_0155981
1343 Ga0495614_0361493
1344 Ga0495615_0067105
1345 Ga0495615_0075561
1346 Ga0496101_0006112
1347 Ga0496101_0034301
1348 Ga0496102_0024751
1349 Ga0496102_0557464
1350 Ga0496102_1080396
1351 Ga0496103_0014373
1352 Ga0496104_0005753
1353 Ga0496104_0023014
1354 Ga0496104_0338251
1355 Ga0496105_0166483
1356 Ga0496105_0217888
1357 Ga0496107_0129413
1358 Ga0496108_0304054
1359 Ga0496109_0429837
1360 Ga0496109_0945999
1361 Ga0496110_0101414
1362 Ga0496110_0186143
1363 Ga0496111_0163859
1364 Ga0496112_0376609
1365 Ga0496114_0119099
1366 Ga0496114_0782441
1367 Ga0496116_0031289
1368 Ga0496117_0091489
1369 Ga0496117_0104753
1370 Ga0496117_0323975
1371 Ga0496118_0009792
1372 Ga0496118_0057847
1373 Ga0496119_0050596
1374 Ga0496121_0026608
1375 Ga0496121_0075961
1376 Ga0496121_0095100
1377 Ga0496121_0278411
1378 Ga0496122_0000063
1379 Ga0496122_0036508
1380 Ga0496122_0271500
1381 Ga0496123_0000045
1382 Ga0496123_0066793
1383 Ga0496123_0274693
1384 Ga0496124_0025846
1385 Ga0496124_0027532
1386 Ga0496124_0052717
1387 Ga0496125_0015804
1388 Ga0496125_0018589
1389 Ga0496125_0026445
1390 Ga0496125_0034979
1391 Ga0496125_0045967
1392 Ga0496126_0086721
1393 Ga0501034_0513293
1394 Ga0501034_0580692
1395 Ga0501249_031273
1396 Ga0501262_000532
1397 Ga0501266_000189
1398 Ga0501268_016851
1399 Ga0501226_012713
1400 nmdc:mga03683_114549_c1
1401 nmdc:mga03683_147316_c1
1402 nmdc:mga03683_47967_c1
1403 nmdc:mga03683_68271_c1
1404 nmdc:mga03n38_411859_c1
1405 nmdc:mga03n38_462996_c1
1406 nmdc:mga03n38_75513_c1
1407 nmdc:mga0yw44_150201_c1
1408 nmdc:mga0yw44_39841_c1
1409 nmdc:mga0yw44_755255_c1
1410 nmdc:mga0k408_11179_c1
1411 nmdc:mga0k408_14507_c1
1412 nmdc:mga0k408_19690_c1
1413 nmdc:mga0k408_250955_c1
1414 nmdc:mga0k408_275230_c1
1415 nmdc:mga0k408_299329_c1
1416 nmdc:mga06z11_254454_c1
1417 nmdc:mga06z11_395256_c1
1418 nmdc:mga04h51_137435_c1
1419 nmdc:mga07m45_207634_c1
1420 nmdc:mga07m45_2078_c1
1421 nmdc:mga07m45_23737_c1
1422 nmdc:mga07m45_246781_c1
1423 nmdc:mga07m45_4305_c1
1424 nmdc:mga07m45_82066_c1
1425 nmdc:mga07m45_9105_c1
1426 nmdc:mga0sz30_141582_c1
1427 Ga0500610_0003003
1428 Ga0500610_0004823
1429 Ga0500643_011596
1430 Ga0500644_0036663
1431 Ga0500644_0095159
1432 Ga0500583_0043952
1433 Ga0500651_0000125
1434 Ga0500651_0019235
1435 Ga0500566_0168782
1436 Ga0500560_123386
1437 Ga0500569_104439
1438 Ga0500571_000811
1439 Ga0500593_003399
1440 Ga0500593_004926
1441 Ga0500594_0013942
1442 Ga0500595_105110
1443 Ga0500597_118750
1444 Ga0500607_004599
1445 Ga0500607_007247
1446 Ga0500608_010325
1447 Ga0500608_089376
1448 Ga0500608_114052
1449 Ga0500614_089979
1450 Ga0500618_018192
1451 Ga0500621_043200
1452 Ga0500626_015711
1453 Ga0500628_018756
1454 Ga0500655_002019
1455 Ga0500658_0001125
1456 Ga0500658_0002341
1457 Ga0500559_0000119
1458 Ga0500559_0012473
1459 Ga0500559_0261687
1460 Ga0500561_0080760
1461 Ga0500564_220229
1462 Ga0500568_0002512
1463 Ga0500573_0190617
1464 Ga0500574_056806
1465 Ga0500616_0124057
1466 Ga0500622_0004359
1467 Ga0500627_0001087
1468 Ga0500634_0015330
1469 Ga0500636_0253279
1470 Ga0500625_058487
1471 Ga0500645_000687
1472 Ga0500645_003664
1473 Ga0500587_016786
1474 Ga0500661_000976
1475 2511244359
1476 2513227686
1477 2548497953
1478 2599625617
1479 2599673630
1480 2599683300
1481 2599695212
1482 2643868649
1483 2643991023
1484 2644058816
1485 2644071059
1486 2644162294
1487 2644295838
1488 2644324455
1489 2644396296
1490 2644464662
1491 2644649579
1492 2738719203
1493 2738880224
1494 2739245174
1495 2739248077
1496 2739281965
1497 2816471524
1498 2819599704
1499 2831271763
1500 2838055612
1501 2842682661
1502 2842734236
1503 2842749507
1504 2881102976
1505 2885194775
1506 2885200854
1507 2885214363
1508 2894024665
1509 2899927663
1510 2904450635
1511 2904459865
1512 2904479593
1513 2904549832
1514 2919462836
1515 2928042060
1516 2928049624
1517 2928051702
1518 2928065607
1519 2928073074
1520 2928086861
1521 2928117604
1522 2929161802
1523 2929521352
1524 2939635380
1525 2945913802
1526 2945949365
1527 2945973410
1528 2945990799
1529 2954770988
1530 2990711452

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14803

Nudix_N_2

Nudix N-terminal

22

57

0.92

PF00293

NUDIX

NUDIX domain

58

176

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1r67-assembly1.cif.gz_A y104a mutant of e.coli ipp isomerase 0.8554 45 143
4v14-assembly2.cif.gz_B structure and function analysis of mutt from the psychrofile fish pathogen aliivibrio salmonicida and the mesophile vibrio cholerae 0.8322 45 144
3h95-assembly1.cif.gz_A-2 crystal structure of the nudix domain of nudt6 0.7956 45 162
8sxs-assembly2.cif.gz_B crystal structure of a nudix hydrolase effector from magnaporthe oryzae 0.7925 41 143
4jzu-assembly1.cif.gz_A crystal structure of the bacillus subtilis pyrophosphohydrolase bsrpph bound to a non-hydrolysable triphosphorylated dinucleotide rna (pcp-pgpg) - first guanosine residue in guanosine binding pocket 0.784 40 139
ID Description Score Start End Superfamily
af_P9WIX5_169_312_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9225 44 141 3.90.79.10
af_Q19427_210_368_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9107 43 141 3.90.79.10
af_P53164_221_376_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8892 44 141 3.90.79.10
af_Q94A82_242_424_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8464 44 141 3.90.79.10
2gb5A02 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8414 41 164 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A2R5EL96-F1-model_v4 Nudix hydrolase domain-containing protein 0.9643 44 162 GO:0016787
AF-A0A3N5FKE5-F1-model_v4 NUDIX hydrolase 0.9635 74 170 GO:0016787
AF-A0A847VK60-F1-model_v4 NUDIX domain-containing protein 0.9527 40 169
AF-A0A3N5FKE5-F1-model_v4 NUDIX hydrolase 0.9263 74 170 GO:0016787
AF-A0A2R5EL96-F1-model_v4 Nudix hydrolase domain-containing protein 0.9051 44 162 GO:0016787

Map