F480052

General Info

Members Datasets Scaffolds Average Seq Length
770 662 294 147

Family's Representative Sequence

Representative Sequence 3300048927|Ga0496124_0129837|Ga0496124_0129837_167_688
Length 157
Sequence LNERNLRERQLVADGQELQSAEYSMENNELSRERLIVPAVAPVYNGTYELVETILRVVAGAVGMVESLGFYPGVFWSPLLAATEFFGGILVAIGLLTRPAAFAAFIVLMVTVYFHWIVKSEGLGGAEKSILWSAIFLFFAVRGGNRHSIDAKLRKVF

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276019 Ensifer aridi TW10 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
8 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
9 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
10 2512875024 Mesorhizobium loti R88b Isolate Nodule
11 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
12 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
13 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
14 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
15 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
16 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
17 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
18 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
19 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
20 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
21 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
22 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
23 2516143018 Ensifer sp. BR816 Isolate Nodule
24 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
25 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
26 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
27 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
28 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
29 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
30 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
31 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
32 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
33 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
34 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
35 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
36 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
37 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
38 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
39 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
40 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
41 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
42 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
43 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
44 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
45 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
46 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
47 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
48 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
49 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
50 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
51 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
52 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
53 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
54 2643221557 Ensifer sp. Root558 Isolate Unclassified
55 2643221568 Rhizobium sp. Root564 Isolate Unclassified
56 2643221582 Rhizobium sp. Root651 Isolate Unclassified
57 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
58 2643221607 Rhizobium sp. Root73 Isolate Unclassified
59 2643221610 Ensifer sp. Root74 Isolate Unclassified
60 2643221618 Ensifer sp. Root231 Isolate Unclassified
61 2643221626 Ensifer sp. Root31 Isolate Unclassified
62 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
63 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
64 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
65 2643221655 Ensifer sp. Root1252 Isolate Unclassified
66 2643221659 Ensifer sp. Root127 Isolate Unclassified
67 2643221668 Ensifer sp. Root423 Isolate Unclassified
68 2643221675 Ensifer sp. Root1298 Isolate Unclassified
69 2643221680 Ensifer sp. Root1312 Isolate Unclassified
70 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
71 2643221688 Rhizobium sp. Root482 Isolate Unclassified
72 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
73 2643221693 Rhizobium sp. Root491 Isolate Unclassified
74 2643221698 Ensifer sp. Root142 Isolate Unclassified
75 2643221712 Ensifer sp. Root258 Isolate Unclassified
76 2643221718 Rhizobium sp. Root268 Isolate Unclassified
77 2643221723 Ensifer sp. Root278 Isolate Unclassified
78 2643221726 Ensifer sp. Root954 Isolate Unclassified
79 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
80 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
81 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
82 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
83 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
84 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
85 2738543024 Aminobacter sp. AP02 Isolate Unclassified
86 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
87 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
88 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
89 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
90 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
91 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
92 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
93 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
94 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
95 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
96 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
97 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
98 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
99 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
100 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
101 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
102 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
103 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
104 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
105 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
106 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
107 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
108 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
109 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
110 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
111 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
112 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
113 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
114 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
115 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
116 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
117 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
118 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
119 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
120 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
121 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
122 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
123 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
124 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
125 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
126 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
127 2844163670 Ensifer sp. 1H6 Isolate Unclassified
128 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
129 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
130 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
131 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
132 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
133 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
134 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
135 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
136 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
137 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
138 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
139 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
140 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
141 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
142 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
143 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
144 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
145 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
146 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
147 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
148 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
149 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
150 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
151 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
152 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
153 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
154 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
155 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
156 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
157 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
158 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
159 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
160 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
161 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
162 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
163 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
164 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
165 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
166 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
167 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
168 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
169 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
170 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
171 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
172 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
173 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
174 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
175 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
176 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
177 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
178 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
179 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
180 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
181 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
182 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
183 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
184 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
185 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
186 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
187 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
188 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
189 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
190 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
191 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
192 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
193 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
194 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
195 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
196 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
197 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
198 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
199 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
200 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
201 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
202 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
203 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
204 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
205 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
206 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
207 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
208 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
209 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
210 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
211 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
212 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
213 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
214 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
215 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
216 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
217 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
218 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
219 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
220 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
221 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
222 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
223 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
224 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
225 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
226 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
227 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
228 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
229 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
230 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
231 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
232 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
233 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
234 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
235 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
236 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
237 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
238 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
239 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
240 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
241 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
242 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
243 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
244 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
245 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
246 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
247 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
248 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
249 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
250 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
251 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
252 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
253 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
254 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
255 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
256 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
257 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
258 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
259 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
260 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
261 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
262 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
263 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
264 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
265 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
266 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
267 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
268 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
269 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
270 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
271 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
272 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
273 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
274 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
275 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
276 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
277 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
278 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
279 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
280 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
281 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
282 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
283 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
284 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
285 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
286 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
287 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
288 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
289 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
290 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
291 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
292 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
293 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
294 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
295 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
296 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
297 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
298 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
299 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
300 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
301 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
302 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
303 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
304 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
305 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
306 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
307 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
308 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
309 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
310 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
311 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
312 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
313 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
314 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
315 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
316 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
317 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
318 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
319 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
320 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
321 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
322 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
323 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
324 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
325 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
326 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
327 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
328 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
329 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
330 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
331 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
332 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
333 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
334 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
335 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
336 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
337 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
338 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
339 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
340 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
341 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
342 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
343 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
344 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
345 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
346 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
347 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
348 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
349 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
350 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
351 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
352 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
353 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
354 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
355 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
356 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
357 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
358 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
359 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
360 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
361 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
362 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
363 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
364 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
365 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
366 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
367 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
368 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
369 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
370 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
371 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
372 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
373 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
374 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
375 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
376 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
377 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
378 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
379 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
380 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
381 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
382 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
383 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
384 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
385 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
386 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
387 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
388 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
389 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
390 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
391 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
392 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
393 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
394 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
395 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
396 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
397 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
398 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
399 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
400 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
401 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
402 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
403 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
404 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
405 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
406 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
407 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
408 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
409 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
410 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
411 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
412 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
413 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
414 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
415 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
416 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
417 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
418 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
419 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
420 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
421 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
422 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
423 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
424 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
425 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
426 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
427 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
428 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
429 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
430 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
431 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
432 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
433 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
434 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
435 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
436 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
437 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
438 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
439 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
440 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
441 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
442 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
443 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
444 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
445 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
446 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
447 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
448 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
449 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
450 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
451 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
452 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
453 3004167301 Mesorhizobium loti 582 Isolate Unclassified
454 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
455 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
456 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
457 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
458 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
459 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
460 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
461 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
462 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
463 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
464 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
465 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
466 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
467 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
468 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
469 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
470 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
471 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
472 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
473 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
474 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
475 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
476 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
477 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
478 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
479 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
480 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
481 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
482 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
483 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
484 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
485 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
486 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
487 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
488 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
489 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
490 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
491 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
492 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
493 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
494 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
495 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
496 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
497 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
498 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
499 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
500 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
501 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
502 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
503 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
504 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
505 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
506 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
507 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
508 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
509 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
510 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
511 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
512 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
513 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
514 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
515 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
516 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
517 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
518 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
519 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
520 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
521 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
522 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
523 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
524 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
525 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
526 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
527 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
528 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
529 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
530 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
531 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
532 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
533 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
534 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
535 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
536 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
537 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
538 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
539 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
540 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
541 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
542 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
543 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
544 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
545 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
546 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
547 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
548 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
549 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
550 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
551 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
552 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
553 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
554 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
555 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
556 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
557 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
558 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
559 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
560 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
561 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
562 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
563 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
564 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
565 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
566 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
567 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
568 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
569 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
570 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
571 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
572 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
573 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
574 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
575 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
576 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
577 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
578 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
579 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
580 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
581 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
582 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
583 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
584 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
585 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
586 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
587 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
588 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
589 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
590 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
591 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
592 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
593 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
594 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
595 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
596 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
597 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
598 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
599 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
600 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
601 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
602 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
603 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
604 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
605 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
606 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
607 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
608 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
609 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
610 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
611 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
612 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
613 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
614 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
615 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
616 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
617 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
618 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
619 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
620 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
621 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
622 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
623 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
624 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
625 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
626 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
627 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
628 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
629 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
630 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
631 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
632 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
633 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
634 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
635 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
636 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
637 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
638 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
639 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
640 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
641 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
642 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
643 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
644 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
645 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
646 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
647 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
648 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
649 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
650 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
651 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
652 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
653 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
654 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
655 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
656 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
657 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
658 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
659 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
660 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
661 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
662 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 38.18
Metatranscriptomes 0
Isolates 61.82

Biome Distribution

Category Percentage (%)
Aerial Root 0.65
Bulb 0
Endosphere 10.78
Nodule 50
Rhizoplane 2.21
Rhizosphere 21.56
Stem 0
Stem Tuber 0
Unclassified 14.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_1494779 2162886012 Bacteria 932
2 JGI24739J22299_10109544 3300001989 Bacteria 829
3 JGI25158J39367_1001021 3300002739 Bacteria 5117
4 JGI25157J39369_1002897 3300002741 Bacteria 3825
5 JGI25159J45721_1000015 3300002987 Bacteria 142431
6 JGI25151J46595_10010501 3300003187 Bacteria 4298
7 JGI25151J46595_10096027 3300003187 Bacteria 811
8 rootH1_10166833 3300003323 Bacteria 1458
9 JGI25160J50197_1000003 3300003354 Bacteria 482719
10 JGI25161J50226_1000802 3300003374 Bacteria 11843
11 Ga0055526_1004230 3300003771 Bacteria 8713
12 Ga0055524_1022448 3300003775 Bacteria 2062
13 Ga0055524_1038180 3300003775 Bacteria 1261
14 Ga0055530_10070988 3300003791 Bacteria 751
15 Ga0055531_10037006 3300003794 Bacteria 1492
16 Ga0058692_1000111 3300003856 Bacteria 53965
17 Ga0058692_1001634 3300003856 Bacteria 8040
18 Ga0058692_1012835 3300003856 Bacteria 1969
19 Ga0055543_1000034 3300004625 Bacteria 128668
20 Ga0065165_1000047 3300005262 Bacteria 197811
21 Ga0065704_10217409 3300005289 Bacteria 1085
22 Ga0070660_100276791 3300005339 Bacteria 1373
23 Ga0070661_100169012 3300005344 Bacteria 1660
24 Ga0070675_100257329 3300005354 Bacteria 1529
25 Ga0070674_101893696 3300005356 Bacteria 542
26 Ga0070659_100206058 3300005366 Bacteria 1620
27 Ga0070663_100048924 3300005455 Bacteria 3000
28 Ga0070663_100308773 3300005455 Bacteria 1268
29 Ga0068853_100022594 3300005539 Bacteria 5255
30 Ga0068853_100228512 3300005539 Bacteria 1701
31 Ga0070665_100022200 3300005548 Bacteria 6385
32 Ga0070665_100029417 3300005548 Bacteria 5529
33 Ga0070665_100748105 3300005548 Bacteria 991
34 Ga0068857_100595660 3300005577 Bacteria 1045
35 Ga0068857_101381004 3300005577 Bacteria 685
36 Ga0068852_100971759 3300005616 Bacteria 867
37 Ga0075365_10005367 3300006038 Bacteria 6908
38 Ga0075365_10031318 3300006038 Bacteria 3411
39 Ga0075365_10054407 3300006038 Bacteria 2654
40 Ga0075365_10913944 3300006038 Bacteria 619
41 Ga0075368_10000802 3300006042 Bacteria 9657
42 Ga0075368_10222088 3300006042 Bacteria 803
43 Ga0075363_100057357 3300006048 Bacteria 2090
44 Ga0075363_100245645 3300006048 Bacteria 1030
45 Ga0075363_100306396 3300006048 Bacteria 922
46 Ga0075364_10050555 3300006051 Bacteria 2713
47 Ga0075364_10076785 3300006051 Bacteria 2204
48 Ga0075364_10116616 3300006051 Bacteria 1785
49 Ga0075364_10123366 3300006051 Bacteria 1735
50 Ga0075364_10218414 3300006051 Bacteria 1293
51 Ga0075364_10652553 3300006051 Bacteria 718
52 Ga0075364_10718839 3300006051 Bacteria 681
53 Ga0075362_10006106 3300006177 Bacteria 4463
54 Ga0075362_10069323 3300006177 Bacteria 1607
55 Ga0075367_10053683 3300006178 Bacteria 2388
56 Ga0075367_10100953 3300006178 Bacteria 1764
57 Ga0075367_10114728 3300006178 Bacteria 1656
58 Ga0075367_10351152 3300006178 Bacteria 931
59 Ga0075369_10030409 3300006186 Bacteria 2274
60 Ga0075369_10158025 3300006186 Bacteria 1038
61 Ga0075370_10013786 3300006353 Bacteria 4300
62 Ga0075370_10242896 3300006353 Bacteria 1066
63 Ga0068865_101536722 3300006881 Bacteria 597
64 Ga0079104_1002726 3300006946 Bacteria 9026
65 Ga0079104_1020023 3300006946 Bacteria 1854
66 Ga0099826_10000075 3300006948 Bacteria 52009
67 Ga0099826_10071547 3300006948 Bacteria 2200
68 Ga0105240_10152353 3300009093 Bacteria 2752
69 Ga0105240_10166244 3300009093 Bacteria 2616
70 Ga0105240_10206277 3300009093 Bacteria 2300
71 Ga0105240_11198611 3300009093 Bacteria 804
72 Ga0105240_11775717 3300009093 Bacteria 643
73 Ga0105240_11824368 3300009093 Bacteria 633
74 Ga0105241_10290854 3300009174 Bacteria 1399
75 Ga0105248_10332186 3300009177 Bacteria 1712
76 Ga0105237_10673325 3300009545 Bacteria 1041
77 Ga0105237_10930219 3300009545 Bacteria 876
78 Ga0105237_10948879 3300009545 Bacteria 867
79 Ga0105238_10114258 3300009551 Bacteria 2679
80 Ga0105238_10694916 3300009551 Bacteria 1029
81 Ga0105239_10045345 3300010375 Bacteria 4818
82 Ga0105239_10797925 3300010375 Bacteria 1082
83 Ga0105239_11382854 3300010375 Bacteria 812
84 Ga0105239_11566819 3300010375 Bacteria 762
85 Ga0105239_12924505 3300010375 Bacteria 557
86 Ga0105246_11357654 3300011119 Bacteria 661
87 Ga0157371_10000004 3300013102 Bacteria 512593
88 Ga0157371_10017302 3300013102 Bacteria 5359
89 Ga0157369_10126002 3300013105 Bacteria 2715
90 Ga0157369_10354399 3300013105 Bacteria 1524
91 Ga0157369_12087964 3300013105 Bacteria 575
92 Ga0157374_10940062 3300013296 Bacteria 883
93 Ga0163162_11634555 3300013306 Bacteria 735
94 Ga0157372_10460646 3300013307 Bacteria 1482
95 Ga0163163_10590763 3300014325 Bacteria 1174
96 Ga0182008_10124576 3300014497 Bacteria 1282
97 Ga0182006_1066219 3300015261 Bacteria 1350
98 Ga0183363_1097 3300015690 Bacteria 24804
99 Ga0163161_10878050 3300017792 Bacteria 758
100 Ga0214544_1000434 3300021320 Bacteria 75507
101 Ga0214542_1002623 3300021321 Bacteria 37091
102 Ga0214543_1000049 3300021327 Bacteria 149506
103 Ga0214543_1000054 3300021327 Bacteria 140288
104 Ga0228711_1000006 3300022739 Bacteria 202437
105 Ga0228710_1000004 3300022740 Bacteria 250560
106 Ga0209436_100306 3300025208 Bacteria 22561
107 Ga0209026_1000050 3300025250 Bacteria 254994
108 Ga0209759_1000229 3300025256 Bacteria 83575
109 Ga0209233_1000034 3300025261 Bacteria 578898
110 Ga0209233_1088967 3300025261 Bacteria 533
111 Ga0209130_1000005 3300025284 Bacteria 599620
112 Ga0209676_1001950 3300025292 Bacteria 16595
113 Ga0209025_1000060 3300025294 Bacteria 305017
114 Ga0209025_1000814 3300025294 Bacteria 50030
115 Ga0209564_1000113 3300025295 Bacteria 211564
116 Ga0209050_1006490 3300025298 Bacteria 6904
117 Ga0209256_1000819 3300025299 Bacteria 39621
118 Ga0209256_1004911 3300025299 Bacteria 8022
119 Ga0207426_1000015 3300025302 Bacteria 599316
120 Ga0209051_1021168 3300025303 Bacteria 2778
121 Ga0207647_10117870 3300025904 Bacteria 1567
122 Ga0207654_10108816 3300025911 Bacteria 1721
123 Ga0207695_10071872 3300025913 Bacteria 3532
124 Ga0207695_10299990 3300025913 Bacteria 1498
125 Ga0207671_10070021 3300025914 Bacteria 2614
126 Ga0207671_10638548 3300025914 Bacteria 848
127 Ga0207657_10054645 3300025919 Bacteria 3452
128 Ga0207649_10568716 3300025920 Bacteria 869
129 Ga0207681_10082883 3300025923 Bacteria 2268
130 Ga0207694_10003257 3300025924 Bacteria 12933
131 Ga0207694_10616184 3300025924 Bacteria 913
132 Ga0207659_10700657 3300025926 Bacteria 867
133 Ga0207709_10428578 3300025935 Bacteria 1018
134 Ga0207640_10656180 3300025981 Bacteria 894
135 Ga0207639_10003680 3300026041 Bacteria 10305
136 Ga0207678_10496028 3300026067 Bacteria 1064
137 Ga0207702_11804693 3300026078 Bacteria 604
138 Ga0207674_10792580 3300026116 Bacteria 914
139 Ga0207674_10856734 3300026116 Bacteria 876
140 Ga0207698_11852430 3300026142 Bacteria 618
141 Ga0209281_1000102 3300027111 Bacteria 221665
142 Ga0209281_1001274 3300027111 Bacteria 16234
143 Ga0209371_1000009 3300027312 Bacteria 963030
144 Ga0209371_1000174 3300027312 Bacteria 96051
145 Ga0209371_1000222 3300027312 Bacteria 75507
146 Ga0209371_1000306 3300027312 Bacteria 54622
147 Ga0209371_1000732 3300027312 Bacteria 27595
148 Ga0209282_1000013 3300027666 Bacteria 215053
149 Ga0209282_1000179 3300027666 Bacteria 34839
150 Ga0209282_1060889 3300027666 Bacteria 2104
151 Ga0209813_10002747 3300027866 Bacteria 4060
152 Ga0268266_10701418 3300028379 Bacteria 975
153 Ga0268265_10741323 3300028380 Bacteria 953
154 Ga0307517_10165955 3300028786 Bacteria 1467
155 Ga0307515_10000029 3300028794 Bacteria 365410
156 Ga0307515_10013457 3300028794 Bacteria 15291
157 Ga0268256_1000010 3300030500 Bacteria 963034
158 Ga0268256_1000028 3300030500 Bacteria 433179
159 Ga0268256_1000751 3300030500 Bacteria 23733
160 Ga0316181_1279897 3300030744 Bacteria 6827
161 Ga0307513_10014973 3300031456 Bacteria 9419
162 Ga0307408_100117646 3300031548 Bacteria 2053
163 Ga0307408_100832514 3300031548 Bacteria 840
164 Ga0307413_11562670 3300031824 Bacteria 585
165 Ga0307410_10763741 3300031852 Bacteria 819
166 Ga0307406_10136004 3300031901 Bacteria 1732
167 Ga0307412_10155501 3300031911 Bacteria 1692
168 Ga0307412_10379736 3300031911 Bacteria 1144
169 Ga0307412_10559512 3300031911 Bacteria 962
170 Ga0315914_1000004 3300031967 Bacteria 288534
171 Ga0307409_100022688 3300031995 Bacteria 4331
172 Ga0307409_100419987 3300031995 Bacteria 1283
173 Ga0307416_100299846 3300032002 Bacteria 1597
174 Ga0307414_11150113 3300032004 Bacteria 718
175 Ga0315913_1000011 3300033430 Bacteria 140532
176 Ga0315915_1000003 3300033464 Bacteria 407996
177 Ga0395899_0000014 3300037312 Bacteria 488813
178 Ga0395900_0000007 3300037418 Bacteria 488860
179 Ga0395900_0276370 3300037418 Bacteria 1673
180 Ga0395900_0949781 3300037418 Bacteria 781
181 Ga0395898_0000011 3300037466 Bacteria 488860
182 Ga0395898_0113118 3300037466 Bacteria 2602
183 Ga0395905_0000008 3300037471 Bacteria 488860
184 Ga0395905_0166850 3300037471 Bacteria 2069
185 Ga0395901_0000020 3300038443 Bacteria 314918
186 Ga0395901_0046061 3300038443 Bacteria 4529
187 Ga0395901_0564536 3300038443 Bacteria 1152
188 Ga0439436_0009599 3300041404 Bacteria 2968
189 Ga0439436_0120008 3300041404 Bacteria 735
190 Ga0439466_0067672 3300041411 Bacteria 1142
191 Ga0439465_0017016 3300041413 Bacteria 2269
192 Ga0451797_1112202 3300041453 Bacteria 772
193 Ga0451802_0931265 3300041460 Bacteria 587
194 Ga0451807_1294930 3300041486 Bacteria 752
195 Ga0451845_0821049 3300041501 Bacteria 558
196 Ga0439431_0077337 3300041997 Unclassified 894
197 Ga0439432_171123 3300042006 Bacteria 634
198 Ga0450900_052197 3300042136 Bacteria 628
199 Ga0466972_0014934 3300044658 Bacteria 3885
200 Ga0466960_0122960 3300044901 Bacteria 1361
201 Ga0495638_0085781 3300046460 Bacteria 1904
202 Ga0495616_0113036 3300046513 Bacteria 1260
203 Ga0495643_0064202 3300046522 Bacteria 1940
204 Ga0495633_0012953 3300046558 Bacteria 4413
205 Ga0495633_0035902 3300046558 Bacteria 2378
206 Ga0495668_0083342 3300046616 Bacteria 1754
207 Ga0495625_0104697 3300046660 Bacteria 1939
208 Ga0495625_0151481 3300046660 Bacteria 1559
209 Ga0495588_0234126 3300046674 Bacteria 969
210 Ga0495588_0288445 3300046674 Bacteria 865
211 Ga0495588_0307155 3300046674 Bacteria 835
212 Ga0495671_0019241 3300046692 Bacteria 3613
213 Ga0495681_0010825 3300047470 Bacteria 5490
214 Ga0495686_0111159 3300047472 Bacteria 1643
215 Ga0496100_1339545 3300048903 Bacteria 565
216 Ga0496102_0983571 3300048905 Bacteria 764
217 Ga0496102_1160830 3300048905 Bacteria 692
218 Ga0496104_0066571 3300048907 Bacteria 3421
219 Ga0496111_0554009 3300048914 Bacteria 844
220 Ga0496112_0109985 3300048915 Bacteria 2726
221 Ga0496115_0485821 3300048918 Bacteria 994
222 Ga0496116_0000395 3300048919 Bacteria 63403
223 Ga0496117_0030051 3300048920 Bacteria 4177
224 Ga0496117_0044389 3300048920 Bacteria 3220
225 Ga0496117_0053981 3300048920 Bacteria 2819
226 Ga0496118_0069376 3300048921 Bacteria 2553
227 Ga0496118_0073428 3300048921 Bacteria 2451
228 Ga0496119_0018882 3300048922 Bacteria 5106
229 Ga0496119_0038808 3300048922 Bacteria 3071
230 Ga0496119_0263473 3300048922 Bacteria 864
231 Ga0496120_0005277 3300048923 Bacteria 10370
232 Ga0496120_0017251 3300048923 Bacteria 4689
233 Ga0496120_0023054 3300048923 Bacteria 3902
234 Ga0496121_0000220 3300048924 Bacteria 123930
235 Ga0496121_0243395 3300048924 Bacteria 1252
236 Ga0496122_0311398 3300048925 Bacteria 842
237 Ga0496123_0082156 3300048926 Bacteria 1954
238 Ga0496124_0097618 3300048927 Bacteria 2385
239 Ga0496124_0129837 3300048927 Bacteria 2003
240 Ga0496124_0258971 3300048927 Bacteria 1281
241 Ga0496124_0273183 3300048927 Bacteria 1236
242 Ga0496124_0277803 3300048927 Bacteria 1223
243 Ga0496124_0401337 3300048927 Bacteria 951
244 Ga0496125_0028346 3300048928 Bacteria 5061
245 Ga0496125_0062939 3300048928 Bacteria 2962
246 Ga0496126_0001701 3300048929 Bacteria 32688
247 Ga0496126_0089499 3300048929 Bacteria 2709
248 Ga0496126_0176954 3300048929 Bacteria 1814
249 Ga0496126_0261837 3300048929 Bacteria 1438
250 Ga0501033_0130974 3300049570 Bacteria 1817
251 Ga0501034_0176370 3300049571 Bacteria 2103
252 Ga0501037_0303169 3300049573 Bacteria 1109
253 Ga0501046_0000060 3300049580 Bacteria 125548
254 Ga0501067_0031393 3300049583 Bacteria 2948
255 Ga0501068_0545622 3300049584 Unclassified 754
256 Ga0501069_0670151 3300049585 Unclassified 625
257 Ga0501070_0087840 3300049586 Bacteria 2573
258 Ga0501073_0691628 3300049589 Bacteria 704
259 Ga0501074_0103168 3300049590 Bacteria 2042
260 Ga0501280_016280 3300049776 Bacteria 1072
261 Ga0501035_0013621 3300049822 Bacteria 7502
262 Ga0501044_0036712 3300049823 Bacteria 5125
263 Ga0501044_0734974 3300049823 Bacteria 870
264 nmdc:mga03683_69664_c1 3300050489 Bacteria 1501
265 nmdc:mga00v17_187528_c1 3300050491 Bacteria 1335
266 nmdc:mga00v17_39387_c1 3300050491 Bacteria 2830
267 nmdc:mga00v17_95369_c1 3300050491 Bacteria 1873
268 nmdc:mga0yw44_122601_c1 3300050492 Bacteria 1675
269 nmdc:mga0yw44_2346_c1 3300050492 Bacteria 8022
270 nmdc:mga0yw44_262163_c1 3300050492 Bacteria 1152
271 nmdc:mga0yw44_30172_c1 3300050492 Bacteria 3138
272 nmdc:mga0yw44_341502_c1 3300050492 Bacteria 1007
273 nmdc:mga06z11_1034052_c1 3300050494 Bacteria 501
274 nmdc:mga06z11_18079_c1 3300050494 Bacteria 3213
275 nmdc:mga06z11_63439_c1 3300050494 Bacteria 1933
276 nmdc:mga04h51_195139_c1 3300050495 Bacteria 793
277 nmdc:mga07m45_16126_c1 3300050496 Bacteria 3998
278 nmdc:mga0sz30_16576_c1 3300050516 Bacteria 2927
279 nmdc:mga0sz30_37238_c1 3300050516 Bacteria 2036
280 Ga0500610_0073016 3300053079 Bacteria 1789
281 Ga0495655_0064135 3300053083 Bacteria 1010
282 Ga0500650_0265836 3300053098 Bacteria 766
283 Ga0500560_000072 3300053107 Bacteria 9691
284 Ga0500560_068672 3300053107 Bacteria 1165
285 Ga0500562_054240 3300053108 Bacteria 1074
286 Ga0500594_0057839 3300053118 Bacteria 1110
287 Ga0500604_0105143 3300053151 Bacteria 933
288 Ga0500620_000040 3300053155 Bacteria 23734
289 Ga0500624_000906 3300053157 Bacteria 6256
290 Ga0500624_021557 3300053157 Bacteria 1042
291 Ga0500634_0036619 3300053161 Bacteria 2671
292 Ga0500634_0047620 3300053161 Bacteria 2314
293 Ga0500611_013315 3300053727 Bacteria 1409
294 Ga0500565_005325 3300053734 Bacteria 1132

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10166833 rootH1_101668333 129
2 3300013307 Ga0157372_10460646 Ga0157372_104606462 129
3 3300048919 Ga0496116_0000395 Ga0496116_0000395_4637_5119 129
4 3300048920 Ga0496117_0053981 Ga0496117_0053981_2255_2737 129
5 3300048921 Ga0496118_0073428 Ga0496118_0073428_1397_1879 129
6 3300013102 Ga0157371_10017302 Ga0157371_100173027 133
7 3300048927 Ga0496124_0129837 Ga0496124_0129837_167_688 133
8 3300048929 Ga0496126_0001701 Ga0496126_0001701_4945_5394 133
9 3300046674 Ga0495588_0234126 Ga0495588_0234126_121_537 138
10 3300046674 Ga0495588_0288445 Ga0495588_0288445_25_441 138
11 iso_pu_bacteria 2958092219 2958099574 143
12 3300006051 Ga0075364_10116616 Ga0075364_101166162 144
13 3300006051 Ga0075364_10218414 Ga0075364_102184142 144
14 iso_pu_bacteria 2693429783 2694628205 144
15 iso_pu_bacteria 2693429784 2694640938 144
16 iso_pu_bacteria 2765235802 2765464846 144
17 iso_pu_bacteria 2767802442 2770195228 144
18 iso_pu_bacteria 2775507049 2776916088 144
19 iso_pu_bacteria 2839993093 2839994768 144
20 iso_pu_bacteria 2840764183 2840767634 144
21 iso_pu_bacteria 2899803654 2899808638 144
22 iso_pu_bacteria 2904578770 2904580837 144
23 iso_pu_bacteria 2919119836 2919121448 144
24 iso_pu_bacteria 2938014810 2938016361 144
25 iso_pu_bacteria 3002141150 3002144474 144
26 3300048927 Ga0496124_0273183 Ga0496124_0273183_584_1021 145
27 3300049580 Ga0501046_0000060 Ga0501046_0000060_95263_95706 145
28 3300049776 Ga0501280_016280 Ga0501280_016280_29_469 145
29 iso_pu_bacteria 2513237146 2513923641 145
30 iso_pu_bacteria 2513237159 2513996237 145
31 iso_pu_bacteria 2516143018 2516204809 145
32 iso_pu_bacteria 2537561587 2537877365 145
33 iso_pu_bacteria 2554235003 2554246262 145
34 iso_pu_bacteria 2558860242 2559293484 145
35 iso_pu_bacteria 2582581283 2585164404 145
36 iso_pu_bacteria 2582581865 2585386229 145
37 iso_pu_bacteria 2582581866 2585394837 145
38 iso_pu_bacteria 2599185156 2599332639 145
39 iso_pu_bacteria 2599185170 2599415668 145
40 iso_pu_bacteria 2599185210 2599604366 145
41 iso_pu_bacteria 2600255279 2601609497 145
42 iso_pu_bacteria 2600255308 2601746272 145
43 iso_pu_bacteria 2643221568 2643857533 145
44 iso_pu_bacteria 2643221582 2643920642 145
45 iso_pu_bacteria 2643221607 2644051656 145
46 iso_pu_bacteria 2643221636 2644200139 145
47 iso_pu_bacteria 2643221637 2644207281 145
48 iso_pu_bacteria 2643221686 2644480525 145
49 iso_pu_bacteria 2643221688 2644495338 145
50 iso_pu_bacteria 2643221689 2644498761 145
51 iso_pu_bacteria 2643221693 2644519549 145
52 iso_pu_bacteria 2643221718 2644650929 145
53 iso_pu_bacteria 2690316117 2692320601 145
54 iso_pu_bacteria 2791355091 2792620983 145
55 iso_pu_bacteria 2791355092 2792625199 145
56 iso_pu_bacteria 2808606387 2808986745 145
57 iso_pu_bacteria 2818991439 2819556819 145
58 iso_pu_bacteria 2838675328 2838677554 145
59 iso_pu_bacteria 2838714209 2838716443 145
60 iso_pu_bacteria 2838719591 2838719757 145
61 iso_pu_bacteria 2838724970 2838727194 145
62 iso_pu_bacteria 2841846520 2841846688 145
63 iso_pu_bacteria 2841859092 2841860782 145
64 iso_pu_bacteria 2842124991 2842127283 145
65 iso_pu_bacteria 2842130223 2842132447 145
66 iso_pu_bacteria 2842152218 2842152384 145
67 iso_pu_bacteria 2842170452 2842172688 145
68 iso_pu_bacteria 2842175837 2842176003 145
69 iso_pu_bacteria 2842187318 2842189550 145
70 iso_pu_bacteria 2842211629 2842213864 145
71 iso_pu_bacteria 2842224351 2842224518 145
72 iso_pu_bacteria 2842515876 2842517567 145
73 iso_pu_bacteria 2842521101 2842521194 145
74 iso_pu_bacteria 2842922631 2842922914 145
75 iso_pu_bacteria 2847417321 2847421293 145
76 iso_pu_bacteria 2848992105 2848996081 145
77 iso_pu_bacteria 2855872281 2855877789 145
78 iso_pu_bacteria 2891373044 2891374767 145
79 iso_pu_bacteria 2899792073 2899794390 145
80 iso_pu_bacteria 2899845264 2899845773 145
81 iso_pu_bacteria 2919114240 2919116660 145
82 iso_pu_bacteria 2919166419 2919166481 145
83 iso_pu_bacteria 2926754445 2926754669 145
84 iso_pu_bacteria 2926760298 2926761837 145
85 iso_pu_bacteria 2929138655 2929142129 145
86 iso_pu_bacteria 2933006813 2933007031 145
87 iso_pu_bacteria 2933011516 2933015378 145
88 iso_pu_bacteria 2933594066 2933594233 145
89 iso_pu_bacteria 2978969890 2978972872 145
90 iso_pu_bacteria 2979089926 2979092897 145
91 iso_pu_bacteria 2979095461 2979099714 145
92 iso_pu_bacteria 2979100975 2979104866 145
93 iso_pu_bacteria 2984509177 2984513334 145
94 iso_pu_bacteria 2984518228 2984520297 145
95 iso_pu_bacteria 2984537506 2984539595 145
96 iso_pu_bacteria 2984587000 2984591126 145
97 iso_pu_bacteria 2984601300 2984601821 145
98 iso_pu_bacteria 2989349275 2989351931 145
99 iso_pu_bacteria 2989771324 2989774476 145
100 iso_pu_bacteria 3003930520 3003931465 145
101 iso_pu_bacteria 650716007 650738721 145
102 iso_pu_bacteria 8003570095 8003572268 145
103 iso_pu_bacteria 8054558443 8054562423 145
104 iso_pu_bacteria 2508501127 2509140075 146
105 iso_pu_bacteria 2509276018 2509368375 146
106 iso_pu_bacteria 2510065057 2510307076 146
107 iso_pu_bacteria 2510065059 2510314656 146
108 iso_pu_bacteria 2511231052 2511498877 146
109 iso_pu_bacteria 2512047086 2512535006 146
110 iso_pu_bacteria 2512875024 2512962520 146
111 iso_pu_bacteria 2512875026 2512973176 146
112 iso_pu_bacteria 2513237086 2513586792 146
113 iso_pu_bacteria 2513237089 2513603536 146
114 iso_pu_bacteria 2513237091 2513619095 146
115 iso_pu_bacteria 2513237140 2513882583 146
116 iso_pu_bacteria 2513237143 2513904567 146
117 iso_pu_bacteria 2513237160 2514005776 146
118 iso_pu_bacteria 2513237164 2514038648 146
119 iso_pu_bacteria 2513237305 2514419047 146
120 iso_pu_bacteria 2515154107 2515607295 146
121 iso_pu_bacteria 2516653046 2516895151 146
122 iso_pu_bacteria 2517487022 2517571821 146
123 iso_pu_bacteria 2524023207 2524452448 146
124 iso_pu_bacteria 2551306084 2551681640 146
125 iso_pu_bacteria 2551306085 2551684567 146
126 iso_pu_bacteria 2551306086 2551693345 146
127 iso_pu_bacteria 2551306087 2551698428 146
128 iso_pu_bacteria 2551306089 2551711296 146
129 iso_pu_bacteria 2551306090 2551719314 146
130 iso_pu_bacteria 2551306091 2551731142 146
131 iso_pu_bacteria 2551306092 2551736722 146
132 iso_pu_bacteria 2551306093 2551743172 146
133 iso_pu_bacteria 2588253730 2588520371 146
134 iso_pu_bacteria 2597489875 2597810556 146
135 iso_pu_bacteria 2643221550 2643772085 146
136 iso_pu_bacteria 2643221551 2643777378 146
137 iso_pu_bacteria 2643221555 2643795826 146
138 iso_pu_bacteria 2643221595 2643983944 146
139 iso_pu_bacteria 2643221627 2644156074 146
140 iso_pu_bacteria 2687453392 2688595630 146
141 iso_pu_bacteria 2721755686 2723572829 146
142 iso_pu_bacteria 2738543024 2739309899 146
143 iso_pu_bacteria 2756170246 2756674287 146
144 iso_pu_bacteria 2791355123 2792746815 146
145 iso_pu_bacteria 2802428858 2802720817 146
146 iso_pu_bacteria 2802428859 2802724423 146
147 iso_pu_bacteria 2802428860 2802729912 146
148 iso_pu_bacteria 2802428861 2802737256 146
149 iso_pu_bacteria 2802428862 2802746386 146
150 iso_pu_bacteria 2802428863 2802751875 146
151 iso_pu_bacteria 2844002411 2844003841 146
152 iso_pu_bacteria 2844009547 2844010429 146
153 iso_pu_bacteria 2855825444 2855827791 146
154 iso_pu_bacteria 2855839649 2855843159 146
155 iso_pu_bacteria 2856320880 2856321940 146
156 iso_pu_bacteria 2856328259 2856332888 146
157 iso_pu_bacteria 2856334872 2856340269 146
158 iso_pu_bacteria 2856342000 2856345771 146
159 iso_pu_bacteria 2856349417 2856354646 146
160 iso_pu_bacteria 2858800743 2858802887 146
161 iso_pu_bacteria 2869162929 2869165895 146
162 iso_pu_bacteria 2869169390 2869176061 146
163 iso_pu_bacteria 2869234852 2869238747 146
164 iso_pu_bacteria 2869242130 2869246205 146
165 iso_pu_bacteria 2869249662 2869254179 146
166 iso_pu_bacteria 2869256925 2869260670 146
167 iso_pu_bacteria 2869264136 2869267182 146
168 iso_pu_bacteria 2869271264 2869275487 146
169 iso_pu_bacteria 2871435913 2871437761 146
170 iso_pu_bacteria 2871444079 2871446868 146
171 iso_pu_bacteria 2871451962 2871458087 146
172 iso_pu_bacteria 2871459585 2871465493 146
173 iso_pu_bacteria 2871466892 2871470624 146
174 iso_pu_bacteria 2871481445 2871485676 146
175 iso_pu_bacteria 2874102143 2874103092 146
176 iso_pu_bacteria 2874116593 2874118343 146
177 iso_pu_bacteria 2874131515 2874133470 146
178 iso_pu_bacteria 2874162495 2874164805 146
179 iso_pu_bacteria 2874168670 2874172020 146
180 iso_pu_bacteria 2876369609 2876374729 146
181 iso_pu_bacteria 2876386047 2876387532 146
182 iso_pu_bacteria 2876399893 2876403904 146
183 iso_pu_bacteria 2876406927 2876412881 146
184 iso_pu_bacteria 2876420981 2876424976 146
185 iso_pu_bacteria 2878730984 2878734978 146
186 iso_pu_bacteria 2878738818 2878740602 146
187 iso_pu_bacteria 2878774303 2878775720 146
188 iso_pu_bacteria 2878781027 2878781322 146
189 iso_pu_bacteria 2878788777 2878789318 146
190 iso_pu_bacteria 2881155292 2881158957 146
191 iso_pu_bacteria 2881853255 2881855808 146
192 iso_pu_bacteria 2882632389 2882634798 146
193 iso_pu_bacteria 2885312484 2885314488 146
194 iso_pu_bacteria 2885342637 2885346225 146
195 iso_pu_bacteria 2885350715 2885351338 146
196 iso_pu_bacteria 2888337043 2888342973 146
197 iso_pu_bacteria 2888343758 2888344024 146
198 iso_pu_bacteria 2889914905 2889915026 146
199 iso_pu_bacteria 2903513507 2903516293 146
200 iso_pu_bacteria 2906328253 2906334869 146
201 iso_pu_bacteria 2906363423 2906369602 146
202 iso_pu_bacteria 2906370794 2906375547 146
203 iso_pu_bacteria 2906378014 2906378052 146
204 iso_pu_bacteria 2906386501 2906387419 146
205 iso_pu_bacteria 2906393657 2906398528 146
206 iso_pu_bacteria 2906401398 2906403046 146
207 iso_pu_bacteria 2906408224 2906413705 146
208 iso_pu_bacteria 2915980308 2915982672 146
209 iso_pu_bacteria 2915986958 2915992034 146
210 iso_pu_bacteria 2915993759 2915998308 146
211 iso_pu_bacteria 2916000859 2916004967 146
212 iso_pu_bacteria 2916007675 2916009561 146
213 iso_pu_bacteria 2916014648 2916014991 146
214 iso_pu_bacteria 2916021584 2916022963 146
215 iso_pu_bacteria 2916028427 2916033745 146
216 iso_pu_bacteria 2916035215 2916035969 146
217 iso_pu_bacteria 2916041962 2916046957 146
218 iso_pu_bacteria 2916048683 2916054904 146
219 iso_pu_bacteria 2916055098 2916061545 146
220 iso_pu_bacteria 2916061851 2916063942 146
221 iso_pu_bacteria 2916068649 2916069679 146
222 iso_pu_bacteria 2916076590 2916083197 146
223 iso_pu_bacteria 2921201388 2921207813 146
224 iso_pu_bacteria 2921208531 2921210428 146
225 iso_pu_bacteria 2921237296 2921238776 146
226 iso_pu_bacteria 2921244191 2921244897 146
227 iso_pu_bacteria 2921250672 2921256353 146
228 iso_pu_bacteria 2921257292 2921261482 146
229 iso_pu_bacteria 2921263974 2921264407 146
230 iso_pu_bacteria 2921282425 2921284138 146
231 iso_pu_bacteria 2921289301 2921295210 146
232 iso_pu_bacteria 2921296804 2921297517 146
233 iso_pu_bacteria 2922151315 2922155108 146
234 iso_pu_bacteria 2922172374 2922177869 146
235 iso_pu_bacteria 2922178524 2922185430 146
236 iso_pu_bacteria 2924144063 2924149095 146
237 iso_pu_bacteria 2924150972 2924152089 146
238 iso_pu_bacteria 2924158325 2924164482 146
239 iso_pu_bacteria 2924165586 2924167467 146
240 iso_pu_bacteria 2924172951 2924177333 146
241 iso_pu_bacteria 2924179722 2924181060 146
242 iso_pu_bacteria 2924186466 2924191192 146
243 iso_pu_bacteria 2924193448 2924198084 146
244 iso_pu_bacteria 2924200457 2924204985 146
245 iso_pu_bacteria 2924207177 2924211797 146
246 iso_pu_bacteria 2924214083 2924215625 146
247 iso_pu_bacteria 2924221636 2924223336 146
248 iso_pu_bacteria 2924228884 2924235451 146
249 iso_pu_bacteria 2924710171 2924715973 146
250 iso_pu_bacteria 2924718760 2924724677 146
251 iso_pu_bacteria 2924726620 2924727218 146
252 iso_pu_bacteria 2924733363 2924736687 146
253 iso_pu_bacteria 2924741084 2924744761 146
254 iso_pu_bacteria 2924748358 2924753867 146
255 iso_pu_bacteria 2924762789 2924764036 146
256 iso_pu_bacteria 2924776078 2924778203 146
257 iso_pu_bacteria 2936996657 2936998716 146
258 iso_pu_bacteria 2937002841 2937003414 146
259 iso_pu_bacteria 2937009748 2937013894 146
260 iso_pu_bacteria 2937016420 2937020880 146
261 iso_pu_bacteria 2937023124 2937025669 146
262 iso_pu_bacteria 2937029754 2937030558 146
263 iso_pu_bacteria 2937036028 2937039025 146
264 iso_pu_bacteria 2937042894 2937043841 146
265 iso_pu_bacteria 2937049772 2937051262 146
266 iso_pu_bacteria 2937056579 2937058749 146
267 iso_pu_bacteria 2937063883 2937071002 146
268 iso_pu_bacteria 2937071275 2937071586 146
269 iso_pu_bacteria 2937078374 2937083899 146
270 iso_pu_bacteria 2937084907 2937088568 146
271 iso_pu_bacteria 2937091812 2937093497 146
272 iso_pu_bacteria 2937098957 2937105499 146
273 iso_pu_bacteria 2937106411 2937107982 146
274 iso_pu_bacteria 2937113482 2937118133 146
275 iso_pu_bacteria 2937119839 2937125998 146
276 iso_pu_bacteria 2937126314 2937127031 146
277 iso_pu_bacteria 2937822353 2937826352 146
278 iso_pu_bacteria 2937836603 2937836711 146
279 iso_pu_bacteria 2937843397 2937845454 146
280 iso_pu_bacteria 2937861824 2937866811 146
281 iso_pu_bacteria 2937891427 2937897734 146
282 iso_pu_bacteria 2937972304 2937973986 146
283 iso_pu_bacteria 2937980651 2937983717 146
284 iso_pu_bacteria 2957375807 2957377992 146
285 iso_pu_bacteria 2957382221 2957386953 146
286 iso_pu_bacteria 2957388812 2957393718 146
287 iso_pu_bacteria 2957395598 2957402262 146
288 iso_pu_bacteria 2957402308 2957405655 146
289 iso_pu_bacteria 2957408893 2957414991 146
290 iso_pu_bacteria 2957415311 2957421676 146
291 iso_pu_bacteria 2957422303 2957426582 146
292 iso_pu_bacteria 2957430029 2957430755 146
293 iso_pu_bacteria 2957437181 2957441468 146
294 iso_pu_bacteria 2957443900 2957447822 146
295 iso_pu_bacteria 2957450854 2957456192 146
296 iso_pu_bacteria 2957457609 2957462265 146
297 iso_pu_bacteria 2957464669 2957469156 146
298 iso_pu_bacteria 2957471148 2957475454 146
299 iso_pu_bacteria 2957478035 2957482416 146
300 iso_pu_bacteria 2957484790 2957486013 146
301 iso_pu_bacteria 2957491536 2957493720 146
302 iso_pu_bacteria 2957498199 2957504113 146
303 iso_pu_bacteria 2957505466 2957510540 146
304 iso_pu_bacteria 2958071322 2958076079 146
305 iso_pu_bacteria 2958108152 2958110380 146
306 iso_pu_bacteria 2958115193 2958119438 146
307 iso_pu_bacteria 2958122699 2958125472 146
308 iso_pu_bacteria 2958137437 2958137532 146
309 iso_pu_bacteria 2958144490 2958147378 146
310 iso_pu_bacteria 2958158011 2958163889 146
311 iso_pu_bacteria 2960584000 2960588350 146
312 iso_pu_bacteria 2960591022 2960593194 146
313 iso_pu_bacteria 2960597568 2960603865 146
314 iso_pu_bacteria 2960603979 2960605227 146
315 iso_pu_bacteria 2960610863 2960615675 146
316 iso_pu_bacteria 2960617483 2960620963 146
317 iso_pu_bacteria 2960624210 2960626184 146
318 iso_pu_bacteria 2960631154 2960635347 146
319 iso_pu_bacteria 2960637947 2960644925 146
320 iso_pu_bacteria 2960645483 2960652049 146
321 iso_pu_bacteria 2960652885 2960656057 146
322 iso_pu_bacteria 2960660292 2960664251 146
323 iso_pu_bacteria 2960667422 2960670898 146
324 iso_pu_bacteria 2960674078 2960677982 146
325 iso_pu_bacteria 2960680706 2960682632 146
326 iso_pu_bacteria 2960687367 2960693010 146
327 iso_pu_bacteria 2960693952 2960697799 146
328 iso_pu_bacteria 2961127735 2961131293 146
329 iso_pu_bacteria 2961136820 2961140805 146
330 iso_pu_bacteria 2961183825 2961185727 146
331 iso_pu_bacteria 2964607997 2964614747 146
332 iso_pu_bacteria 2964615318 2964618210 146
333 iso_pu_bacteria 2964621998 2964624086 146
334 iso_pu_bacteria 2964628898 2964634676 146
335 iso_pu_bacteria 2964636051 2964637373 146
336 iso_pu_bacteria 2964643177 2964643718 146
337 iso_pu_bacteria 2964649959 2964656496 146
338 iso_pu_bacteria 2964656573 2964661828 146
339 iso_pu_bacteria 2964663802 2964668593 146
340 iso_pu_bacteria 2964670856 2964675701 146
341 iso_pu_bacteria 2964678106 2964683781 146
342 iso_pu_bacteria 2964685014 2964690337 146
343 iso_pu_bacteria 2964691889 2964692869 146
344 iso_pu_bacteria 2964698721 2964704088 146
345 iso_pu_bacteria 2964705432 2964708900 146
346 iso_pu_bacteria 2964712639 2964713709 146
347 iso_pu_bacteria 2964719344 2964726289 146
348 iso_pu_bacteria 2965025482 2965030335 146
349 iso_pu_bacteria 2965032056 2965034306 146
350 iso_pu_bacteria 2965040258 2965041557 146
351 iso_pu_bacteria 2965047637 2965049188 146
352 iso_pu_bacteria 2965062239 2965065549 146
353 iso_pu_bacteria 2965089291 2965094273 146
354 iso_pu_bacteria 2965102966 2965108743 146
355 iso_pu_bacteria 2967664464 2967665848 146
356 iso_pu_bacteria 2967671571 2967673042 146
357 iso_pu_bacteria 2967678726 2967684543 146
358 iso_pu_bacteria 2967686174 2967688478 146
359 iso_pu_bacteria 2967693043 2967697588 146
360 iso_pu_bacteria 2967699805 2967702877 146
361 iso_pu_bacteria 2967706974 2967708508 146
362 iso_pu_bacteria 2967714385 2967721314 146
363 iso_pu_bacteria 2967721400 2967722353 146
364 iso_pu_bacteria 2967728569 2967732885 146
365 iso_pu_bacteria 2967735183 2967740269 146
366 iso_pu_bacteria 2967742019 2967743940 146
367 iso_pu_bacteria 2967748971 2967749656 146
368 iso_pu_bacteria 2967755722 2967758467 146
369 iso_pu_bacteria 2967762386 2967767604 146
370 iso_pu_bacteria 2967769361 2967775844 146
371 iso_pu_bacteria 2967775926 2967777826 146
372 iso_pu_bacteria 2968091066 2968093872 146
373 iso_pu_bacteria 2968097103 2968101351 146
374 iso_pu_bacteria 2968128360 2968134149 146
375 iso_pu_bacteria 2968138860 2968139198 146
376 iso_pu_bacteria 2970019648 2970020736 146
377 iso_pu_bacteria 2970026789 2970031936 146
378 iso_pu_bacteria 2970033650 2970038020 146
379 iso_pu_bacteria 2970040964 2970041931 146
380 iso_pu_bacteria 2970047711 2970049701 146
381 iso_pu_bacteria 2970054988 2970061269 146
382 iso_pu_bacteria 2970061556 2970067722 146
383 iso_pu_bacteria 2970068827 2970073430 146
384 iso_pu_bacteria 2970076120 2970081331 146
385 iso_pu_bacteria 2970082768 2970085105 146
386 iso_pu_bacteria 2970088815 2970093752 146
387 iso_pu_bacteria 2970095765 2970097029 146
388 iso_pu_bacteria 2970102677 2970106222 146
389 iso_pu_bacteria 2970109326 2970116214 146
390 iso_pu_bacteria 2970116247 2970121367 146
391 iso_pu_bacteria 2970122695 2970122753 146
392 iso_pu_bacteria 2970129317 2970133877 146
393 iso_pu_bacteria 2970136068 2970142331 146
394 iso_pu_bacteria 2970143518 2970145276 146
395 iso_pu_bacteria 2970149975 2970154634 146
396 iso_pu_bacteria 2970156795 2970158594 146
397 iso_pu_bacteria 2970164137 2970170623 146
398 iso_pu_bacteria 2970170962 2970173979 146
399 iso_pu_bacteria 2970177841 2970182068 146
400 iso_pu_bacteria 2970184632 2970186943 146
401 iso_pu_bacteria 2970191845 2970192513 146
402 iso_pu_bacteria 2970489779 2970490190 146
403 iso_pu_bacteria 2970510686 2970514766 146
404 iso_pu_bacteria 2970524798 2970525728 146
405 iso_pu_bacteria 2970532167 2970537934 146
406 iso_pu_bacteria 2970540015 2970541361 146
407 iso_pu_bacteria 2970547951 2970550446 146
408 iso_pu_bacteria 2970619444 2970624237 146
409 iso_pu_bacteria 2970627176 2970627992 146
410 iso_pu_bacteria 2977516862 2977522175 146
411 iso_pu_bacteria 2977523885 2977529916 146
412 iso_pu_bacteria 2977530762 2977530927 146
413 iso_pu_bacteria 2977537788 2977542738 146
414 iso_pu_bacteria 2977544691 2977546953 146
415 iso_pu_bacteria 2977551784 2977558874 146
416 iso_pu_bacteria 2977558990 2977560225 146
417 iso_pu_bacteria 2977565890 2977569910 146
418 iso_pu_bacteria 2977572785 2977573252 146
419 iso_pu_bacteria 2977579622 2977584538 146
420 iso_pu_bacteria 2977851361 2977857615 146
421 iso_pu_bacteria 2977858184 2977864797 146
422 iso_pu_bacteria 2977872689 2977873672 146
423 iso_pu_bacteria 2977898635 2977905576 146
424 iso_pu_bacteria 2977907340 2977911532 146
425 iso_pu_bacteria 2977915119 2977916143 146
426 iso_pu_bacteria 2977935797 2977941861 146
427 iso_pu_bacteria 2977950692 2977951474 146
428 iso_pu_bacteria 2977957713 2977963398 146
429 iso_pu_bacteria 2979764755 2979769472 146
430 iso_pu_bacteria 2979772303 2979778236 146
431 iso_pu_bacteria 2979779861 2979781883 146
432 iso_pu_bacteria 2987645492 2987649033 146
433 iso_pu_bacteria 2987666974 2987667573 146
434 iso_pu_bacteria 2987673487 2987674495 146
435 iso_pu_bacteria 2996336353 2996336507 146
436 iso_pu_bacteria 2996341866 2996342224 146
437 iso_pu_bacteria 2996386984 2996391677 146
438 iso_pu_bacteria 3004167301 3004172841 146
439 iso_pu_bacteria 3004195979 3004197870 146
440 iso_pu_bacteria 3004232784 3004239399 146
441 iso_pu_bacteria 3004239961 3004242170 146
442 iso_pu_bacteria 3004248173 3004254072 146
443 iso_pu_bacteria 3004268573 3004272576 146
444 iso_pu_bacteria 3004334049 3004337776 146
445 iso_pu_bacteria 648276728 648736615 146
446 iso_pu_bacteria 649633066 649870197 146
447 iso_pu_bacteria 8002285264 8002286460 146
448 iso_pu_bacteria 8003992118 8003995741 146
449 iso_pu_bacteria 8003999396 8004003493 146
450 iso_pu_bacteria 8004300914 8004301742 146
451 iso_pu_bacteria 8004312739 8004314999 146
452 iso_pu_bacteria 8004395343 8004396296 146
453 iso_pu_bacteria 8004445564 8004446362 146
454 iso_pu_bacteria 8004633249 8004633645 146
455 iso_pu_bacteria 8004695233 8004703392 146
456 iso_pu_bacteria 8004703790 8004707022 146
457 iso_pu_bacteria 8004727605 8004727918 146
458 iso_pu_bacteria 8055617313 8055617542 146
459 3300005455 Ga0070663_100048924 Ga0070663_1000489243 147
460 3300026116 Ga0207674_10792580 Ga0207674_107925801 147
461 3300031911 Ga0307412_10379736 Ga0307412_103797362 147
462 3300041997 Ga0439431_0077337 Ga0439431_0077337_405_860 147
463 3300049571 Ga0501034_0176370 Ga0501034_0176370_831_1274 147
464 iso_pu_bacteria 2508501122 2509112838 147
465 iso_pu_bacteria 2509276019 2509375462 147
466 iso_pu_bacteria 2558860100 2558866561 147
467 iso_pu_bacteria 2599185352 2600195290 147
468 iso_pu_bacteria 2643221557 2643805803 147
469 iso_pu_bacteria 2643221610 2644065979 147
470 iso_pu_bacteria 2643221618 2644103775 147
471 iso_pu_bacteria 2643221626 2644144656 147
472 iso_pu_bacteria 2643221655 2644306705 147
473 iso_pu_bacteria 2643221659 2644330896 147
474 iso_pu_bacteria 2643221668 2644380283 147
475 iso_pu_bacteria 2643221675 2644417310 147
476 iso_pu_bacteria 2643221680 2644450706 147
477 iso_pu_bacteria 2643221698 2644541115 147
478 iso_pu_bacteria 2643221712 2644612316 147
479 iso_pu_bacteria 2643221723 2644671483 147
480 iso_pu_bacteria 2643221726 2644692869 147
481 iso_pu_bacteria 2657244999 2657682808 147
482 iso_pu_bacteria 2751185821 2753459933 147
483 iso_pu_bacteria 2791355082 2792583388 147
484 iso_pu_bacteria 2791355094 2792637637 147
485 iso_pu_bacteria 2802429268 2804754028 147
486 iso_pu_bacteria 2838074704 2838074899 147
487 iso_pu_bacteria 2844163670 2844164719 147
488 iso_pu_bacteria 2850079185 2850079471 147
489 iso_pu_bacteria 2896384573 2896388626 147
490 iso_pu_bacteria 2913295892 2913298380 147
491 iso_pu_bacteria 2920760137 2920763851 147
492 iso_pu_bacteria 2920822456 2920822845 147
493 iso_pu_bacteria 2941499720 2941504007 147
494 iso_pu_bacteria 2996310559 2996316476 147
495 iso_pu_bacteria 8049293176 8049296645 147
496 3300003856 Ga0058692_1000111 Ga0058692_100011146 148
497 3300006051 Ga0075364_10076785 Ga0075364_100767854 148
498 3300013105 Ga0157369_10354399 Ga0157369_103543992 148
499 3300027312 Ga0209371_1000174 Ga0209371_100017482 148
500 3300027312 Ga0209371_1000222 Ga0209371_100022262 148
501 3300030500 Ga0268256_1000028 Ga0268256_1000028155 148
502 3300031824 Ga0307413_11562670 Ga0307413_115626701 148
503 3300041413 Ga0439465_0017016 Ga0439465_0017016_968_1414 148
504 3300046660 Ga0495625_0151481 Ga0495625_0151481_358_804 148
505 3300049589 Ga0501073_0691628 Ga0501073_0691628_175_621 148
506 3300053108 Ga0500562_054240 Ga0500562_054240_297_749 148
507 iso_pu_bacteria 2924754689 2924756788 148
508 3300003187 JGI25151J46595_10096027 JGI25151J46595_100960271 149
509 3300003856 Ga0058692_1001634 Ga0058692_10016344 149
510 3300003856 Ga0058692_1012835 Ga0058692_10128353 149
511 3300005289 Ga0065704_10217409 Ga0065704_102174091 149
512 3300005354 Ga0070675_100257329 Ga0070675_1002573293 149
513 3300005548 Ga0070665_100022200 Ga0070665_1000222007 149
514 3300006038 Ga0075365_10913944 Ga0075365_109139442 149
515 3300006042 Ga0075368_10000802 Ga0075368_100008023 149
516 3300006048 Ga0075363_100306396 Ga0075363_1003063962 149
517 3300006051 Ga0075364_10050555 Ga0075364_100505552 149
518 3300006051 Ga0075364_10123366 Ga0075364_101233663 149
519 3300006051 Ga0075364_10718839 Ga0075364_107188392 149
520 3300006177 Ga0075362_10006106 Ga0075362_100061062 149
521 3300006178 Ga0075367_10100953 Ga0075367_101009533 149
522 3300006178 Ga0075367_10114728 Ga0075367_101147283 149
523 3300006186 Ga0075369_10030409 Ga0075369_100304092 149
524 3300006186 Ga0075369_10158025 Ga0075369_101580253 149
525 3300006353 Ga0075370_10242896 Ga0075370_102428963 149
526 3300006946 Ga0079104_1002726 Ga0079104_100272610 149
527 3300006946 Ga0079104_1020023 Ga0079104_10200232 149
528 3300006948 Ga0099826_10000075 Ga0099826_100000757 149
529 3300006948 Ga0099826_10071547 Ga0099826_100715474 149
530 3300011119 Ga0105246_11357654 Ga0105246_113576542 149
531 3300013102 Ga0157371_10000004 Ga0157371_10000004163 149
532 3300022739 Ga0228711_1000006 Ga0228711_100000633 149
533 3300022740 Ga0228710_1000004 Ga0228710_100000481 149
534 3300025294 Ga0209025_1000060 Ga0209025_100006051 149
535 3300025923 Ga0207681_10082883 Ga0207681_100828835 149
536 3300025926 Ga0207659_10700657 Ga0207659_107006572 149
537 3300025935 Ga0207709_10428578 Ga0207709_104285782 149
538 3300027111 Ga0209281_1000102 Ga0209281_100010216 149
539 3300027111 Ga0209281_1001274 Ga0209281_100127416 149
540 3300027312 Ga0209371_1000009 Ga0209371_1000009834 149
541 3300027312 Ga0209371_1000306 Ga0209371_100030649 149
542 3300027312 Ga0209371_1000732 Ga0209371_100073226 149
543 3300027666 Ga0209282_1000013 Ga0209282_100001351 149
544 3300027666 Ga0209282_1000179 Ga0209282_100017935 149
545 3300027666 Ga0209282_1060889 Ga0209282_10608894 149
546 3300027866 Ga0209813_10002747 Ga0209813_100027476 149
547 3300028794 Ga0307515_10000029 Ga0307515_1000002919 149
548 3300028794 Ga0307515_10013457 Ga0307515_100134579 149
549 3300030500 Ga0268256_1000010 Ga0268256_1000010833 149
550 3300030500 Ga0268256_1000751 Ga0268256_100075122 149
551 3300030744 Ga0316181_1279897 Ga0316181_12798972 149
552 3300031456 Ga0307513_10014973 Ga0307513_100149736 149
553 3300031548 Ga0307408_100117646 Ga0307408_1001176463 149
554 3300031548 Ga0307408_100832514 Ga0307408_1008325142 149
555 3300031852 Ga0307410_10763741 Ga0307410_107637412 149
556 3300031901 Ga0307406_10136004 Ga0307406_101360042 149
557 3300031911 Ga0307412_10559512 Ga0307412_105595122 149
558 3300031967 Ga0315914_1000004 Ga0315914_100000486 149
559 3300031995 Ga0307409_100022688 Ga0307409_1000226882 149
560 3300031995 Ga0307409_100419987 Ga0307409_1004199873 149
561 3300032002 Ga0307416_100299846 Ga0307416_1002998462 149
562 3300033430 Ga0315913_1000011 Ga0315913_1000011104 149
563 3300033464 Ga0315915_1000003 Ga0315915_1000003193 149
564 3300041404 Ga0439436_0120008 Ga0439436_0120008_73_525 149
565 3300042006 Ga0439432_171123 Ga0439432_171123_47_499 149
566 3300042136 Ga0450900_052197 Ga0450900_052197_132_581 149
567 3300046558 Ga0495633_0012953 Ga0495633_0012953_1178_1627 149
568 3300046558 Ga0495633_0035902 Ga0495633_0035902_297_746 149
569 3300046692 Ga0495671_0019241 Ga0495671_0019241_1303_1752 149
570 3300047470 Ga0495681_0010825 Ga0495681_0010825_692_1141 149
571 3300048907 Ga0496104_0066571 Ga0496104_0066571_330_779 149
572 3300048914 Ga0496111_0554009 Ga0496111_0554009_154_603 149
573 3300048920 Ga0496117_0030051 Ga0496117_0030051_3708_4157 149
574 3300048920 Ga0496117_0044389 Ga0496117_0044389_2099_2548 149
575 3300048922 Ga0496119_0018882 Ga0496119_0018882_4069_4518 149
576 3300048922 Ga0496119_0038808 Ga0496119_0038808_876_1337 149
577 3300048923 Ga0496120_0017251 Ga0496120_0017251_2193_2654 149
578 3300048924 Ga0496121_0000220 Ga0496121_0000220_49409_49858 149
579 3300048925 Ga0496122_0311398 Ga0496122_0311398_157_618 149
580 3300048926 Ga0496123_0082156 Ga0496123_0082156_484_945 149
581 3300048927 Ga0496124_0097618 Ga0496124_0097618_1208_1669 149
582 3300048927 Ga0496124_0258971 Ga0496124_0258971_170_619 149
583 3300048927 Ga0496124_0401337 Ga0496124_0401337_29_490 149
584 3300048928 Ga0496125_0062939 Ga0496125_0062939_994_1443 149
585 3300048929 Ga0496126_0089499 Ga0496126_0089499_1056_1517 149
586 3300049570 Ga0501033_0130974 Ga0501033_0130974_1096_1551 149
587 3300049573 Ga0501037_0303169 Ga0501037_0303169_64_519 149
588 3300049584 Ga0501068_0545622 Ga0501068_0545622_243_698 149
589 3300049585 Ga0501069_0670151 Ga0501069_0670151_138_593 149
590 3300049586 Ga0501070_0087840 Ga0501070_0087840_807_1262 149
591 3300049590 Ga0501074_0103168 Ga0501074_0103168_1485_1940 149
592 3300049822 Ga0501035_0013621 Ga0501035_0013621_2268_2723 149
593 3300049823 Ga0501044_0036712 Ga0501044_0036712_2955_3410 149
594 3300050491 nmdc:mga00v17_39387_c1 nmdc:mga00v17_39387_c1_2030_2479 149
595 3300050491 nmdc:mga00v17_95369_c1 nmdc:mga00v17_95369_c1_329_778 149
596 3300050492 nmdc:mga0yw44_341502_c1 nmdc:mga0yw44_341502_c1_138_587 149
597 3300050494 nmdc:mga06z11_63439_c1 nmdc:mga06z11_63439_c1_1168_1617 149
598 3300050516 nmdc:mga0sz30_16576_c1 nmdc:mga0sz30_16576_c1_2332_2781 149
599 3300050516 nmdc:mga0sz30_37238_c1 nmdc:mga0sz30_37238_c1_568_1017 149
600 3300053107 Ga0500560_000072 Ga0500560_000072_7948_8397 149
601 3300053107 Ga0500560_068672 Ga0500560_068672_77_526 149
602 3300053118 Ga0500594_0057839 Ga0500594_0057839_415_864 149
603 3300053157 Ga0500624_000906 Ga0500624_000906_5245_5694 149
604 3300053157 Ga0500624_021557 Ga0500624_021557_136_585 149
605 3300053161 Ga0500634_0036619 Ga0500634_0036619_981_1430 149
606 3300053161 Ga0500634_0047620 Ga0500634_0047620_457_906 149
607 3300053734 Ga0500565_005325 Ga0500565_005325_341_790 149
608 2162886012 MBSR1b_contig_1494779 MBSR1b_0878.00001770 150
609 3300001989 JGI24739J22299_10109544 JGI24739J22299_101095442 150
610 3300002739 JGI25158J39367_1001021 JGI25158J39367_10010215 150
611 3300002741 JGI25157J39369_1002897 JGI25157J39369_10028971 150
612 3300002987 JGI25159J45721_1000015 JGI25159J45721_1000015142 150
613 3300003187 JGI25151J46595_10010501 JGI25151J46595_100105015 150
614 3300003354 JGI25160J50197_1000003 JGI25160J50197_100000343 150
615 3300003374 JGI25161J50226_1000802 JGI25161J50226_10008026 150
616 3300003771 Ga0055526_1004230 Ga0055526_10042305 150
617 3300003775 Ga0055524_1022448 Ga0055524_10224482 150
618 3300003775 Ga0055524_1038180 Ga0055524_10381802 150
619 3300003791 Ga0055530_10070988 Ga0055530_100709881 150
620 3300003794 Ga0055531_10037006 Ga0055531_100370063 150
621 3300004625 Ga0055543_1000034 Ga0055543_1000034111 150
622 3300005262 Ga0065165_1000047 Ga0065165_1000047163 150
623 3300005339 Ga0070660_100276791 Ga0070660_1002767911 150
624 3300005344 Ga0070661_100169012 Ga0070661_1001690121 150
625 3300005356 Ga0070674_101893696 Ga0070674_1018936961 150
626 3300005366 Ga0070659_100206058 Ga0070659_1002060581 150
627 3300005455 Ga0070663_100308773 Ga0070663_1003087732 150
628 3300005539 Ga0068853_100022594 Ga0068853_1000225945 150
629 3300005539 Ga0068853_100228512 Ga0068853_1002285121 150
630 3300005548 Ga0070665_100029417 Ga0070665_1000294172 150
631 3300005548 Ga0070665_100748105 Ga0070665_1007481052 150
632 3300005577 Ga0068857_100595660 Ga0068857_1005956601 150
633 3300005577 Ga0068857_101381004 Ga0068857_1013810041 150
634 3300005616 Ga0068852_100971759 Ga0068852_1009717592 150
635 3300006038 Ga0075365_10005367 Ga0075365_100053673 150
636 3300006038 Ga0075365_10031318 Ga0075365_100313182 150
637 3300006038 Ga0075365_10054407 Ga0075365_100544072 150
638 3300006042 Ga0075368_10222088 Ga0075368_102220881 150
639 3300006048 Ga0075363_100057357 Ga0075363_1000573572 150
640 3300006048 Ga0075363_100245645 Ga0075363_1002456452 150
641 3300006051 Ga0075364_10652553 Ga0075364_106525531 150
642 3300006177 Ga0075362_10069323 Ga0075362_100693232 150
643 3300006178 Ga0075367_10053683 Ga0075367_100536833 150
644 3300006178 Ga0075367_10351152 Ga0075367_103511522 150
645 3300006353 Ga0075370_10013786 Ga0075370_100137862 150
646 3300006881 Ga0068865_101536722 Ga0068865_1015367221 150
647 3300009093 Ga0105240_10152353 Ga0105240_101523533 150
648 3300009093 Ga0105240_10166244 Ga0105240_101662442 150
649 3300009093 Ga0105240_10206277 Ga0105240_102062773 150
650 3300009093 Ga0105240_11198611 Ga0105240_111986111 150
651 3300009093 Ga0105240_11775717 Ga0105240_117757172 150
652 3300009093 Ga0105240_11824368 Ga0105240_118243682 150
653 3300009174 Ga0105241_10290854 Ga0105241_102908542 150
654 3300009177 Ga0105248_10332186 Ga0105248_103321862 150
655 3300009545 Ga0105237_10673325 Ga0105237_106733251 150
656 3300009545 Ga0105237_10930219 Ga0105237_109302191 150
657 3300009545 Ga0105237_10948879 Ga0105237_109488791 150
658 3300009551 Ga0105238_10114258 Ga0105238_101142582 150
659 3300009551 Ga0105238_10694916 Ga0105238_106949162 150
660 3300010375 Ga0105239_10045345 Ga0105239_100453451 150
661 3300010375 Ga0105239_10797925 Ga0105239_107979252 150
662 3300010375 Ga0105239_11382854 Ga0105239_113828541 150
663 3300010375 Ga0105239_11566819 Ga0105239_115668192 150
664 3300010375 Ga0105239_12924505 Ga0105239_129245051 150
665 3300013105 Ga0157369_10126002 Ga0157369_101260022 150
666 3300013105 Ga0157369_12087964 Ga0157369_120879641 150
667 3300013296 Ga0157374_10940062 Ga0157374_109400622 150
668 3300013306 Ga0163162_11634555 Ga0163162_116345552 150
669 3300014325 Ga0163163_10590763 Ga0163163_105907631 150
670 3300014497 Ga0182008_10124576 Ga0182008_101245762 150
671 3300015261 Ga0182006_1066219 Ga0182006_10662192 150
672 3300015690 Ga0183363_1097 Ga0183363_109729 150
673 3300017792 Ga0163161_10878050 Ga0163161_108780502 150
674 3300021320 Ga0214544_1000434 Ga0214544_100043450 150
675 3300021321 Ga0214542_1002623 Ga0214542_100262312 150
676 3300021327 Ga0214543_1000049 Ga0214543_100004947 150
677 3300021327 Ga0214543_1000054 Ga0214543_1000054106 150
678 3300025208 Ga0209436_100306 Ga0209436_10030610 150
679 3300025250 Ga0209026_1000050 Ga0209026_1000050105 150
680 3300025256 Ga0209759_1000229 Ga0209759_10002292 150
681 3300025261 Ga0209233_1000034 Ga0209233_1000034103 150
682 3300025261 Ga0209233_1088967 Ga0209233_10889671 150
683 3300025284 Ga0209130_1000005 Ga0209130_1000005437 150
684 3300025292 Ga0209676_1001950 Ga0209676_10019508 150
685 3300025294 Ga0209025_1000814 Ga0209025_100081421 150
686 3300025295 Ga0209564_1000113 Ga0209564_1000113127 150
687 3300025298 Ga0209050_1006490 Ga0209050_10064902 150
688 3300025299 Ga0209256_1000819 Ga0209256_10008199 150
689 3300025299 Ga0209256_1004911 Ga0209256_10049117 150
690 3300025302 Ga0207426_1000015 Ga0207426_1000015162 150
691 3300025303 Ga0209051_1021168 Ga0209051_10211681 150
692 3300025904 Ga0207647_10117870 Ga0207647_101178702 150
693 3300025911 Ga0207654_10108816 Ga0207654_101088161 150
694 3300025913 Ga0207695_10071872 Ga0207695_100718723 150
695 3300025913 Ga0207695_10299990 Ga0207695_102999901 150
696 3300025914 Ga0207671_10070021 Ga0207671_100700212 150
697 3300025914 Ga0207671_10638548 Ga0207671_106385481 150
698 3300025919 Ga0207657_10054645 Ga0207657_100546452 150
699 3300025920 Ga0207649_10568716 Ga0207649_105687161 150
700 3300025924 Ga0207694_10003257 Ga0207694_100032579 150
701 3300025924 Ga0207694_10616184 Ga0207694_106161842 150
702 3300025981 Ga0207640_10656180 Ga0207640_106561801 150
703 3300026041 Ga0207639_10003680 Ga0207639_100036807 150
704 3300026067 Ga0207678_10496028 Ga0207678_104960281 150
705 3300026078 Ga0207702_11804693 Ga0207702_118046931 150
706 3300026116 Ga0207674_10856734 Ga0207674_108567341 150
707 3300026142 Ga0207698_11852430 Ga0207698_118524301 150
708 3300028379 Ga0268266_10701418 Ga0268266_107014181 150
709 3300028380 Ga0268265_10741323 Ga0268265_107413232 150
710 3300028786 Ga0307517_10165955 Ga0307517_101659551 150
711 3300031911 Ga0307412_10155501 Ga0307412_101555012 150
712 3300032004 Ga0307414_11150113 Ga0307414_111501132 150
713 3300037312 Ga0395899_0000014 Ga0395899_0000014_283709_284161 150
714 3300037418 Ga0395900_0000007 Ga0395900_0000007_283728_284180 150
715 3300037418 Ga0395900_0276370 Ga0395900_0276370_1038_1493 150
716 3300037418 Ga0395900_0949781 Ga0395900_0949781_60_512 150
717 3300037466 Ga0395898_0000011 Ga0395898_0000011_204681_205133 150
718 3300037466 Ga0395898_0113118 Ga0395898_0113118_2107_2559 150
719 3300037471 Ga0395905_0000008 Ga0395905_0000008_283728_284180 150
720 3300037471 Ga0395905_0166850 Ga0395905_0166850_160_612 150
721 3300038443 Ga0395901_0000020 Ga0395901_0000020_109786_110238 150
722 3300038443 Ga0395901_0046061 Ga0395901_0046061_3604_4056 150
723 3300038443 Ga0395901_0564536 Ga0395901_0564536_390_842 150
724 3300041404 Ga0439436_0009599 Ga0439436_0009599_748_1203 150
725 3300041411 Ga0439466_0067672 Ga0439466_0067672_196_651 150
726 3300041453 Ga0451797_1112202 Ga0451797_1112202_237_692 150
727 3300041460 Ga0451802_0931265 Ga0451802_0931265_46_498 150
728 3300041486 Ga0451807_1294930 Ga0451807_1294930_119_571 150
729 3300041501 Ga0451845_0821049 Ga0451845_0821049_48_500 150
730 3300044658 Ga0466972_0014934 Ga0466972_0014934_3404_3856 150
731 3300044901 Ga0466960_0122960 Ga0466960_0122960_159_611 150
732 3300046460 Ga0495638_0085781 Ga0495638_0085781_1366_1818 150
733 3300046513 Ga0495616_0113036 Ga0495616_0113036_519_971 150
734 3300046522 Ga0495643_0064202 Ga0495643_0064202_901_1353 150
735 3300046616 Ga0495668_0083342 Ga0495668_0083342_730_1182 150
736 3300046660 Ga0495625_0104697 Ga0495625_0104697_56_508 150
737 3300046674 Ga0495588_0307155 Ga0495588_0307155_80_532 150
738 3300047472 Ga0495686_0111159 Ga0495686_0111159_263_715 150
739 3300048903 Ga0496100_1339545 Ga0496100_1339545_97_549 150
740 3300048905 Ga0496102_0983571 Ga0496102_0983571_248_700 150
741 3300048905 Ga0496102_1160830 Ga0496102_1160830_14_466 150
742 3300048915 Ga0496112_0109985 Ga0496112_0109985_911_1363 150
743 3300048918 Ga0496115_0485821 Ga0496115_0485821_485_937 150
744 3300048921 Ga0496118_0069376 Ga0496118_0069376_424_876 150
745 3300048922 Ga0496119_0263473 Ga0496119_0263473_23_475 150
746 3300048923 Ga0496120_0005277 Ga0496120_0005277_9859_10314 150
747 3300048923 Ga0496120_0023054 Ga0496120_0023054_648_1100 150
748 3300048924 Ga0496121_0243395 Ga0496121_0243395_710_1162 150
749 3300048927 Ga0496124_0277803 Ga0496124_0277803_466_918 150
750 3300048928 Ga0496125_0028346 Ga0496125_0028346_4487_4939 150
751 3300048929 Ga0496126_0176954 Ga0496126_0176954_309_761 150
752 3300048929 Ga0496126_0261837 Ga0496126_0261837_315_767 150
753 3300049583 Ga0501067_0031393 Ga0501067_0031393_2024_2476 150
754 3300049823 Ga0501044_0734974 Ga0501044_0734974_134_586 150
755 3300050489 nmdc:mga03683_69664_c1 nmdc:mga03683_69664_c1_412_864 150
756 3300050491 nmdc:mga00v17_187528_c1 nmdc:mga00v17_187528_c1_863_1315 150
757 3300050492 nmdc:mga0yw44_122601_c1 nmdc:mga0yw44_122601_c1_133_585 150
758 3300050492 nmdc:mga0yw44_2346_c1 nmdc:mga0yw44_2346_c1_2099_2551 150
759 3300050492 nmdc:mga0yw44_262163_c1 nmdc:mga0yw44_262163_c1_610_1062 150
760 3300050492 nmdc:mga0yw44_30172_c1 nmdc:mga0yw44_30172_c1_2138_2674 150
761 3300050494 nmdc:mga06z11_1034052_c1 nmdc:mga06z11_1034052_c1_30_482 150
762 3300050494 nmdc:mga06z11_18079_c1 nmdc:mga06z11_18079_c1_23_475 150
763 3300050495 nmdc:mga04h51_195139_c1 nmdc:mga04h51_195139_c1_173_625 150
764 3300050496 nmdc:mga07m45_16126_c1 nmdc:mga07m45_16126_c1_379_831 150
765 3300053079 Ga0500610_0073016 Ga0500610_0073016_746_1198 150
766 3300053083 Ga0495655_0064135 Ga0495655_0064135_212_664 150
767 3300053098 Ga0500650_0265836 Ga0500650_0265836_48_500 150
768 3300053151 Ga0500604_0105143 Ga0500604_0105143_199_651 150
769 3300053155 Ga0500620_000040 Ga0500620_000040_14894_15346 150
770 3300053727 Ga0500611_013315 Ga0500611_013315_127_579 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07681

DoxX

DoxX

34

117

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6q58-assembly1.cif.gz_A copper loading to a cytosolic copper storage protein from streptomyces lividans (five coppers) 0.6066 27 137
6q58-assembly1.cif.gz_A copper loading to a cytosolic copper storage protein from streptomyces lividans (five coppers) 0.5694 27 137
5arm-assembly1.cif.gz_A apo-csp3 (copper storage protein 3) from methylosinus 0.4399 29 133
4xxi-assembly1.cif.gz_B crystal structure of the bilin-binding domain of phycobilisome core-membrane linker apce 0.4289 18 133
5nqn-assembly1.cif.gz_A cu(i)-csp3 (copper storage protein 3) from methylosinus 0.4205 33 130
ID Description Score Start End Superfamily
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.7679 28 134 1.10.10.1740
af_Q8T0T9_12_131_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7414 32 129 1.20.120.550
af_Q53FP2_11_127_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7158 32 130 1.20.120.550
af_D3ZYP5_7_123_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7068 32 130 1.20.120.550
af_Q2FWC2_1_116_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7065 30 129 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A439MYQ9-F1-model_v4 DoxX family protein 0.9915 28 150 GO:0005886
AF-A0A3Q8ZXW7-F1-model_v4 DoxX family protein 0.9819 1 150 GO:0005886
AF-A0A212DML8-F1-model_v4 deleted 0.9791 58 150
AF-A0A1M3AQQ8-F1-model_v4 deleted 0.9777 8 150
AF-A0A439MYQ9-F1-model_v4 DoxX family protein 0.9757 28 150 GO:0005886

Feature Viewer

pLDDT pTM Quality
90.62 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map