F480089

General Info

Members Datasets Scaffolds Average Seq Length
771 322 757 225

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0008903|Ga0495625_0008903_1265_2062
Length 265
Sequence VFHYGEDNKRIHVSCQNVPVTKIKLFATFTTNRAPMQHHEHHVSSSEAIRDIVIGMSDGLTVPFALAAGLSGAITSSTLVVTAGIAEIVAGSIAMGLGGFLAGRTEQDHYRSELKREYEEVERVPEQEKLEVREVFAEFGLSETLQAQIADEMAKDKKKWVDFMMRYELGLEEPNPNRASRSAFTIGASYIVGGIIPLSPYILISHAGEALYYSCAVTLICLFIFGYFKSKMTGQPALSGAIKVVIIGTLAAGAAFGMAKLITGK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2738541302 Pedobacter sp. CF074 Isolate Unclassified
5 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
6 2914759650 Rhizosphaericola mali Isolate Rhizosphere
7 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
8 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
9 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
10 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
11 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
12 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
13 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
14 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
15 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
18 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
19 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
20 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
21 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
22 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
23 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
24 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
25 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
26 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
32 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
59 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
62 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
70 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
89 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
90 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
96 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
97 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
137 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
138 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
139 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
140 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
141 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
142 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
143 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
144 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
205 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
206 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
207 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
208 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
209 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
212 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
213 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
214 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
215 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
216 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
217 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
218 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
219 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
220 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
221 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
222 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
223 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
224 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
225 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
227 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
228 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
229 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
230 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
231 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
232 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
233 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
234 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
235 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
236 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
237 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
238 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
239 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
240 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
241 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
242 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
243 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
244 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
245 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
246 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
247 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
248 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
249 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
250 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
251 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
252 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
253 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
254 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
255 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
256 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
257 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
258 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
259 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
261 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
262 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
263 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
264 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
265 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
266 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
267 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
268 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
269 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
274 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
275 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
276 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
277 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
278 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
279 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
280 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
283 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
284 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
285 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
286 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
287 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
288 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
289 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
290 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
291 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
292 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
293 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
294 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
295 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
296 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
297 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
298 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
299 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
300 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
301 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
306 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
307 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
308 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
309 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
310 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
311 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
312 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
313 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
314 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
315 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
316 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
317 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
318 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
319 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
320 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
321 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
322 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.18
Metatranscriptomes 0
Isolates 1.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.19
Nodule 0
Rhizoplane 0.65
Rhizosphere 89.11
Stem 0
Stem Tuber 0
Unclassified 5.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2391078 2162886007 Bacteria 2689
2 MRS1b_contig_9365721 2162886011 Bacteria 802
3 JGI24740J21852_10031747 3300001979 Bacteria 1699
4 JGI24737J22298_10004147 3300001990 Bacteria 5067
5 JGI24737J22298_10005859 3300001990 Bacteria 4230
6 JGI24735J21928_10000002 3300002067 Bacteria 624895
7 JGI24751J29686_10000010 3300002459 Bacteria 124816
8 JGI24751J29686_10000107 3300002459 Bacteria 44982
9 JGI25162J39368_1000173 3300002737 Bacteria 69607
10 JGI25162J39368_1000203 3300002737 Bacteria 62704
11 JGI25162J39368_1000486 3300002737 Bacteria 30351
12 JGI25157J39369_1014756 3300002741 Bacteria 967
13 JGI25164J39214_1000997 3300002772 Bacteria 8889
14 JGI25165J46597_1000588 3300003214 Bacteria 31654
15 JGI25165J46597_1015710 3300003214 Bacteria 1019
16 rootH1_10045496 3300003316 Bacteria 5208
17 rootH1_10133118 3300003316 Bacteria 1578
18 rootH2_10000984 3300003320 Bacteria 89440
19 rootH2_10169248 3300003320 Bacteria 3196
20 rootL2_10041802 3300003322 Bacteria 9397
21 rootL2_10092734 3300003322 Bacteria 5179
22 rootL2_10092735 3300003322 Unclassified 3676
23 rootL2_10109435 3300003322 Bacteria 4982
24 rootL2_10168338 3300003322 Bacteria 13097
25 rootH1_10021683 3300003323 Bacteria 35735
26 rootH1_10052679 3300003323 Unclassified 2851
27 rootH1_10070424 3300003323 Bacteria 4767
28 rootH1_10121455 3300003323 Bacteria 6700
29 rootH1_10280973 3300003323 Unclassified 4857
30 rootH1_10321219 3300003323 Bacteria 2731
31 JGI25160J50197_1006062 3300003354 Bacteria 4939
32 JGI25160J50197_1009107 3300003354 Unclassified 3712
33 Ga0065165_1008276 3300005262 Unclassified 4909
34 Ga0065714_10064435 3300005288 Bacteria 121919
35 Ga0065714_10238212 3300005288 Bacteria 801
36 Ga0065712_10000118 3300005290 Bacteria 121959
37 Ga0065712_10072090 3300005290 Bacteria 4911
38 Ga0065715_10089145 3300005293 Bacteria 13570
39 Ga0065715_10157525 3300005293 Bacteria 1649
40 Ga0065707_10001947 3300005295 Bacteria 7027
41 Ga0065707_10329536 3300005295 Bacteria 952
42 Ga0070658_10000041 3300005327 Bacteria 134208
43 Ga0070658_10056700 3300005327 Bacteria 3185
44 Ga0070658_10069446 3300005327 Bacteria 2882
45 Ga0070658_10124132 3300005327 Unclassified 2148
46 Ga0070658_10167905 3300005327 Bacteria 1843
47 Ga0070683_100005232 3300005329 Bacteria 10799
48 Ga0070683_100100762 3300005329 Bacteria 2719
49 Ga0070690_100016186 3300005330 Bacteria 4462
50 Ga0070670_100000172 3300005331 Bacteria 58670
51 Ga0070670_100073834 3300005331 Bacteria 2930
52 Ga0068869_100138990 3300005334 Bacteria 1874
53 Ga0068869_100619318 3300005334 Bacteria 916
54 Ga0070666_10003301 3300005335 Bacteria 9781
55 Ga0070666_10018568 3300005335 Bacteria 4475
56 Ga0070666_10038570 3300005335 Bacteria 3180
57 Ga0070680_100174214 3300005336 Bacteria 1811
58 Ga0070682_100000839 3300005337 Bacteria 17934
59 Ga0070682_100002934 3300005337 Bacteria 9462
60 Ga0070682_100054751 3300005337 Bacteria 2504
61 Ga0068868_100002654 3300005338 Bacteria 12413
62 Ga0068868_100164372 3300005338 Bacteria 1835
63 Ga0068868_100645825 3300005338 Bacteria 942
64 Ga0070660_100004005 3300005339 Bacteria 10169
65 Ga0070660_100006429 3300005339 Bacteria 8145
66 Ga0070689_100464983 3300005340 Bacteria 1078
67 Ga0070687_100073734 3300005343 Bacteria 1841
68 Ga0070661_100008270 3300005344 Bacteria 7183
69 Ga0070669_100005601 3300005353 Bacteria 9077
70 Ga0070669_100042724 3300005353 Bacteria 3299
71 Ga0070675_100039548 3300005354 Bacteria 3849
72 Ga0070671_100000755 3300005355 Bacteria 23162
73 Ga0070674_100090129 3300005356 Unclassified 2211
74 Ga0070673_100677954 3300005364 Unclassified 945
75 Ga0070688_100000001 3300005365 Bacteria 106331
76 Ga0070688_100484780 3300005365 Bacteria 930
77 Ga0070659_100005958 3300005366 Bacteria 8788
78 Ga0070659_100027729 3300005366 Bacteria 4366
79 Ga0070659_100032312 3300005366 Bacteria 4058
80 Ga0070667_100000002 3300005367 Bacteria 504831
81 Ga0070667_100015230 3300005367 Bacteria 6355
82 Ga0070709_10374286 3300005434 Bacteria 1057
83 Ga0070714_100000141 3300005435 Bacteria 57518
84 Ga0070713_100014049 3300005436 Bacteria 5929
85 Ga0070713_100182537 3300005436 Bacteria 1886
86 Ga0070701_10170175 3300005438 Bacteria 1268
87 Ga0070705_100013532 3300005440 Bacteria 4176
88 Ga0070700_100000316 3300005441 Bacteria 25114
89 Ga0070700_100066212 3300005441 Bacteria 2292
90 Ga0070694_100003332 3300005444 Bacteria 9614
91 Ga0070708_100175680 3300005445 Bacteria 2001
92 Ga0070708_100204996 3300005445 Bacteria 1847
93 Ga0070708_100268903 3300005445 Unclassified 1603
94 Ga0070663_100015752 3300005455 Bacteria 4891
95 Ga0070663_100025567 3300005455 Bacteria 3988
96 Ga0070678_100184423 3300005456 Bacteria 1711
97 Ga0070662_100000355 3300005457 Bacteria 27474
98 Ga0070662_100014364 3300005457 Bacteria 5288
99 Ga0070681_10005292 3300005458 Bacteria 12458
100 Ga0070681_10028068 3300005458 Bacteria 5657
101 Ga0070681_10033530 3300005458 Bacteria 5155
102 Ga0070681_10195056 3300005458 Bacteria 1944
103 Ga0070681_10590540 3300005458 Bacteria 1025
104 Ga0068867_100013911 3300005459 Bacteria 5696
105 Ga0068867_100051398 3300005459 Bacteria 3040
106 Ga0068867_100135043 3300005459 Bacteria 1922
107 Ga0068867_100331576 3300005459 Bacteria 1264
108 Ga0068867_100452692 3300005459 Bacteria 1094
109 Ga0068867_100747107 3300005459 Bacteria 868
110 Ga0070685_10000003 3300005466 Bacteria 283138
111 Ga0070685_10161057 3300005466 Bacteria 1430
112 Ga0070698_100115416 3300005471 Bacteria 2650
113 Ga0070699_100003179 3300005518 Bacteria 14533
114 Ga0070684_100093435 3300005535 Unclassified 2678
115 Ga0070684_100215163 3300005535 Bacteria 1752
116 Ga0070684_100550138 3300005535 Bacteria 1071
117 Ga0068853_100029000 3300005539 Bacteria 4660
118 Ga0068853_100048608 3300005539 Bacteria 3644
119 Ga0068853_100437641 3300005539 Bacteria 1228
120 Ga0068853_100513333 3300005539 Bacteria 1132
121 Ga0068853_100628064 3300005539 Bacteria 1021
122 Ga0070672_100000377 3300005543 Bacteria 25848
123 Ga0070686_100011670 3300005544 Bacteria 4990
124 Ga0070686_100321685 3300005544 Unclassified 1153
125 Ga0070696_100079768 3300005546 Bacteria 2316
126 Ga0070693_100154091 3300005547 Bacteria 1458
127 Ga0070693_100155131 3300005547 Unclassified 1453
128 Ga0070665_100009662 3300005548 Bacteria 9753
129 Ga0070665_100138148 3300005548 Bacteria 2440
130 Ga0070704_100375373 3300005549 Bacteria 1207
131 Ga0068855_100000199 3300005563 Bacteria 77676
132 Ga0068855_100000279 3300005563 Bacteria 63112
133 Ga0068855_100003108 3300005563 Bacteria 20322
134 Ga0068855_100010533 3300005563 Bacteria 11151
135 Ga0068855_100024600 3300005563 Bacteria 7204
136 Ga0068855_100052342 3300005563 Bacteria 4807
137 Ga0068855_100056250 3300005563 Bacteria 4616
138 Ga0068855_100074802 3300005563 Bacteria 3934
139 Ga0068855_100081103 3300005563 Unclassified 3761
140 Ga0068855_100163491 3300005563 Bacteria 2525
141 Ga0068855_100204246 3300005563 Bacteria 2223
142 Ga0068855_100436044 3300005563 Bacteria 1431
143 Ga0068855_100452875 3300005563 Unclassified 1400
144 Ga0068855_100776767 3300005563 Bacteria 1020
145 Ga0070664_100057821 3300005564 Bacteria 3297
146 Ga0068857_100005240 3300005577 Bacteria 11038
147 Ga0068857_100115936 3300005577 Unclassified 2410
148 Ga0068857_100320828 3300005577 Bacteria 1431
149 Ga0068854_100095075 3300005578 Bacteria 2224
150 Ga0068854_100335609 3300005578 Bacteria 1233
151 Ga0068854_100636275 3300005578 Bacteria 914
152 Ga0068856_100000006 3300005614 Bacteria 223827
153 Ga0068856_100009832 3300005614 Bacteria 9290
154 Ga0068856_100019146 3300005614 Bacteria 6645
155 Ga0068856_100020537 3300005614 Bacteria 6414
156 Ga0068856_100060690 3300005614 Bacteria 3736
157 Ga0068856_100458490 3300005614 Bacteria 1295
158 Ga0070702_100065755 3300005615 Bacteria 2124
159 Ga0068852_100013589 3300005616 Bacteria 6233
160 Ga0068852_100117732 3300005616 Unclassified 2426
161 Ga0068852_100224941 3300005616 Bacteria 1786
162 Ga0068852_100367894 3300005616 Bacteria 1408
163 Ga0068852_100379267 3300005616 Bacteria 1387
164 Ga0068852_100494587 3300005616 Bacteria 1217
165 Ga0068859_100000232 3300005617 Bacteria 54896
166 Ga0068859_100068491 3300005617 Bacteria 3583
167 Ga0068859_100409774 3300005617 Bacteria 1451
168 Ga0068864_100000002 3300005618 Bacteria 658857
169 Ga0068864_100000204 3300005618 Bacteria 53587
170 Ga0068864_100023593 3300005618 Bacteria 5168
171 Ga0068864_100030488 3300005618 Bacteria 4571
172 Ga0068864_100237518 3300005618 Bacteria 1688
173 Ga0068866_10035293 3300005718 Bacteria 2442
174 Ga0068866_10060247 3300005718 Unclassified 1967
175 Ga0068866_10068140 3300005718 Bacteria 1870
176 Ga0068866_10124539 3300005718 Bacteria 1457
177 Ga0068861_100001436 3300005719 Bacteria 15053
178 Ga0068851_10047670 3300005834 Bacteria 2171
179 Ga0068851_10226227 3300005834 Bacteria 1053
180 Ga0068851_10365837 3300005834 Bacteria 842
181 Ga0068863_100051999 3300005841 Unclassified 3883
182 Ga0068863_100406769 3300005841 Unclassified 1332
183 Ga0068863_100446762 3300005841 Unclassified 1269
184 Ga0068858_100002610 3300005842 Bacteria 18162
185 Ga0068858_100087171 3300005842 Bacteria 2903
186 Ga0068858_100624099 3300005842 Bacteria 1046
187 Ga0068860_100000499 3300005843 Bacteria 48692
188 Ga0068860_100004790 3300005843 Bacteria 13786
189 Ga0068860_100152663 3300005843 Bacteria 2224
190 Ga0068860_100338393 3300005843 Unclassified 1479
191 Ga0068860_100788811 3300005843 Bacteria 963
192 Ga0068860_101262279 3300005843 Bacteria 759
193 Ga0068862_100001709 3300005844 Bacteria 19896
194 Ga0081539_10000534 3300005985 Bacteria 78990
195 Ga0070717_10098075 3300006028 Bacteria 2484
196 Ga0070716_100025815 3300006173 Bacteria 3140
197 Ga0070716_100233193 3300006173 Bacteria 1244
198 Ga0075366_10000197 3300006195 Bacteria 26552
199 Ga0075366_10000210 3300006195 Bacteria 25723
200 Ga0097621_100000505 3300006237 Bacteria 27268
201 Ga0097621_100018435 3300006237 Bacteria 5331
202 Ga0097621_100023640 3300006237 Bacteria 4787
203 Ga0097621_100024308 3300006237 Bacteria 4729
204 Ga0097621_100027659 3300006237 Bacteria 4462
205 Ga0097621_100255418 3300006237 Bacteria 1536
206 Ga0068871_100000614 3300006358 Bacteria 24537
207 Ga0068871_100011508 3300006358 Bacteria 6489
208 Ga0068871_100032234 3300006358 Bacteria 4138
209 Ga0068871_100047136 3300006358 Bacteria 3474
210 Ga0075428_100209699 3300006844 Bacteria 2105
211 Ga0075430_100487295 3300006846 Unclassified 1017
212 Ga0075431_100145335 3300006847 Bacteria 2444
213 Ga0075431_100148256 3300006847 Bacteria 2416
214 Ga0075433_10583645 3300006852 Bacteria 982
215 Ga0075434_100192772 3300006871 Unclassified 2058
216 Ga0075434_100296995 3300006871 Bacteria 1635
217 Ga0075434_100844977 3300006871 Unclassified 931
218 Ga0097620_100000232 3300006931 Bacteria 54896
219 Ga0097620_100068491 3300006931 Bacteria 3583
220 Ga0097620_100409757 3300006931 Bacteria 1451
221 Ga0105251_10016317 3300009011 Unclassified 4018
222 Ga0105240_10000083 3300009093 Bacteria 192934
223 Ga0105240_10000692 3300009093 Bacteria 61955
224 Ga0105240_10004631 3300009093 Bacteria 20858
225 Ga0105240_10005237 3300009093 Bacteria 19384
226 Ga0105240_10031223 3300009093 Bacteria 6912
227 Ga0105240_10163816 3300009093 Unclassified 2639
228 Ga0105240_10170126 3300009093 Bacteria 2581
229 Ga0105240_10240823 3300009093 Bacteria 2097
230 Ga0105240_10310661 3300009093 Bacteria 1800
231 Ga0105240_10348830 3300009093 Unclassified 1680
232 Ga0105240_10383665 3300009093 Bacteria 1586
233 Ga0105240_10556833 3300009093 Bacteria 1268
234 Ga0105240_10704861 3300009093 Bacteria 1101
235 Ga0105240_11038150 3300009093 Bacteria 875
236 Ga0111539_10009141 3300009094 Bacteria 12536
237 Ga0111539_10174955 3300009094 Bacteria 2507
238 Ga0105245_10004153 3300009098 Bacteria 12869
239 Ga0105245_10031079 3300009098 Bacteria 4723
240 Ga0105245_10052236 3300009098 Bacteria 3665
241 Ga0105247_10011594 3300009101 Bacteria 5309
242 Ga0105247_10100625 3300009101 Unclassified 1847
243 Ga0105247_10148509 3300009101 Bacteria 1542
244 Ga0114129_10025727 3300009147 Bacteria 8337
245 Ga0105243_10017206 3300009148 Bacteria 5468
246 Ga0105243_10065566 3300009148 Bacteria 2917
247 Ga0105241_10001713 3300009174 Bacteria 16686
248 Ga0105241_10001784 3300009174 Bacteria 16342
249 Ga0105241_10020736 3300009174 Bacteria 4857
250 Ga0105241_10035486 3300009174 Bacteria 3751
251 Ga0105241_10064507 3300009174 Bacteria 2828
252 Ga0105241_10108168 3300009174 Bacteria 2222
253 Ga0105241_10373739 3300009174 Unclassified 1243
254 Ga0105241_10394710 3300009174 Bacteria 1212
255 Ga0105242_10010571 3300009176 Bacteria 7088
256 Ga0105242_10020526 3300009176 Bacteria 5181
257 Ga0105242_10095184 3300009176 Bacteria 2514
258 Ga0105242_10235115 3300009176 Unclassified 1644
259 Ga0105242_10301285 3300009176 Bacteria 1463
260 Ga0105242_10874891 3300009176 Bacteria 896
261 Ga0105248_10018980 3300009177 Bacteria 7602
262 Ga0105248_10077364 3300009177 Unclassified 3740
263 Ga0105248_10206786 3300009177 Bacteria 2212
264 Ga0105248_10298121 3300009177 Bacteria 1815
265 Ga0105237_10000198 3300009545 Bacteria 85302
266 Ga0105237_10003401 3300009545 Bacteria 18925
267 Ga0105237_10007709 3300009545 Bacteria 11759
268 Ga0105237_10009412 3300009545 Bacteria 10465
269 Ga0105237_10010796 3300009545 Bacteria 9695
270 Ga0105237_10047401 3300009545 Bacteria 4320
271 Ga0105237_10250147 3300009545 Bacteria 1775
272 Ga0105238_10020299 3300009551 Bacteria 6764
273 Ga0105238_10038848 3300009551 Bacteria 4833
274 Ga0105238_10139245 3300009551 Unclassified 2404
275 Ga0105238_10190621 3300009551 Bacteria 2026
276 Ga0105249_10002707 3300009553 Bacteria 15316
277 Ga0105249_10076714 3300009553 Bacteria 3098
278 Ga0105249_10781111 3300009553 Bacteria 1018
279 Ga0105239_10000011 3300010375 Bacteria 337500
280 Ga0105239_10000807 3300010375 Bacteria 44370
281 Ga0105239_10001867 3300010375 Bacteria 27574
282 Ga0105239_10003144 3300010375 Bacteria 20493
283 Ga0105239_10004417 3300010375 Bacteria 16825
284 Ga0105239_10007380 3300010375 Bacteria 12629
285 Ga0105239_10010926 3300010375 Bacteria 10142
286 Ga0105239_10010995 3300010375 Bacteria 10104
287 Ga0105239_10030977 3300010375 Bacteria 5884
288 Ga0105239_10089784 3300010375 Bacteria 3389
289 Ga0105239_10126822 3300010375 Bacteria 2837
290 Ga0105239_10202962 3300010375 Unclassified 2221
291 Ga0105239_10279406 3300010375 Bacteria 1879
292 Ga0105239_10807991 3300010375 Bacteria 1075
293 Ga0105239_10888540 3300010375 Bacteria 1023
294 Ga0105239_11177808 3300010375 Bacteria 883
295 Ga0105246_10137587 3300011119 Bacteria 1832
296 Ga0105246_10164313 3300011119 Bacteria 1694
297 Ga0105246_10323975 3300011119 Unclassified 1253
298 Ga0105246_10409259 3300011119 Unclassified 1129
299 Ga0157373_10000050 3300013100 Bacteria 106011
300 Ga0157373_10000464 3300013100 Bacteria 32220
301 Ga0157373_10004461 3300013100 Bacteria 10534
302 Ga0157373_10038403 3300013100 Bacteria 3432
303 Ga0157373_10193480 3300013100 Bacteria 1433
304 Ga0157371_10000749 3300013102 Bacteria 37566
305 Ga0157371_10006822 3300013102 Bacteria 9332
306 Ga0157371_10048872 3300013102 Unclassified 3006
307 Ga0157371_10072786 3300013102 Bacteria 2434
308 Ga0157370_10002241 3300013104 Bacteria 23522
309 Ga0157370_10095003 3300013104 Bacteria 2797
310 Ga0157370_10135395 3300013104 Unclassified 2296
311 Ga0157370_10199453 3300013104 Unclassified 1856
312 Ga0157370_10233244 3300013104 Bacteria 1703
313 Ga0157369_10054487 3300013105 Bacteria 4318
314 Ga0157369_10139987 3300013105 Bacteria 2561
315 Ga0157369_10147038 3300013105 Bacteria 2492
316 Ga0157369_10181258 3300013105 Bacteria 2216
317 Ga0157369_10555796 3300013105 Bacteria 1186
318 Ga0157369_10658161 3300013105 Unclassified 1080
319 Ga0157369_10664483 3300013105 Bacteria 1074
320 Ga0157374_10000536 3300013296 Bacteria 34007
321 Ga0157374_10000967 3300013296 Bacteria 24929
322 Ga0157374_10018304 3300013296 Bacteria 6181
323 Ga0157374_10056042 3300013296 Bacteria 3679
324 Ga0157374_10063148 3300013296 Bacteria 3473
325 Ga0157374_10140555 3300013296 Bacteria 2344
326 Ga0157374_10159843 3300013296 Bacteria 2194
327 Ga0157374_10495162 3300013296 Bacteria 1226
328 Ga0157378_10000667 3300013297 Bacteria 32316
329 Ga0157378_10008787 3300013297 Bacteria 8792
330 Ga0157378_10024277 3300013297 Bacteria 5332
331 Ga0157378_10030343 3300013297 Bacteria 4778
332 Ga0157378_10036775 3300013297 Bacteria 4333
333 Ga0157378_10074424 3300013297 Bacteria 3056
334 Ga0157378_10178913 3300013297 Bacteria 1994
335 Ga0157378_10195722 3300013297 Bacteria 1909
336 Ga0157378_10649254 3300013297 Bacteria 1071
337 Ga0157378_10723224 3300013297 Bacteria 1016
338 Ga0163162_10000005 3300013306 Bacteria 447195
339 Ga0163162_10008607 3300013306 Bacteria 9947
340 Ga0163162_10060121 3300013306 Bacteria 3834
341 Ga0163162_10067089 3300013306 Bacteria 3638
342 Ga0163162_10126637 3300013306 Bacteria 2661
343 Ga0163162_10212292 3300013306 Bacteria 2065
344 Ga0163162_10280779 3300013306 Bacteria 1797
345 Ga0163162_10330286 3300013306 Bacteria 1657
346 Ga0163162_10342524 3300013306 Bacteria 1627
347 Ga0163162_10428363 3300013306 Bacteria 1455
348 Ga0157372_10000011 3300013307 Bacteria 277202
349 Ga0157372_10001047 3300013307 Bacteria 30262
350 Ga0157372_10004867 3300013307 Bacteria 14272
351 Ga0157372_10025599 3300013307 Bacteria 6419
352 Ga0157372_10031907 3300013307 Bacteria 5773
353 Ga0157372_10042285 3300013307 Bacteria 5039
354 Ga0157372_10060278 3300013307 Unclassified 4246
355 Ga0157372_10067595 3300013307 Bacteria 4016
356 Ga0157372_10596446 3300013307 Bacteria 1288
357 Ga0157375_10051608 3300013308 Bacteria 4040
358 Ga0157375_10065528 3300013308 Bacteria 3621
359 Ga0157375_10068770 3300013308 Bacteria 3545
360 Ga0157375_10072228 3300013308 Bacteria 3467
361 Ga0157375_10690215 3300013308 Bacteria 1175
362 Ga0157375_10717282 3300013308 Bacteria 1153
363 Ga0157375_10729648 3300013308 Unclassified 1143
364 Ga0157375_10766894 3300013308 Unclassified 1115
365 Ga0163163_10000172 3300014325 Bacteria 67754
366 Ga0163163_10001034 3300014325 Bacteria 23573
367 Ga0163163_10040223 3300014325 Bacteria 4565
368 Ga0163163_10339434 3300014325 Unclassified 1557
369 Ga0163163_10343491 3300014325 Bacteria 1548
370 Ga0163163_10426859 3300014325 Bacteria 1385
371 Ga0163163_10455159 3300014325 Bacteria 1340
372 Ga0157379_10666086 3300014968 Bacteria 975
373 Ga0157376_10036879 3300014969 Bacteria 3963
374 Ga0157376_10045613 3300014969 Bacteria 3610
375 Ga0157376_10107979 3300014969 Bacteria 2444
376 Ga0157376_10315191 3300014969 Bacteria 1485
377 Ga0182006_1000267 3300015261 Bacteria 47415
378 Ga0163161_10007129 3300017792 Bacteria 7727
379 Ga0213872_10007757 3300021361 Bacteria 5246
380 Ga0213876_10004110 3300021384 Bacteria 8176
381 Ga0209436_102005 3300025208 Bacteria 6475
382 Ga0207427_100043 3300025231 Bacteria 249595
383 Ga0209437_100008 3300025233 Bacteria 921142
384 Ga0209437_100102 3300025233 Bacteria 224216
385 Ga0209437_100299 3300025233 Bacteria 69659
386 Ga0209646_1000017 3300025246 Bacteria 488265
387 Ga0209026_1000287 3300025250 Bacteria 57255
388 Ga0209026_1000314 3300025250 Bacteria 51962
389 Ga0209026_1000609 3300025250 Bacteria 22967
390 Ga0209233_1000366 3300025261 Bacteria 40794
391 Ga0209233_1001432 3300025261 Bacteria 9412
392 Ga0209233_1035303 3300025261 Bacteria 1131
393 Ga0209130_1003592 3300025284 Bacteria 6466
394 Ga0207426_1000363 3300025302 Bacteria 81330
395 Ga0207426_1000589 3300025302 Bacteria 48263
396 Ga0207656_10166036 3300025321 Bacteria 1053
397 Ga0207642_10048644 3300025899 Bacteria 1902
398 Ga0207710_10047459 3300025900 Bacteria 1920
399 Ga0207710_10150944 3300025900 Unclassified 1127
400 Ga0207680_10005691 3300025903 Bacteria 5970
401 Ga0207680_10013425 3300025903 Bacteria 4207
402 Ga0207680_10094569 3300025903 Bacteria 1908
403 Ga0207680_10163379 3300025903 Bacteria 1495
404 Ga0207647_10000043 3300025904 Bacteria 91109
405 Ga0207647_10000392 3300025904 Bacteria 35883
406 Ga0207647_10003538 3300025904 Bacteria 11715
407 Ga0207647_10127031 3300025904 Bacteria 1500
408 Ga0207647_10188236 3300025904 Bacteria 1197
409 Ga0207699_10290678 3300025906 Bacteria 1139
410 Ga0207645_10207646 3300025907 Bacteria 1289
411 Ga0207705_10000068 3300025909 Bacteria 134316
412 Ga0207705_10095062 3300025909 Bacteria 2187
413 Ga0207705_10129411 3300025909 Unclassified 1878
414 Ga0207705_10135521 3300025909 Bacteria 1835
415 Ga0207705_10229340 3300025909 Bacteria 1412
416 Ga0207654_10058939 3300025911 Bacteria 2237
417 Ga0207654_10334520 3300025911 Unclassified 1039
418 Ga0207654_10431531 3300025911 Bacteria 921
419 Ga0207707_10014848 3300025912 Bacteria 6783
420 Ga0207707_10119769 3300025912 Bacteria 2301
421 Ga0207707_10318043 3300025912 Bacteria 1344
422 Ga0207707_10490641 3300025912 Bacteria 1048
423 Ga0207695_10000020 3300025913 Bacteria 723025
424 Ga0207695_10000127 3300025913 Bacteria 227338
425 Ga0207695_10020429 3300025913 Bacteria 7585
426 Ga0207695_10040659 3300025913 Bacteria 4982
427 Ga0207695_10138763 3300025913 Bacteria 2382
428 Ga0207695_10224110 3300025913 Bacteria 1787
429 Ga0207695_10262447 3300025913 Bacteria 1624
430 Ga0207695_10351954 3300025913 Bacteria 1360
431 Ga0207671_10000254 3300025914 Bacteria 79974
432 Ga0207671_10002928 3300025914 Bacteria 17594
433 Ga0207671_10004487 3300025914 Bacteria 13301
434 Ga0207671_10014431 3300025914 Bacteria 6244
435 Ga0207671_10188761 3300025914 Bacteria 1606
436 Ga0207662_10051503 3300025918 Bacteria 2450
437 Ga0207657_10006159 3300025919 Bacteria 12468
438 Ga0207657_10077723 3300025919 Bacteria 2797
439 Ga0207657_10086320 3300025919 Bacteria 2627
440 Ga0207657_10164219 3300025919 Bacteria 1802
441 Ga0207649_10009942 3300025920 Bacteria 5214
442 Ga0207652_10011789 3300025921 Bacteria 7054
443 Ga0207652_10235917 3300025921 Bacteria 1649
444 Ga0207652_10506673 3300025921 Unclassified 1086
445 Ga0207646_10352675 3300025922 Unclassified 1330
446 Ga0207681_10003997 3300025923 Bacteria 9152
447 Ga0207694_10011623 3300025924 Bacteria 6642
448 Ga0207694_10046106 3300025924 Bacteria 3369
449 Ga0207694_10094115 3300025924 Bacteria 2367
450 Ga0207694_10171470 3300025924 Unclassified 1757
451 Ga0207650_10000001 3300025925 Bacteria 1545726
452 Ga0207650_10000002 3300025925 Bacteria 1439222
453 Ga0207650_10216813 3300025925 Bacteria 1539
454 Ga0207650_10336712 3300025925 Bacteria 1238
455 Ga0207659_10041633 3300025926 Bacteria 3217
456 Ga0207687_10012522 3300025927 Bacteria 5541
457 Ga0207687_10110726 3300025927 Bacteria 2037
458 Ga0207700_10012739 3300025928 Bacteria 5437
459 Ga0207664_10007396 3300025929 Bacteria 7613
460 Ga0207644_10000673 3300025931 Bacteria 21534
461 Ga0207644_10002294 3300025931 Bacteria 12410
462 Ga0207690_10003894 3300025932 Bacteria 8826
463 Ga0207690_10139792 3300025932 Bacteria 1783
464 Ga0207690_10319384 3300025932 Bacteria 1220
465 Ga0207706_10000738 3300025933 Bacteria 34077
466 Ga0207706_10005031 3300025933 Bacteria 12341
467 Ga0207706_10190436 3300025933 Unclassified 1801
468 Ga0207686_10033683 3300025934 Unclassified 3059
469 Ga0207686_10041954 3300025934 Bacteria 2793
470 Ga0207686_10150897 3300025934 Bacteria 1618
471 Ga0207709_10034119 3300025935 Bacteria 2996
472 Ga0207709_10445371 3300025935 Unclassified 1000
473 Ga0207670_10000012 3300025936 Bacteria 246808
474 Ga0207670_10731429 3300025936 Bacteria 821
475 Ga0207669_10107736 3300025937 Unclassified 1859
476 Ga0207704_10223540 3300025938 Bacteria 1395
477 Ga0207665_10200533 3300025939 Unclassified 1454
478 Ga0207691_10105989 3300025940 Bacteria 2504
479 Ga0207711_10000765 3300025941 Bacteria 31593
480 Ga0207711_10014165 3300025941 Bacteria 6624
481 Ga0207711_10016292 3300025941 Bacteria 6174
482 Ga0207711_10049413 3300025941 Unclassified 3602
483 Ga0207711_10084621 3300025941 Bacteria 2776
484 Ga0207711_10142602 3300025941 Bacteria 2156
485 Ga0207689_10154073 3300025942 Bacteria 1894
486 Ga0207661_10184629 3300025944 Bacteria 1824
487 Ga0207667_10000346 3300025949 Bacteria 63247
488 Ga0207667_10013817 3300025949 Bacteria 9224
489 Ga0207667_10017117 3300025949 Bacteria 8172
490 Ga0207667_10029813 3300025949 Bacteria 5911
491 Ga0207667_10049745 3300025949 Bacteria 4425
492 Ga0207667_10071445 3300025949 Bacteria 3608
493 Ga0207667_10269299 3300025949 Bacteria 1741
494 Ga0207667_10399166 3300025949 Unclassified 1400
495 Ga0207667_10656550 3300025949 Bacteria 1054
496 Ga0207651_10099358 3300025960 Bacteria 2155
497 Ga0207651_10442717 3300025960 Unclassified 1113
498 Ga0207712_10001316 3300025961 Bacteria 17028
499 Ga0207640_10040001 3300025981 Bacteria 2971
500 Ga0207640_10078886 3300025981 Bacteria 2243
501 Ga0207640_10320052 3300025981 Bacteria 1235
502 Ga0207640_10455240 3300025981 Bacteria 1056
503 Ga0207658_10000001 3300025986 Bacteria 1439333
504 Ga0207658_10072474 3300025986 Bacteria 2611
505 Ga0207677_10019158 3300026023 Bacteria 4126
506 Ga0207677_10112565 3300026023 Bacteria 2030
507 Ga0207677_10228864 3300026023 Bacteria 1496
508 Ga0207677_10333392 3300026023 Bacteria 1265
509 Ga0207677_10462314 3300026023 Bacteria 1089
510 Ga0207703_10010124 3300026035 Bacteria 7390
511 Ga0207703_10208133 3300026035 Bacteria 1742
512 Ga0207703_10533752 3300026035 Bacteria 1105
513 Ga0207639_10003351 3300026041 Bacteria 10774
514 Ga0207639_10036831 3300026041 Bacteria 3628
515 Ga0207639_10387198 3300026041 Bacteria 1257
516 Ga0207639_10475603 3300026041 Bacteria 1138
517 Ga0207678_10001342 3300026067 Bacteria 22684
518 Ga0207678_10060367 3300026067 Bacteria 3261
519 Ga0207708_10000061 3300026075 Bacteria 92741
520 Ga0207708_10040287 3300026075 Bacteria 3561
521 Ga0207702_10000023 3300026078 Bacteria 189234
522 Ga0207702_10023617 3300026078 Bacteria 5101
523 Ga0207702_10062592 3300026078 Unclassified 3178
524 Ga0207702_10146089 3300026078 Bacteria 2146
525 Ga0207702_10352100 3300026078 Bacteria 1409
526 Ga0207702_10495672 3300026078 Bacteria 1190
527 Ga0207641_10039803 3300026088 Bacteria 3932
528 Ga0207641_10368258 3300026088 Unclassified 1373
529 Ga0207641_10623886 3300026088 Bacteria 1057
530 Ga0207648_10020187 3300026089 Bacteria 6005
531 Ga0207648_10041787 3300026089 Unclassified 4027
532 Ga0207648_10107916 3300026089 Bacteria 2443
533 Ga0207648_10142292 3300026089 Bacteria 2114
534 Ga0207648_10170733 3300026089 Bacteria 1922
535 Ga0207648_10442745 3300026089 Bacteria 1182
536 Ga0207676_10000001 3300026095 Bacteria 1439222
537 Ga0207676_10000023 3300026095 Bacteria 266848
538 Ga0207676_10093434 3300026095 Bacteria 2476
539 Ga0207676_10394397 3300026095 Unclassified 1292
540 Ga0207676_10395580 3300026095 Bacteria 1290
541 Ga0207676_10423602 3300026095 Bacteria 1249
542 Ga0207676_10531560 3300026095 Bacteria 1121
543 Ga0207676_10556040 3300026095 Bacteria 1097
544 Ga0207674_10018675 3300026116 Bacteria 7531
545 Ga0207674_10041592 3300026116 Unclassified 4752
546 Ga0207674_10088374 3300026116 Bacteria 3092
547 Ga0207674_10137182 3300026116 Unclassified 2407
548 Ga0207674_10695018 3300026116 Unclassified 982
549 Ga0207675_100003627 3300026118 Bacteria 15059
550 Ga0207675_100422350 3300026118 Bacteria 1317
551 Ga0207675_100450227 3300026118 Bacteria 1276
552 Ga0207675_100628019 3300026118 Bacteria 1079
553 Ga0207683_10204870 3300026121 Bacteria 1794
554 Ga0207698_10027682 3300026142 Bacteria 4028
555 Ga0207698_10081202 3300026142 Bacteria 2616
556 Ga0207698_10304397 3300026142 Bacteria 1485
557 Ga0268266_10023782 3300028379 Bacteria 5214
558 Ga0268266_10165912 3300028379 Bacteria 2001
559 Ga0268265_10000455 3300028380 Bacteria 43315
560 Ga0268264_10000004 3300028381 Bacteria 1116842
561 Ga0268264_10007176 3300028381 Bacteria 9332
562 Ga0268264_10033142 3300028381 Bacteria 4241
563 Ga0268264_10133451 3300028381 Bacteria 2205
564 Ga0268264_10310452 3300028381 Unclassified 1488
565 Ga0268264_10955287 3300028381 Bacteria 862
566 Ga0307517_10015946 3300028786 Bacteria 9922
567 Ga0307515_10000002 3300028794 Bacteria 1231751
568 Ga0307515_10009896 3300028794 Bacteria 18361
569 Ga0307515_10013335 3300028794 Bacteria 15375
570 Ga0265338_10014144 3300028800 Bacteria 8920
571 Ga0265327_10000344 3300031251 Bacteria 87965
572 Ga0265327_10000551 3300031251 Bacteria 64082
573 Ga0265327_10045118 3300031251 Bacteria 2345
574 Ga0265316_10051620 3300031344 Bacteria 3230
575 Ga0307509_10044703 3300031507 Bacteria 4783
576 Ga0307408_100000859 3300031548 Bacteria 23895
577 Ga0307408_100003612 3300031548 Bacteria 10539
578 Ga0307408_100154291 3300031548 Bacteria 1816
579 Ga0307408_100251194 3300031548 Bacteria 1459
580 Ga0265314_10007935 3300031711 Bacteria 9157
581 Ga0307413_10249260 3300031824 Bacteria 1316
582 Ga0307406_10000578 3300031901 Bacteria 21116
583 Ga0307407_10163782 3300031903 Unclassified 1458
584 Ga0307407_10299047 3300031903 Bacteria 1121
585 Ga0307412_10003104 3300031911 Bacteria 9221
586 Ga0307412_10071980 3300031911 Bacteria 2361
587 Ga0307409_100029817 3300031995 Unclassified 3911
588 Ga0307409_100969708 3300031995 Bacteria 867
589 Ga0307416_100002833 3300032002 Bacteria 10091
590 Ga0307416_100082445 3300032002 Bacteria 2724
591 Ga0307416_100101227 3300032002 Unclassified 2509
592 Ga0307414_10003090 3300032004 Bacteria 8839
593 Ga0307411_10040125 3300032005 Unclassified 2967
594 Ga0307415_100001307 3300032126 Bacteria 11780
595 Ga0307415_100065230 3300032126 Bacteria 2536
596 Ga0307507_10000894 3300033179 Bacteria 66220
597 Ga0307510_10001986 3300033180 Bacteria 23038
598 Ga0373941_0014409 3300035115 Bacteria 2111
599 Ga0316574_0447586 3300035398 Unclassified 809
600 Ga0373925_0362181 3300037068 Bacteria 1179
601 Ga0395899_0000177 3300037312 Bacteria 94226
602 Ga0395899_0000853 3300037312 Bacteria 29193
603 Ga0395899_0004174 3300037312 Bacteria 11342
604 Ga0395899_0006897 3300037312 Bacteria 8797
605 Ga0395899_0022689 3300037312 Bacteria 4754
606 Ga0395899_0060313 3300037312 Bacteria 2795
607 Ga0395899_0113912 3300037312 Bacteria 1942
608 Ga0395899_0115396 3300037312 Bacteria 1927
609 Ga0395900_0000139 3300037418 Bacteria 122708
610 Ga0395900_0001986 3300037418 Bacteria 23094
611 Ga0395900_0003729 3300037418 Bacteria 16354
612 Ga0395900_0018576 3300037418 Bacteria 7091
613 Ga0395900_0154595 3300037418 Unclassified 2343
614 Ga0395900_0272592 3300037418 Bacteria 1686
615 Ga0395900_0468161 3300037418 Bacteria 1214
616 Ga0395898_0005317 3300037466 Bacteria 13919
617 Ga0395898_0018675 3300037466 Bacteria 7068
618 Ga0395898_0032257 3300037466 Bacteria 5228
619 Ga0395898_0398735 3300037466 Bacteria 1312
620 Ga0395905_0000169 3300037471 Bacteria 106579
621 Ga0395905_0013551 3300037471 Bacteria 7811
622 Ga0395905_0019014 3300037471 Bacteria 6514
623 Ga0436364_0874301 3300037853 Bacteria 1409
624 Ga0395901_0000838 3300038443 Bacteria 33913
625 Ga0395901_0006768 3300038443 Bacteria 11578
626 Ga0395901_0032319 3300038443 Bacteria 5400
627 Ga0395901_0084537 3300038443 Bacteria 3316
628 Ga0395901_0394157 3300038443 Unclassified 1423
629 Ga0395901_0707879 3300038443 Bacteria 1004
630 Ga0436365_1919188 3300039437 Bacteria 11957
631 Ga0436361_0616042 3300039447 Bacteria 10564
632 Ga0439448_0000952 3300042005 Bacteria 7141
633 Ga0439449_0102220 3300042007 Unclassified 1060
634 Ga0439455_0032835 3300042012 Bacteria 1299
635 Ga0439459_0049740 3300042438 Unclassified 917
636 Ga0466969_0026309 3300044656 Bacteria 2985
637 Ga0466972_0039698 3300044658 Bacteria 2296
638 Ga0466966_0002350 3300044684 Bacteria 12351
639 Ga0453684_0049946 3300044712 Bacteria 5508
640 Ga0466959_0033047 3300045049 Bacteria 3828
641 Ga0466959_0060585 3300045049 Bacteria 2754
642 Ga0451576_1168387 3300045051 Bacteria 804
643 Ga0466967_0153352 3300045976 Bacteria 2156
644 Ga0495638_0202920 3300046460 Bacteria 1118
645 Ga0495651_0280442 3300046462 Bacteria 1126
646 Ga0495650_0000036 3300046471 Bacteria 400633
647 Ga0495650_0038648 3300046471 Bacteria 2066
648 Ga0495650_0142101 3300046471 Bacteria 868
649 Ga0495585_0000704 3300046492 Bacteria 30119
650 Ga0495606_0000143 3300046507 Bacteria 123231
651 Ga0495606_0004123 3300046507 Bacteria 14756
652 Ga0495606_0012660 3300046507 Bacteria 6735
653 Ga0495606_0018189 3300046507 Bacteria 5281
654 Ga0495606_0037648 3300046507 Bacteria 3283
655 Ga0495610_0001747 3300046512 Bacteria 19026
656 Ga0495616_0006658 3300046513 Bacteria 6974
657 Ga0495616_0008524 3300046513 Bacteria 6062
658 Ga0495616_0009958 3300046513 Bacteria 5525
659 Ga0495631_0002540 3300046518 Bacteria 10248
660 Ga0495631_0027483 3300046518 Bacteria 2603
661 Ga0495632_0065365 3300046519 Unclassified 1757
662 Ga0495648_0010424 3300046524 Bacteria 7079
663 Ga0495648_0029392 3300046524 Bacteria 3648
664 Ga0495648_0044082 3300046524 Bacteria 2787
665 Ga0495652_0211389 3300046529 Bacteria 1464
666 Ga0495587_0138852 3300046536 Bacteria 1388
667 Ga0495609_0016092 3300046538 Bacteria 3489
668 Ga0495633_0000079 3300046558 Bacteria 127941
669 Ga0495668_0000010 3300046616 Bacteria 487308
670 Ga0495668_0000433 3300046616 Bacteria 54007
671 Ga0495668_0297876 3300046616 Bacteria 884
672 Ga0495625_0000009 3300046660 Bacteria 404954
673 Ga0495625_0000791 3300046660 Bacteria 43870
674 Ga0495625_0000932 3300046660 Bacteria 39330
675 Ga0495625_0008903 3300046660 Bacteria 8486
676 Ga0495625_0044684 3300046660 Bacteria 3205
677 Ga0495625_0073561 3300046660 Bacteria 2395
678 Ga0495625_0119685 3300046660 Bacteria 1793
679 Ga0495625_0130416 3300046660 Bacteria 1703
680 Ga0495661_0016299 3300046665 Bacteria 4929
681 Ga0495661_0048242 3300046665 Bacteria 2588
682 Ga0495661_0057144 3300046665 Bacteria 2331
683 Ga0495669_0124170 3300046684 Unclassified 1212
684 Ga0495649_0000008 3300046694 Bacteria 483706
685 Ga0495649_0098266 3300046694 Bacteria 1557
686 Ga0495649_0123979 3300046694 Bacteria 1365
687 Ga0495636_0165490 3300047318 Bacteria 998
688 Ga0495683_0007331 3300047323 Bacteria 5978
689 Ga0495687_002785 3300047443 Bacteria 13508
690 Ga0495687_005561 3300047443 Bacteria 7988
691 Ga0495685_027293 3300047447 Bacteria 1964
692 Ga0495686_0000107 3300047472 Bacteria 174386
693 Ga0495686_0000673 3300047472 Bacteria 46191
694 Ga0495686_0006124 3300047472 Bacteria 9314
695 Ga0495686_0057141 3300047472 Bacteria 2436
696 Ga0495686_0073217 3300047472 Bacteria 2105
697 Ga0495686_0153722 3300047472 Bacteria 1349
698 Ga0496102_0226286 3300048905 Bacteria 1764
699 Ga0496104_0558215 3300048907 Bacteria 1056
700 Ga0496108_0079183 3300048911 Unclassified 2782
701 Ga0496111_0280739 3300048914 Unclassified 1235
702 Ga0496126_0000024 3300048929 Bacteria 462877
703 Ga0496126_0424263 3300048929 Unclassified 1075
704 Ga0495678_111944 3300049459 Bacteria 929
705 Ga0495682_0029619 3300049460 Bacteria 2028
706 Ga0501291_006870 3300049514 Bacteria 1528
707 Ga0501297_007527 3300049520 Unclassified 1185
708 Ga0501298_004133 3300049521 Unclassified 2277
709 Ga0501299_023837 3300049522 Unclassified 1138
710 Ga0501032_0015253 3300049569 Bacteria 5425
711 Ga0501047_0166437 3300049581 Bacteria 2075
712 Ga0501067_0045071 3300049583 Bacteria 2450
713 Ga0501198_005615 3300049649 Unclassified 1770
714 Ga0501202_004419 3300049652 Unclassified 2461
715 Ga0501207_002239 3300049654 Unclassified 2485
716 Ga0501214_034984 3300049659 Unclassified 706
717 Ga0501216_007077 3300049660 Unclassified 1737
718 Ga0501217_000924 3300049661 Bacteria 5251
719 Ga0501223_002194 3300049663 Unclassified 4379
720 Ga0501227_000370 3300049665 Bacteria 9439
721 Ga0501227_083097 3300049665 Bacteria 841
722 Ga0501233_002952 3300049668 Unclassified 3036
723 Ga0501236_010870 3300049670 Unclassified 1200
724 Ga0501257_002411 3300049686 Bacteria 3940
725 Ga0501259_006855 3300049688 Unclassified 1818
726 Ga0501261_031759 3300049690 Bacteria 801
727 Ga0501221_016794 3300049704 Unclassified 1390
728 Ga0501225_0016490 3300049705 Unclassified 2054
729 Ga0501234_000506 3300049707 Bacteria 5986
730 Ga0501245_003271 3300049708 Unclassified 2195
731 Ga0501271_006854 3300049768 Bacteria 1138
732 Ga0501283_002273 3300049779 Unclassified 2493
733 Ga0501044_0215037 3300049823 Bacteria 1875
734 nmdc:mga0k408_152_c1 3300050493 Bacteria 35351
735 nmdc:mga0k408_52352_c1 3300050493 Bacteria 2366
736 nmdc:mga08y16_22785_c1 3300050511 Bacteria 6610
737 nmdc:mga08y16_256953_c1 3300050511 Bacteria 1804
738 nmdc:mga0n895_208125_c1 3300050512 Unclassified 1987
739 nmdc:mga0n895_45178_c1 3300050512 Bacteria 4297
740 nmdc:mga0a205_301389_c1 3300050515 Unclassified 1476
741 nmdc:mga0a205_63792_c1 3300050515 Unclassified 3558
742 Ga0500644_0000081 3300053088 Bacteria 58662
743 Ga0500646_0005142 3300053090 Bacteria 3312
744 Ga0500569_000086 3300053109 Bacteria 14960
745 Ga0500569_104085 3300053109 Bacteria 933
746 Ga0500608_011092 3300053122 Bacteria 3898
747 Ga0500614_127780 3300053123 Bacteria 753
748 Ga0500618_000040 3300053125 Bacteria 112548
749 Ga0500652_036884 3300053131 Bacteria 1949
750 Ga0500559_0038101 3300053136 Bacteria 2087
751 Ga0500564_007177 3300053138 Bacteria 4708
752 Ga0500568_0054376 3300053139 Bacteria 1566
753 Ga0500590_031986 3300053148 Bacteria 2728
754 Ga0500622_0000291 3300053156 Bacteria 51275
755 Ga0500634_0017478 3300053161 Bacteria 3840
756 Ga0500636_0160121 3300053177 Bacteria 1228
757 Ga0500661_006091 3300055283 Bacteria 2250

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005563 Ga0068855_100436044 Ga0068855_1004360441 173
2 3300013296 Ga0157374_10495162 Ga0157374_104951621 177
3 3300009093 Ga0105240_11038150 Ga0105240_110381502 179
4 3300025922 Ga0207646_10352675 Ga0207646_103526752 180
5 3300005563 Ga0068855_100010533 Ga0068855_1000105335 183
6 3300025949 Ga0207667_10029813 Ga0207667_100298133 183
7 3300005535 Ga0070684_100093435 Ga0070684_1000934353 185
8 3300006358 Ga0068871_100011508 Ga0068871_1000115082 185
9 3300026089 Ga0207648_10041787 Ga0207648_100417875 185
10 3300005563 Ga0068855_100003108 Ga0068855_1000031089 188
11 3300005842 Ga0068858_100002610 Ga0068858_1000026106 188
12 3300005843 Ga0068860_100004790 Ga0068860_1000047904 188
13 3300009093 Ga0105240_10005237 Ga0105240_100052375 188
14 3300009093 Ga0105240_10163816 Ga0105240_101638161 188
15 3300009176 Ga0105242_10874891 Ga0105242_108748911 188
16 3300013296 Ga0157374_10056042 Ga0157374_100560422 188
17 3300013297 Ga0157378_10178913 Ga0157378_101789132 188
18 3300014969 Ga0157376_10107979 Ga0157376_101079792 188
19 3300025903 Ga0207680_10005691 Ga0207680_100056911 188
20 3300025913 Ga0207695_10040659 Ga0207695_100406593 188
21 3300025934 Ga0207686_10041954 Ga0207686_100419541 188
22 3300025934 Ga0207686_10150897 Ga0207686_101508972 188
23 3300025949 Ga0207667_10049745 Ga0207667_100497452 188
24 3300028381 Ga0268264_10007176 Ga0268264_100071765 188
25 3300031711 Ga0265314_10007935 Ga0265314_100079352 190
26 3300009098 Ga0105245_10052236 Ga0105245_100522362 191
27 3300009101 Ga0105247_10148509 Ga0105247_101485092 191
28 3300009147 Ga0114129_10025727 Ga0114129_100257272 191
29 3300009176 Ga0105242_10095184 Ga0105242_100951842 191
30 3300013306 Ga0163162_10342524 Ga0163162_103425242 191
31 3300014325 Ga0163163_10040223 Ga0163163_100402234 191
32 3300014968 Ga0157379_10666086 Ga0157379_106660861 191
33 3300045051 Ga0451576_1168387 Ga0451576_1168387_134_763 191
34 3300005327 Ga0070658_10124132 Ga0070658_101241322 192
35 3300005455 Ga0070663_100025567 Ga0070663_1000255672 192
36 3300005563 Ga0068855_100081103 Ga0068855_1000811032 192
37 3300005616 Ga0068852_100117732 Ga0068852_1001177323 192
38 3300013104 Ga0157370_10199453 Ga0157370_101994532 192
39 3300013105 Ga0157369_10658161 Ga0157369_106581612 192
40 3300013307 Ga0157372_10067595 Ga0157372_100675952 192
41 3300025909 Ga0207705_10129411 Ga0207705_101294112 192
42 3300025921 Ga0207652_10506673 Ga0207652_105066732 192
43 3300026067 Ga0207678_10001342 Ga0207678_100013427 192
44 3300053148 Ga0500590_031986 Ga0500590_031986_2045_2683 194
45 3300005327 Ga0070658_10069446 Ga0070658_100694462 195
46 3300025909 Ga0207705_10229340 Ga0207705_102293403 195
47 3300049659 Ga0501214_034984 Ga0501214_034984_18_659 195
48 3300005356 Ga0070674_100090129 Ga0070674_1000901293 196
49 3300005445 Ga0070708_100204996 Ga0070708_1002049962 196
50 3300005718 Ga0068866_10060247 Ga0068866_100602473 196
51 3300009176 Ga0105242_10235115 Ga0105242_102351153 196
52 3300025937 Ga0207669_10107736 Ga0207669_101077363 196
53 3300025981 Ga0207640_10455240 Ga0207640_104552402 196
54 3300037312 Ga0395899_0060313 Ga0395899_0060313_1610_2299 196
55 3300037418 Ga0395900_0018576 Ga0395900_0018576_4289_4978 196
56 3300037471 Ga0395905_0000169 Ga0395905_0000169_9410_10099 196
57 3300038443 Ga0395901_0032319 Ga0395901_0032319_3235_3924 196
58 3300005548 Ga0070665_100138148 Ga0070665_1001381483 198
59 3300013105 Ga0157369_10181258 Ga0157369_101812582 198
60 3300005438 Ga0070701_10170175 Ga0070701_101701751 199
61 3300005535 Ga0070684_100550138 Ga0070684_1005501381 199
62 3300005544 Ga0070686_100011670 Ga0070686_1000116701 199
63 3300009093 Ga0105240_10556833 Ga0105240_105568332 199
64 3300025913 Ga0207695_10351954 Ga0207695_103519542 199
65 3300025932 Ga0207690_10319384 Ga0207690_103193842 199
66 3300037312 Ga0395899_0022689 Ga0395899_0022689_1854_2558 199
67 3300037418 Ga0395900_0272592 Ga0395900_0272592_632_1336 199
68 3300037466 Ga0395898_0018675 Ga0395898_0018675_5308_6012 199
69 3300038443 Ga0395901_0006768 Ga0395901_0006768_4351_5055 199
70 3300009093 Ga0105240_10240823 Ga0105240_102408232 200
71 3300025913 Ga0207695_10262447 Ga0207695_102624472 200
72 3300026023 Ga0207677_10333392 Ga0207677_103333922 200
73 3300028379 Ga0268266_10165912 Ga0268266_101659121 200
74 3300005329 Ga0070683_100100762 Ga0070683_1001007622 201
75 3300005535 Ga0070684_100215163 Ga0070684_1002151632 201
76 3300005834 Ga0068851_10365837 Ga0068851_103658371 201
77 3300013100 Ga0157373_10000050 Ga0157373_10000050102 201
78 3300013307 Ga0157372_10031907 Ga0157372_100319072 201
79 3300025944 Ga0207661_10184629 Ga0207661_101846291 201
80 3300005435 Ga0070714_100000141 Ga0070714_1000001415 202
81 3300005459 Ga0068867_100452692 Ga0068867_1004526922 202
82 3300005718 Ga0068866_10035293 Ga0068866_100352931 202
83 3300011119 Ga0105246_10323975 Ga0105246_103239752 202
84 3300025925 Ga0207650_10216813 Ga0207650_102168132 202
85 3300025929 Ga0207664_10007396 Ga0207664_100073965 202
86 3300026023 Ga0207677_10112565 Ga0207677_101125652 202
87 3300047443 Ga0495687_005561 Ga0495687_005561_389_1078 203
88 3300006173 Ga0070716_100233193 Ga0070716_1002331932 204
89 3300048929 Ga0496126_0000024 Ga0496126_0000024_166162_166902 205
90 iso_pu_bacteria 2929177148 2929179218 205
91 iso_pu_bacteria 2929921140 2929925485 205
92 iso_pu_bacteria 2945977869 2945981623 205
93 iso_pu_bacteria 2946013367 2946018974 205
94 iso_pu_bacteria 8003151029 8003155918 205
95 3300009551 Ga0105238_10190621 Ga0105238_101906212 206
96 3300031251 Ga0265327_10000551 Ga0265327_1000055136 206
97 3300037068 Ga0373925_0362181 Ga0373925_0362181_76_786 206
98 3300049569 Ga0501032_0015253 Ga0501032_0015253_3531_4232 206
99 iso_pu_bacteria 2599185184 2599478095 206
100 iso_pu_bacteria 2919437846 2919440241 206
101 iso_pu_bacteria 2928078545 2928080057 206
102 iso_pu_bacteria 2928147474 2928147485 206
103 iso_pu_bacteria 2929239360 2929240655 206
104 iso_pu_bacteria 2932082852 2932083596 206
105 3300005331 Ga0070670_100073834 Ga0070670_1000738344 208
106 3300005334 Ga0068869_100138990 Ga0068869_1001389902 208
107 3300005338 Ga0068868_100645825 Ga0068868_1006458252 208
108 3300005365 Ga0070688_100484780 Ga0070688_1004847801 208
109 3300005458 Ga0070681_10590540 Ga0070681_105905402 208
110 3300005466 Ga0070685_10161057 Ga0070685_101610571 208
111 3300005563 Ga0068855_100776767 Ga0068855_1007767671 208
112 3300005616 Ga0068852_100367894 Ga0068852_1003678942 208
113 3300005718 Ga0068866_10124539 Ga0068866_101245392 208
114 3300006195 Ga0075366_10000197 Ga0075366_1000019713 208
115 3300006237 Ga0097621_100018435 Ga0097621_1000184352 208
116 3300006237 Ga0097621_100024308 Ga0097621_1000243083 208
117 3300006358 Ga0068871_100032234 Ga0068871_1000322344 208
118 3300009098 Ga0105245_10031079 Ga0105245_100310794 208
119 3300009174 Ga0105241_10020736 Ga0105241_100207362 208
120 3300013297 Ga0157378_10723224 Ga0157378_107232242 208
121 3300013306 Ga0163162_10126637 Ga0163162_101266372 208
122 3300013308 Ga0157375_10051608 Ga0157375_100516086 208
123 3300014325 Ga0163163_10426859 Ga0163163_104268592 208
124 3300014969 Ga0157376_10036879 Ga0157376_100368791 208
125 3300025912 Ga0207707_10490641 Ga0207707_104906411 208
126 3300025919 Ga0207657_10164219 Ga0207657_101642192 208
127 3300025924 Ga0207694_10094115 Ga0207694_100941152 208
128 3300025925 Ga0207650_10336712 Ga0207650_103367122 208
129 3300025927 Ga0207687_10110726 Ga0207687_101107262 208
130 3300025940 Ga0207691_10105989 Ga0207691_101059892 208
131 3300025942 Ga0207689_10154073 Ga0207689_101540731 208
132 3300025949 Ga0207667_10656550 Ga0207667_106565502 208
133 3300026023 Ga0207677_10462314 Ga0207677_104623142 208
134 3300026095 Ga0207676_10423602 Ga0207676_104236021 208
135 3300026095 Ga0207676_10531560 Ga0207676_105315602 208
136 3300026116 Ga0207674_10088374 Ga0207674_100883742 208
137 3300026142 Ga0207698_10304397 Ga0207698_103043972 208
138 3300050493 nmdc:mga0k408_152_c1 nmdc:mga0k408_152_c1_10056_10754 208
139 iso_pu_bacteria 2738541302 2738852226 208
140 iso_pu_bacteria 2849281842 2849285489 208
141 3300003322 rootL2_10041802 rootL2_100418029 209
142 3300003323 rootH1_10070424 rootH1_100704244 209
143 3300003354 JGI25160J50197_1006062 JGI25160J50197_10060623 209
144 3300003354 JGI25160J50197_1009107 JGI25160J50197_10091074 209
145 3300005262 Ga0065165_1008276 Ga0065165_10082764 209
146 3300010375 Ga0105239_10279406 Ga0105239_102794062 209
147 3300013104 Ga0157370_10233244 Ga0157370_102332442 209
148 3300025208 Ga0209436_102005 Ga0209436_1020053 209
149 3300025284 Ga0209130_1003592 Ga0209130_10035923 209
150 3300025302 Ga0207426_1000363 Ga0207426_100036356 209
151 3300025302 Ga0207426_1000589 Ga0207426_100058929 209
152 3300031344 Ga0265316_10051620 Ga0265316_100516202 209
153 3300044658 Ga0466972_0039698 Ga0466972_0039698_123_806 209
154 3300045049 Ga0466959_0033047 Ga0466959_0033047_2668_3351 209
155 3300049581 Ga0501047_0166437 Ga0501047_0166437_345_1028 209
156 3300053131 Ga0500652_036884 Ga0500652_036884_1076_1759 209
157 3300053139 Ga0500568_0054376 Ga0500568_0054376_250_933 209
158 iso_pu_bacteria 2914759650 2914763436 209
159 3300001979 JGI24740J21852_10031747 JGI24740J21852_100317472 210
160 3300001990 JGI24737J22298_10004147 JGI24737J22298_100041475 210
161 3300001990 JGI24737J22298_10005859 JGI24737J22298_100058592 210
162 3300002067 JGI24735J21928_10000002 JGI24735J21928_1000000252 210
163 3300002737 JGI25162J39368_1000173 JGI25162J39368_100017375 210
164 3300002737 JGI25162J39368_1000203 JGI25162J39368_10002038 210
165 3300002737 JGI25162J39368_1000486 JGI25162J39368_100048623 210
166 3300002741 JGI25157J39369_1014756 JGI25157J39369_10147562 210
167 3300002772 JGI25164J39214_1000997 JGI25164J39214_10009974 210
168 3300003214 JGI25165J46597_1000588 JGI25165J46597_100058813 210
169 3300003214 JGI25165J46597_1015710 JGI25165J46597_10157101 210
170 3300003316 rootH1_10045496 rootH1_100454966 210
171 3300003320 rootH2_10000984 rootH2_1000098461 210
172 3300003320 rootH2_10169248 rootH2_101692482 210
173 3300003322 rootL2_10168338 rootL2_101683385 210
174 3300003323 rootH1_10021683 rootH1_1002168316 210
175 3300003323 rootH1_10052679 rootH1_100526791 210
176 3300003323 rootH1_10121455 rootH1_101214553 210
177 3300005327 Ga0070658_10000041 Ga0070658_1000004160 210
178 3300005327 Ga0070658_10167905 Ga0070658_101679052 210
179 3300005366 Ga0070659_100032312 Ga0070659_1000323122 210
180 3300005455 Ga0070663_100015752 Ga0070663_1000157523 210
181 3300005457 Ga0070662_100000355 Ga0070662_10000035528 210
182 3300005539 Ga0068853_100029000 Ga0068853_1000290001 210
183 3300005539 Ga0068853_100513333 Ga0068853_1005133331 210
184 3300005539 Ga0068853_100628064 Ga0068853_1006280641 210
185 3300005563 Ga0068855_100000199 Ga0068855_10000019923 210
186 3300005563 Ga0068855_100000279 Ga0068855_10000027940 210
187 3300005563 Ga0068855_100024600 Ga0068855_1000246006 210
188 3300005563 Ga0068855_100052342 Ga0068855_1000523423 210
189 3300005563 Ga0068855_100074802 Ga0068855_1000748023 210
190 3300005563 Ga0068855_100163491 Ga0068855_1001634913 210
191 3300005563 Ga0068855_100204246 Ga0068855_1002042463 210
192 3300005578 Ga0068854_100095075 Ga0068854_1000950752 210
193 3300005578 Ga0068854_100335609 Ga0068854_1003356092 210
194 3300005614 Ga0068856_100000006 Ga0068856_10000000658 210
195 3300005614 Ga0068856_100009832 Ga0068856_1000098322 210
196 3300005614 Ga0068856_100019146 Ga0068856_1000191462 210
197 3300005614 Ga0068856_100060690 Ga0068856_1000606904 210
198 3300005616 Ga0068852_100224941 Ga0068852_1002249413 210
199 3300005616 Ga0068852_100494587 Ga0068852_1004945872 210
200 3300005718 Ga0068866_10068140 Ga0068866_100681402 210
201 3300006195 Ga0075366_10000210 Ga0075366_1000021011 210
202 3300009093 Ga0105240_10000083 Ga0105240_10000083161 210
203 3300009093 Ga0105240_10004631 Ga0105240_1000463115 210
204 3300009093 Ga0105240_10031223 Ga0105240_100312236 210
205 3300009093 Ga0105240_10170126 Ga0105240_101701263 210
206 3300009093 Ga0105240_10310661 Ga0105240_103106611 210
207 3300009093 Ga0105240_10383665 Ga0105240_103836652 210
208 3300009174 Ga0105241_10001713 Ga0105241_1000171313 210
209 3300009174 Ga0105241_10001784 Ga0105241_1000178412 210
210 3300009174 Ga0105241_10064507 Ga0105241_100645073 210
211 3300009174 Ga0105241_10108168 Ga0105241_101081683 210
212 3300009174 Ga0105241_10394710 Ga0105241_103947101 210
213 3300009176 Ga0105242_10010571 Ga0105242_100105712 210
214 3300009545 Ga0105237_10000198 Ga0105237_1000019842 210
215 3300009545 Ga0105237_10003401 Ga0105237_100034019 210
216 3300009545 Ga0105237_10007709 Ga0105237_100077097 210
217 3300009545 Ga0105237_10009412 Ga0105237_1000941212 210
218 3300009545 Ga0105237_10047401 Ga0105237_100474012 210
219 3300009545 Ga0105237_10250147 Ga0105237_102501472 210
220 3300009551 Ga0105238_10139245 Ga0105238_101392452 210
221 3300010375 Ga0105239_10000011 Ga0105239_10000011307 210
222 3300010375 Ga0105239_10001867 Ga0105239_1000186721 210
223 3300010375 Ga0105239_10003144 Ga0105239_100031445 210
224 3300010375 Ga0105239_10007380 Ga0105239_1000738015 210
225 3300010375 Ga0105239_10010926 Ga0105239_1001092610 210
226 3300010375 Ga0105239_10010995 Ga0105239_100109952 210
227 3300010375 Ga0105239_10030977 Ga0105239_100309771 210
228 3300010375 Ga0105239_10089784 Ga0105239_100897843 210
229 3300010375 Ga0105239_10126822 Ga0105239_101268223 210
230 3300010375 Ga0105239_10807991 Ga0105239_108079912 210
231 3300011119 Ga0105246_10164313 Ga0105246_101643132 210
232 3300013100 Ga0157373_10000464 Ga0157373_100004643 210
233 3300013100 Ga0157373_10038403 Ga0157373_100384032 210
234 3300013102 Ga0157371_10000749 Ga0157371_1000074916 210
235 3300013102 Ga0157371_10072786 Ga0157371_100727862 210
236 3300013104 Ga0157370_10002241 Ga0157370_100022419 210
237 3300013105 Ga0157369_10054487 Ga0157369_100544872 210
238 3300013105 Ga0157369_10139987 Ga0157369_101399873 210
239 3300013105 Ga0157369_10555796 Ga0157369_105557962 210
240 3300013296 Ga0157374_10000536 Ga0157374_1000053612 210
241 3300013296 Ga0157374_10000967 Ga0157374_1000096712 210
242 3300013296 Ga0157374_10159843 Ga0157374_101598433 210
243 3300013297 Ga0157378_10024277 Ga0157378_100242773 210
244 3300013297 Ga0157378_10030343 Ga0157378_100303433 210
245 3300013306 Ga0163162_10000005 Ga0163162_10000005189 210
246 3300013306 Ga0163162_10008607 Ga0163162_100086073 210
247 3300013306 Ga0163162_10212292 Ga0163162_102122922 210
248 3300013306 Ga0163162_10330286 Ga0163162_103302862 210
249 3300013307 Ga0157372_10000011 Ga0157372_10000011197 210
250 3300013307 Ga0157372_10001047 Ga0157372_1000104714 210
251 3300013307 Ga0157372_10004867 Ga0157372_100048674 210
252 3300013307 Ga0157372_10042285 Ga0157372_100422854 210
253 3300013308 Ga0157375_10065528 Ga0157375_100655282 210
254 3300013308 Ga0157375_10068770 Ga0157375_100687703 210
255 3300013308 Ga0157375_10072228 Ga0157375_100722283 210
256 3300014325 Ga0163163_10339434 Ga0163163_103394341 210
257 3300014969 Ga0157376_10045613 Ga0157376_100456133 210
258 3300017792 Ga0163161_10007129 Ga0163161_100071298 210
259 3300021361 Ga0213872_10007757 Ga0213872_100077575 210
260 3300025231 Ga0207427_100043 Ga0207427_100043156 210
261 3300025233 Ga0209437_100008 Ga0209437_100008782 210
262 3300025233 Ga0209437_100102 Ga0209437_10010255 210
263 3300025233 Ga0209437_100299 Ga0209437_10029973 210
264 3300025250 Ga0209026_1000287 Ga0209026_100028720 210
265 3300025250 Ga0209026_1000609 Ga0209026_100060910 210
266 3300025261 Ga0209233_1000366 Ga0209233_100036638 210
267 3300025261 Ga0209233_1001432 Ga0209233_10014325 210
268 3300025261 Ga0209233_1035303 Ga0209233_10353032 210
269 3300025899 Ga0207642_10048644 Ga0207642_100486442 210
270 3300025904 Ga0207647_10000043 Ga0207647_1000004337 210
271 3300025904 Ga0207647_10000392 Ga0207647_1000039216 210
272 3300025904 Ga0207647_10127031 Ga0207647_101270311 210
273 3300025909 Ga0207705_10000068 Ga0207705_1000006865 210
274 3300025909 Ga0207705_10095062 Ga0207705_100950623 210
275 3300025911 Ga0207654_10058939 Ga0207654_100589392 210
276 3300025913 Ga0207695_10000127 Ga0207695_10000127161 210
277 3300025913 Ga0207695_10020429 Ga0207695_100204295 210
278 3300025913 Ga0207695_10138763 Ga0207695_101387633 210
279 3300025913 Ga0207695_10224110 Ga0207695_102241101 210
280 3300025914 Ga0207671_10000254 Ga0207671_1000025441 210
281 3300025914 Ga0207671_10002928 Ga0207671_100029289 210
282 3300025914 Ga0207671_10004487 Ga0207671_100044875 210
283 3300025914 Ga0207671_10188761 Ga0207671_101887611 210
284 3300025919 Ga0207657_10077723 Ga0207657_100777232 210
285 3300025924 Ga0207694_10171470 Ga0207694_101714702 210
286 3300025931 Ga0207644_10002294 Ga0207644_1000229414 210
287 3300025932 Ga0207690_10139792 Ga0207690_101397922 210
288 3300025933 Ga0207706_10000738 Ga0207706_1000073816 210
289 3300025949 Ga0207667_10000346 Ga0207667_1000034624 210
290 3300025949 Ga0207667_10013817 Ga0207667_100138178 210
291 3300025949 Ga0207667_10017117 Ga0207667_100171174 210
292 3300025949 Ga0207667_10071445 Ga0207667_100714453 210
293 3300025981 Ga0207640_10078886 Ga0207640_100788862 210
294 3300025981 Ga0207640_10320052 Ga0207640_103200521 210
295 3300026041 Ga0207639_10475603 Ga0207639_104756032 210
296 3300026067 Ga0207678_10060367 Ga0207678_100603673 210
297 3300026078 Ga0207702_10000023 Ga0207702_1000002342 210
298 3300026078 Ga0207702_10062592 Ga0207702_100625923 210
299 3300026078 Ga0207702_10146089 Ga0207702_101460892 210
300 3300026078 Ga0207702_10495672 Ga0207702_104956722 210
301 3300026142 Ga0207698_10081202 Ga0207698_100812023 210
302 3300028786 Ga0307517_10015946 Ga0307517_100159465 210
303 3300028794 Ga0307515_10009896 Ga0307515_1000989618 210
304 3300028794 Ga0307515_10013335 Ga0307515_100133352 210
305 3300028800 Ga0265338_10014144 Ga0265338_100141442 210
306 3300031507 Ga0307509_10044703 Ga0307509_100447034 210
307 3300033179 Ga0307507_10000894 Ga0307507_100008948 210
308 3300033180 Ga0307510_10001986 Ga0307510_100019864 210
309 3300035115 Ga0373941_0014409 Ga0373941_0014409_538_1227 210
310 3300035398 Ga0316574_0447586 Ga0316574_0447586_49_738 210
311 3300037312 Ga0395899_0000177 Ga0395899_0000177_15588_16277 210
312 3300037312 Ga0395899_0000853 Ga0395899_0000853_19151_19840 210
313 3300037312 Ga0395899_0006897 Ga0395899_0006897_6982_7671 210
314 3300037418 Ga0395900_0000139 Ga0395900_0000139_16935_17624 210
315 3300037418 Ga0395900_0001986 Ga0395900_0001986_15986_16675 210
316 3300037466 Ga0395898_0032257 Ga0395898_0032257_3440_4129 210
317 3300037466 Ga0395898_0398735 Ga0395898_0398735_120_809 210
318 3300037471 Ga0395905_0013551 Ga0395905_0013551_6420_7109 210
319 3300038443 Ga0395901_0000838 Ga0395901_0000838_4595_5284 210
320 3300039447 Ga0436361_0616042 Ga0436361_0616042_1478_2167 210
321 3300042005 Ga0439448_0000952 Ga0439448_0000952_578_1267 210
322 3300044656 Ga0466969_0026309 Ga0466969_0026309_1000_1689 210
323 3300044684 Ga0466966_0002350 Ga0466966_0002350_4112_4801 210
324 3300045049 Ga0466959_0060585 Ga0466959_0060585_1378_2067 210
325 3300046460 Ga0495638_0202920 Ga0495638_0202920_331_1017 210
326 3300046462 Ga0495651_0280442 Ga0495651_0280442_401_1090 210
327 3300046471 Ga0495650_0000036 Ga0495650_0000036_209592_210281 210
328 3300046471 Ga0495650_0038648 Ga0495650_0038648_428_1114 210
329 3300046471 Ga0495650_0142101 Ga0495650_0142101_101_790 210
330 3300046492 Ga0495585_0000704 Ga0495585_0000704_11461_12150 210
331 3300046507 Ga0495606_0000143 Ga0495606_0000143_71200_71889 210
332 3300046507 Ga0495606_0004123 Ga0495606_0004123_7865_8554 210
333 3300046507 Ga0495606_0012660 Ga0495606_0012660_1368_2057 210
334 3300046507 Ga0495606_0018189 Ga0495606_0018189_74_763 210
335 3300046507 Ga0495606_0037648 Ga0495606_0037648_2569_3258 210
336 3300046512 Ga0495610_0001747 Ga0495610_0001747_7722_8411 210
337 3300046513 Ga0495616_0006658 Ga0495616_0006658_4438_5124 210
338 3300046513 Ga0495616_0008524 Ga0495616_0008524_3590_4279 210
339 3300046513 Ga0495616_0009958 Ga0495616_0009958_947_1636 210
340 3300046518 Ga0495631_0002540 Ga0495631_0002540_3818_4507 210
341 3300046518 Ga0495631_0027483 Ga0495631_0027483_1368_2054 210
342 3300046519 Ga0495632_0065365 Ga0495632_0065365_213_899 210
343 3300046524 Ga0495648_0010424 Ga0495648_0010424_1592_2281 210
344 3300046524 Ga0495648_0029392 Ga0495648_0029392_87_776 210
345 3300046524 Ga0495648_0044082 Ga0495648_0044082_139_828 210
346 3300046529 Ga0495652_0211389 Ga0495652_0211389_213_902 210
347 3300046536 Ga0495587_0138852 Ga0495587_0138852_549_1238 210
348 3300046538 Ga0495609_0016092 Ga0495609_0016092_124_813 210
349 3300046558 Ga0495633_0000079 Ga0495633_0000079_90544_91233 210
350 3300046616 Ga0495668_0000010 Ga0495668_0000010_284128_284817 210
351 3300046660 Ga0495625_0000009 Ga0495625_0000009_29333_30022 210
352 3300046660 Ga0495625_0000791 Ga0495625_0000791_12710_13399 210
353 3300046660 Ga0495625_0000932 Ga0495625_0000932_7385_8074 210
354 3300046660 Ga0495625_0044684 Ga0495625_0044684_904_1590 210
355 3300046660 Ga0495625_0073561 Ga0495625_0073561_360_1049 210
356 3300046660 Ga0495625_0119685 Ga0495625_0119685_20_709 210
357 3300046660 Ga0495625_0130416 Ga0495625_0130416_888_1574 210
358 3300046665 Ga0495661_0016299 Ga0495661_0016299_167_856 210
359 3300046665 Ga0495661_0048242 Ga0495661_0048242_970_1656 210
360 3300046665 Ga0495661_0057144 Ga0495661_0057144_632_1318 210
361 3300046694 Ga0495649_0000008 Ga0495649_0000008_218536_219225 210
362 3300046694 Ga0495649_0123979 Ga0495649_0123979_598_1287 210
363 3300047323 Ga0495683_0007331 Ga0495683_0007331_1673_2362 210
364 3300047443 Ga0495687_002785 Ga0495687_002785_589_1278 210
365 3300047472 Ga0495686_0000107 Ga0495686_0000107_29299_29985 210
366 3300047472 Ga0495686_0000673 Ga0495686_0000673_13321_14007 210
367 3300047472 Ga0495686_0057141 Ga0495686_0057141_1362_2051 210
368 3300047472 Ga0495686_0073217 Ga0495686_0073217_291_980 210
369 3300047472 Ga0495686_0153722 Ga0495686_0153722_391_1080 210
370 3300048929 Ga0496126_0424263 Ga0496126_0424263_219_908 210
371 3300049459 Ga0495678_111944 Ga0495678_111944_132_818 210
372 3300049460 Ga0495682_0029619 Ga0495682_0029619_1037_1726 210
373 3300050493 nmdc:mga0k408_52352_c1 nmdc:mga0k408_52352_c1_512_1201 210
374 3300053088 Ga0500644_0000081 Ga0500644_0000081_2280_2966 210
375 3300053090 Ga0500646_0005142 Ga0500646_0005142_2356_3042 210
376 3300053109 Ga0500569_000086 Ga0500569_000086_14047_14733 210
377 3300053109 Ga0500569_104085 Ga0500569_104085_199_885 210
378 3300053122 Ga0500608_011092 Ga0500608_011092_120_809 210
379 3300053123 Ga0500614_127780 Ga0500614_127780_32_721 210
380 3300053125 Ga0500618_000040 Ga0500618_000040_34644_35333 210
381 3300053136 Ga0500559_0038101 Ga0500559_0038101_66_752 210
382 3300053161 Ga0500634_0017478 Ga0500634_0017478_1943_2629 210
383 3300053177 Ga0500636_0160121 Ga0500636_0160121_176_862 210
384 3300055283 Ga0500661_006091 Ga0500661_006091_1469_2155 210
385 3300005327 Ga0070658_10056700 Ga0070658_100567002 211
386 3300005330 Ga0070690_100016186 Ga0070690_1000161865 211
387 3300005335 Ga0070666_10003301 Ga0070666_100033016 211
388 3300005338 Ga0068868_100002654 Ga0068868_1000026544 211
389 3300005339 Ga0070660_100004005 Ga0070660_1000040055 211
390 3300005366 Ga0070659_100005958 Ga0070659_1000059586 211
391 3300005367 Ga0070667_100015230 Ga0070667_1000152302 211
392 3300005458 Ga0070681_10033530 Ga0070681_100335303 211
393 3300005458 Ga0070681_10195056 Ga0070681_101950562 211
394 3300005539 Ga0068853_100437641 Ga0068853_1004376412 211
395 3300005544 Ga0070686_100321685 Ga0070686_1003216852 211
396 3300005547 Ga0070693_100155131 Ga0070693_1001551311 211
397 3300005549 Ga0070704_100375373 Ga0070704_1003753732 211
398 3300005563 Ga0068855_100452875 Ga0068855_1004528751 211
399 3300005577 Ga0068857_100005240 Ga0068857_1000052407 211
400 3300005843 Ga0068860_100338393 Ga0068860_1003383932 211
401 3300006237 Ga0097621_100000505 Ga0097621_10000050512 211
402 3300006358 Ga0068871_100000614 Ga0068871_1000006144 211
403 3300009093 Ga0105240_10348830 Ga0105240_103488302 211
404 3300009093 Ga0105240_10704861 Ga0105240_107048612 211
405 3300009098 Ga0105245_10004153 Ga0105245_1000415318 211
406 3300009176 Ga0105242_10020526 Ga0105242_100205262 211
407 3300009177 Ga0105248_10077364 Ga0105248_100773644 211
408 3300009545 Ga0105237_10010796 Ga0105237_100107962 211
409 3300009551 Ga0105238_10038848 Ga0105238_100388481 211
410 3300010375 Ga0105239_10000807 Ga0105239_100008072 211
411 3300010375 Ga0105239_10202962 Ga0105239_102029623 211
412 3300013296 Ga0157374_10018304 Ga0157374_100183043 211
413 3300013296 Ga0157374_10140555 Ga0157374_101405551 211
414 3300013297 Ga0157378_10000667 Ga0157378_1000066737 211
415 3300013297 Ga0157378_10649254 Ga0157378_106492541 211
416 3300013308 Ga0157375_10766894 Ga0157375_107668942 211
417 3300015261 Ga0182006_1000267 Ga0182006_10002676 211
418 3300025900 Ga0207710_10047459 Ga0207710_100474592 211
419 3300025903 Ga0207680_10163379 Ga0207680_101633791 211
420 3300025904 Ga0207647_10003538 Ga0207647_100035382 211
421 3300025912 Ga0207707_10014848 Ga0207707_100148484 211
422 3300025912 Ga0207707_10119769 Ga0207707_101197693 211
423 3300025914 Ga0207671_10014431 Ga0207671_100144312 211
424 3300025919 Ga0207657_10086320 Ga0207657_100863202 211
425 3300025921 Ga0207652_10011789 Ga0207652_100117892 211
426 3300025921 Ga0207652_10235917 Ga0207652_102359172 211
427 3300025924 Ga0207694_10046106 Ga0207694_100461062 211
428 3300025927 Ga0207687_10012522 Ga0207687_100125223 211
429 3300025932 Ga0207690_10003894 Ga0207690_100038946 211
430 3300025941 Ga0207711_10016292 Ga0207711_100162922 211
431 3300025941 Ga0207711_10049413 Ga0207711_100494133 211
432 3300025949 Ga0207667_10399166 Ga0207667_103991662 211
433 3300025986 Ga0207658_10072474 Ga0207658_100724742 211
434 3300026023 Ga0207677_10019158 Ga0207677_100191583 211
435 3300026035 Ga0207703_10010124 Ga0207703_100101244 211
436 3300026041 Ga0207639_10003351 Ga0207639_100033512 211
437 3300026041 Ga0207639_10387198 Ga0207639_103871982 211
438 3300026095 Ga0207676_10395580 Ga0207676_103955802 211
439 3300026116 Ga0207674_10018675 Ga0207674_100186753 211
440 3300028381 Ga0268264_10310452 Ga0268264_103104522 211
441 3300046616 Ga0495668_0297876 Ga0495668_0297876_133_825 211
442 3300046660 Ga0495625_0008903 Ga0495625_0008903_1265_2062 211
443 3300046684 Ga0495669_0124170 Ga0495669_0124170_494_1189 211
444 3300046694 Ga0495649_0098266 Ga0495649_0098266_84_785 211
445 3300047318 Ga0495636_0165490 Ga0495636_0165490_267_959 211
446 3300047447 Ga0495685_027293 Ga0495685_027293_729_1421 211
447 3300053156 Ga0500622_0000291 Ga0500622_0000291_39222_39983 211
448 3300003322 rootL2_10092734 rootL2_100927343 212
449 3300003323 rootH1_10280973 rootH1_102809732 212
450 3300005295 Ga0065707_10329536 Ga0065707_103295361 212
451 3300005335 Ga0070666_10018568 Ga0070666_100185684 212
452 3300005337 Ga0070682_100000839 Ga0070682_10000083912 212
453 3300005340 Ga0070689_100464983 Ga0070689_1004649831 212
454 3300005353 Ga0070669_100005601 Ga0070669_1000056017 212
455 3300005355 Ga0070671_100000755 Ga0070671_1000007553 212
456 3300005367 Ga0070667_100000002 Ga0070667_100000002100 212
457 3300005466 Ga0070685_10000003 Ga0070685_1000000318 212
458 3300005548 Ga0070665_100009662 Ga0070665_1000096629 212
459 3300005616 Ga0068852_100379267 Ga0068852_1003792671 212
460 3300005618 Ga0068864_100000002 Ga0068864_100000002380 212
461 3300005843 Ga0068860_100000499 Ga0068860_10000049918 212
462 3300005844 Ga0068862_100001709 Ga0068862_1000017094 212
463 3300009101 Ga0105247_10011594 Ga0105247_100115945 212
464 3300009553 Ga0105249_10076714 Ga0105249_100767145 212
465 3300013100 Ga0157373_10193480 Ga0157373_101934802 212
466 3300013102 Ga0157371_10048872 Ga0157371_100488723 212
467 3300013105 Ga0157369_10664483 Ga0157369_106644831 212
468 3300013307 Ga0157372_10060278 Ga0157372_100602784 212
469 3300014325 Ga0163163_10001034 Ga0163163_100010349 212
470 3300025246 Ga0209646_1000017 Ga0209646_1000017151 212
471 3300025250 Ga0209026_1000314 Ga0209026_10003144 212
472 3300025903 Ga0207680_10094569 Ga0207680_100945692 212
473 3300025904 Ga0207647_10188236 Ga0207647_101882362 212
474 3300025909 Ga0207705_10135521 Ga0207705_101355212 212
475 3300025923 Ga0207681_10003997 Ga0207681_100039977 212
476 3300025925 Ga0207650_10000002 Ga0207650_10000002375 212
477 3300025931 Ga0207644_10000673 Ga0207644_100006733 212
478 3300025936 Ga0207670_10731429 Ga0207670_107314291 212
479 3300025941 Ga0207711_10000765 Ga0207711_1000076516 212
480 3300025986 Ga0207658_10000001 Ga0207658_10000001977 212
481 3300026035 Ga0207703_10208133 Ga0207703_102081331 212
482 3300026088 Ga0207641_10039803 Ga0207641_100398035 212
483 3300026095 Ga0207676_10000001 Ga0207676_10000001375 212
484 3300028379 Ga0268266_10023782 Ga0268266_100237825 212
485 3300028380 Ga0268265_10000455 Ga0268265_1000045511 212
486 3300028381 Ga0268264_10000004 Ga0268264_10000004393 212
487 3300031548 Ga0307408_100000859 Ga0307408_10000085911 212
488 3300037312 Ga0395899_0004174 Ga0395899_0004174_2176_2871 212
489 3300037312 Ga0395899_0113912 Ga0395899_0113912_689_1384 212
490 3300037312 Ga0395899_0115396 Ga0395899_0115396_336_1103 212
491 3300037418 Ga0395900_0003729 Ga0395900_0003729_10660_11355 212
492 3300037418 Ga0395900_0154595 Ga0395900_0154595_35_730 212
493 3300037466 Ga0395898_0005317 Ga0395898_0005317_8225_8920 212
494 3300037471 Ga0395905_0019014 Ga0395905_0019014_336_1031 212
495 3300038443 Ga0395901_0084537 Ga0395901_0084537_2332_3027 212
496 3300038443 Ga0395901_0707879 Ga0395901_0707879_35_730 212
497 3300003316 rootH1_10133118 rootH1_101331181 213
498 3300003322 rootL2_10109435 rootL2_101094352 213
499 3300003323 rootH1_10321219 rootH1_103212193 213
500 3300005288 Ga0065714_10238212 Ga0065714_102382121 213
501 3300005290 Ga0065712_10072090 Ga0065712_100720903 213
502 3300005337 Ga0070682_100054751 Ga0070682_1000547512 213
503 3300005365 Ga0070688_100000001 Ga0070688_10000000131 213
504 3300005434 Ga0070709_10374286 Ga0070709_103742862 213
505 3300005436 Ga0070713_100014049 Ga0070713_1000140496 213
506 3300005445 Ga0070708_100268903 Ga0070708_1002689032 213
507 3300005459 Ga0068867_100331576 Ga0068867_1003315762 213
508 3300005543 Ga0070672_100000377 Ga0070672_10000037713 213
509 3300005546 Ga0070696_100079768 Ga0070696_1000797681 213
510 3300005614 Ga0068856_100458490 Ga0068856_1004584902 213
511 3300005618 Ga0068864_100000204 Ga0068864_10000020452 213
512 3300005618 Ga0068864_100023593 Ga0068864_1000235933 213
513 3300005834 Ga0068851_10226227 Ga0068851_102262271 213
514 3300006028 Ga0070717_10098075 Ga0070717_100980752 213
515 3300006237 Ga0097621_100023640 Ga0097621_1000236403 213
516 3300006237 Ga0097621_100255418 Ga0097621_1002554182 213
517 3300006358 Ga0068871_100047136 Ga0068871_1000471363 213
518 3300006844 Ga0075428_100209699 Ga0075428_1002096992 213
519 3300006846 Ga0075430_100487295 Ga0075430_1004872952 213
520 3300006847 Ga0075431_100145335 Ga0075431_1001453352 213
521 3300009011 Ga0105251_10016317 Ga0105251_100163172 213
522 3300009093 Ga0105240_10000692 Ga0105240_1000069229 213
523 3300010375 Ga0105239_10004417 Ga0105239_100044179 213
524 3300011119 Ga0105246_10137587 Ga0105246_101375872 213
525 3300013104 Ga0157370_10135395 Ga0157370_101353952 213
526 3300013297 Ga0157378_10036775 Ga0157378_100367752 213
527 3300013297 Ga0157378_10074424 Ga0157378_100744244 213
528 3300013297 Ga0157378_10195722 Ga0157378_101957222 213
529 3300013306 Ga0163162_10280779 Ga0163162_102807792 213
530 3300013308 Ga0157375_10690215 Ga0157375_106902151 213
531 3300013308 Ga0157375_10729648 Ga0157375_107296481 213
532 3300025321 Ga0207656_10166036 Ga0207656_101660361 213
533 3300025906 Ga0207699_10290678 Ga0207699_102906782 213
534 3300025907 Ga0207645_10207646 Ga0207645_102076462 213
535 3300025913 Ga0207695_10000020 Ga0207695_1000002030 213
536 3300025928 Ga0207700_10012739 Ga0207700_100127392 213
537 3300025936 Ga0207670_10000012 Ga0207670_1000001275 213
538 3300025938 Ga0207704_10223540 Ga0207704_102235403 213
539 3300026035 Ga0207703_10533752 Ga0207703_105337521 213
540 3300026078 Ga0207702_10352100 Ga0207702_103521002 213
541 3300026089 Ga0207648_10442745 Ga0207648_104427452 213
542 3300026095 Ga0207676_10000023 Ga0207676_1000002351 213
543 3300026116 Ga0207674_10041592 Ga0207674_100415924 213
544 3300028794 Ga0307515_10000002 Ga0307515_10000002691 213
545 3300031995 Ga0307409_100969708 Ga0307409_1009697082 213
546 3300032002 Ga0307416_100101227 Ga0307416_1001012272 213
547 3300037418 Ga0395900_0468161 Ga0395900_0468161_370_1068 213
548 3300037853 Ga0436364_0874301 Ga0436364_0874301_181_903 213
549 3300044712 Ga0453684_0049946 Ga0453684_0049946_211_921 213
550 3300046616 Ga0495668_0000433 Ga0495668_0000433_45392_46102 213
551 3300049823 Ga0501044_0215037 Ga0501044_0215037_216_911 213
552 3300053138 Ga0500564_007177 Ga0500564_007177_2401_3096 213
553 2162886007 SwRhRL2b_contig_2391078 SwRhRL2b_0625.00000870 214
554 2162886011 MRS1b_contig_9365721 MRS1b_0463.00001610 214
555 3300002459 JGI24751J29686_10000010 JGI24751J29686_1000001022 214
556 3300002459 JGI24751J29686_10000107 JGI24751J29686_1000010731 214
557 3300003322 rootL2_10092735 rootL2_100927352 214
558 3300005288 Ga0065714_10064435 Ga0065714_1006443536 214
559 3300005290 Ga0065712_10000118 Ga0065712_1000011837 214
560 3300005293 Ga0065715_10089145 Ga0065715_100891458 214
561 3300005293 Ga0065715_10157525 Ga0065715_101575251 214
562 3300005295 Ga0065707_10001947 Ga0065707_100019474 214
563 3300005329 Ga0070683_100005232 Ga0070683_1000052326 214
564 3300005331 Ga0070670_100000172 Ga0070670_10000017230 214
565 3300005334 Ga0068869_100619318 Ga0068869_1006193181 214
566 3300005335 Ga0070666_10038570 Ga0070666_100385702 214
567 3300005336 Ga0070680_100174214 Ga0070680_1001742141 214
568 3300005337 Ga0070682_100002934 Ga0070682_1000029342 214
569 3300005338 Ga0068868_100164372 Ga0068868_1001643722 214
570 3300005339 Ga0070660_100006429 Ga0070660_1000064294 214
571 3300005343 Ga0070687_100073734 Ga0070687_1000737343 214
572 3300005344 Ga0070661_100008270 Ga0070661_1000082701 214
573 3300005353 Ga0070669_100042724 Ga0070669_1000427243 214
574 3300005354 Ga0070675_100039548 Ga0070675_1000395482 214
575 3300005364 Ga0070673_100677954 Ga0070673_1006779542 214
576 3300005366 Ga0070659_100027729 Ga0070659_1000277293 214
577 3300005436 Ga0070713_100182537 Ga0070713_1001825373 214
578 3300005440 Ga0070705_100013532 Ga0070705_1000135323 214
579 3300005441 Ga0070700_100000316 Ga0070700_10000031619 214
580 3300005441 Ga0070700_100066212 Ga0070700_1000662123 214
581 3300005444 Ga0070694_100003332 Ga0070694_1000033327 214
582 3300005445 Ga0070708_100175680 Ga0070708_1001756803 214
583 3300005456 Ga0070678_100184423 Ga0070678_1001844232 214
584 3300005457 Ga0070662_100014364 Ga0070662_1000143644 214
585 3300005458 Ga0070681_10005292 Ga0070681_100052927 214
586 3300005458 Ga0070681_10028068 Ga0070681_100280683 214
587 3300005459 Ga0068867_100013911 Ga0068867_1000139113 214
588 3300005459 Ga0068867_100051398 Ga0068867_1000513985 214
589 3300005459 Ga0068867_100135043 Ga0068867_1001350432 214
590 3300005459 Ga0068867_100747107 Ga0068867_1007471071 214
591 3300005471 Ga0070698_100115416 Ga0070698_1001154164 214
592 3300005518 Ga0070699_100003179 Ga0070699_1000031793 214
593 3300005539 Ga0068853_100048608 Ga0068853_1000486081 214
594 3300005547 Ga0070693_100154091 Ga0070693_1001540912 214
595 3300005563 Ga0068855_100056250 Ga0068855_1000562502 214
596 3300005564 Ga0070664_100057821 Ga0070664_1000578212 214
597 3300005577 Ga0068857_100115936 Ga0068857_1001159362 214
598 3300005577 Ga0068857_100320828 Ga0068857_1003208282 214
599 3300005578 Ga0068854_100636275 Ga0068854_1006362751 214
600 3300005614 Ga0068856_100020537 Ga0068856_1000205372 214
601 3300005615 Ga0070702_100065755 Ga0070702_1000657552 214
602 3300005616 Ga0068852_100013589 Ga0068852_1000135895 214
603 3300005617 Ga0068859_100000232 Ga0068859_10000023223 214
604 3300005617 Ga0068859_100068491 Ga0068859_1000684913 214
605 3300005617 Ga0068859_100409774 Ga0068859_1004097742 214
606 3300005618 Ga0068864_100030488 Ga0068864_1000304883 214
607 3300005618 Ga0068864_100237518 Ga0068864_1002375183 214
608 3300005719 Ga0068861_100001436 Ga0068861_1000014368 214
609 3300005834 Ga0068851_10047670 Ga0068851_100476702 214
610 3300005841 Ga0068863_100051999 Ga0068863_1000519992 214
611 3300005841 Ga0068863_100406769 Ga0068863_1004067692 214
612 3300005841 Ga0068863_100446762 Ga0068863_1004467622 214
613 3300005842 Ga0068858_100087171 Ga0068858_1000871712 214
614 3300005842 Ga0068858_100624099 Ga0068858_1006240992 214
615 3300005843 Ga0068860_100152663 Ga0068860_1001526632 214
616 3300005843 Ga0068860_100788811 Ga0068860_1007888111 214
617 3300005843 Ga0068860_101262279 Ga0068860_1012622791 214
618 3300005985 Ga0081539_10000534 Ga0081539_1000053458 214
619 3300006173 Ga0070716_100025815 Ga0070716_1000258153 214
620 3300006237 Ga0097621_100027659 Ga0097621_1000276593 214
621 3300006847 Ga0075431_100148256 Ga0075431_1001482563 214
622 3300006852 Ga0075433_10583645 Ga0075433_105836452 214
623 3300006871 Ga0075434_100192772 Ga0075434_1001927723 214
624 3300006871 Ga0075434_100296995 Ga0075434_1002969951 214
625 3300006871 Ga0075434_100844977 Ga0075434_1008449772 214
626 3300006931 Ga0097620_100000232 Ga0097620_10000023223 214
627 3300006931 Ga0097620_100068491 Ga0097620_1000684913 214
628 3300006931 Ga0097620_100409757 Ga0097620_1004097572 214
629 3300009094 Ga0111539_10009141 Ga0111539_100091413 214
630 3300009094 Ga0111539_10174955 Ga0111539_101749553 214
631 3300009101 Ga0105247_10100625 Ga0105247_101006251 214
632 3300009148 Ga0105243_10017206 Ga0105243_100172064 214
633 3300009148 Ga0105243_10065566 Ga0105243_100655661 214
634 3300009174 Ga0105241_10035486 Ga0105241_100354863 214
635 3300009174 Ga0105241_10373739 Ga0105241_103737392 214
636 3300009176 Ga0105242_10301285 Ga0105242_103012852 214
637 3300009177 Ga0105248_10018980 Ga0105248_100189804 214
638 3300009177 Ga0105248_10206786 Ga0105248_102067862 214
639 3300009177 Ga0105248_10298121 Ga0105248_102981213 214
640 3300009551 Ga0105238_10020299 Ga0105238_100202993 214
641 3300009553 Ga0105249_10002707 Ga0105249_100027073 214
642 3300009553 Ga0105249_10781111 Ga0105249_107811111 214
643 3300010375 Ga0105239_10888540 Ga0105239_108885401 214
644 3300010375 Ga0105239_11177808 Ga0105239_111778081 214
645 3300011119 Ga0105246_10409259 Ga0105246_104092592 214
646 3300013100 Ga0157373_10004461 Ga0157373_100044612 214
647 3300013102 Ga0157371_10006822 Ga0157371_100068227 214
648 3300013104 Ga0157370_10095003 Ga0157370_100950032 214
649 3300013105 Ga0157369_10147038 Ga0157369_101470383 214
650 3300013296 Ga0157374_10063148 Ga0157374_100631483 214
651 3300013297 Ga0157378_10008787 Ga0157378_100087872 214
652 3300013306 Ga0163162_10060121 Ga0163162_100601212 214
653 3300013306 Ga0163162_10067089 Ga0163162_100670893 214
654 3300013306 Ga0163162_10428363 Ga0163162_104283633 214
655 3300013307 Ga0157372_10025599 Ga0157372_100255992 214
656 3300013307 Ga0157372_10596446 Ga0157372_105964461 214
657 3300013308 Ga0157375_10717282 Ga0157375_107172822 214
658 3300014325 Ga0163163_10000172 Ga0163163_100001723 214
659 3300014325 Ga0163163_10343491 Ga0163163_103434912 214
660 3300014325 Ga0163163_10455159 Ga0163163_104551592 214
661 3300014969 Ga0157376_10315191 Ga0157376_103151912 214
662 3300021384 Ga0213876_10004110 Ga0213876_100041102 214
663 3300025900 Ga0207710_10150944 Ga0207710_101509441 214
664 3300025903 Ga0207680_10013425 Ga0207680_100134252 214
665 3300025911 Ga0207654_10334520 Ga0207654_103345201 214
666 3300025911 Ga0207654_10431531 Ga0207654_104315312 214
667 3300025912 Ga0207707_10318043 Ga0207707_103180431 214
668 3300025918 Ga0207662_10051503 Ga0207662_100515031 214
669 3300025919 Ga0207657_10006159 Ga0207657_100061593 214
670 3300025920 Ga0207649_10009942 Ga0207649_100099421 214
671 3300025924 Ga0207694_10011623 Ga0207694_100116233 214
672 3300025925 Ga0207650_10000001 Ga0207650_10000001490 214
673 3300025926 Ga0207659_10041633 Ga0207659_100416332 214
674 3300025933 Ga0207706_10005031 Ga0207706_100050318 214
675 3300025933 Ga0207706_10190436 Ga0207706_101904362 214
676 3300025934 Ga0207686_10033683 Ga0207686_100336831 214
677 3300025935 Ga0207709_10034119 Ga0207709_100341192 214
678 3300025935 Ga0207709_10445371 Ga0207709_104453712 214
679 3300025939 Ga0207665_10200533 Ga0207665_102005332 214
680 3300025941 Ga0207711_10014165 Ga0207711_100141653 214
681 3300025941 Ga0207711_10084621 Ga0207711_100846213 214
682 3300025941 Ga0207711_10142602 Ga0207711_101426022 214
683 3300025949 Ga0207667_10269299 Ga0207667_102692992 214
684 3300025960 Ga0207651_10099358 Ga0207651_100993583 214
685 3300025960 Ga0207651_10442717 Ga0207651_104427171 214
686 3300025961 Ga0207712_10001316 Ga0207712_100013163 214
687 3300025981 Ga0207640_10040001 Ga0207640_100400013 214
688 3300026023 Ga0207677_10228864 Ga0207677_102288642 214
689 3300026041 Ga0207639_10036831 Ga0207639_100368312 214
690 3300026075 Ga0207708_10000061 Ga0207708_1000006165 214
691 3300026075 Ga0207708_10040287 Ga0207708_100402873 214
692 3300026078 Ga0207702_10023617 Ga0207702_100236174 214
693 3300026088 Ga0207641_10368258 Ga0207641_103682583 214
694 3300026088 Ga0207641_10623886 Ga0207641_106238861 214
695 3300026089 Ga0207648_10020187 Ga0207648_100201873 214
696 3300026089 Ga0207648_10107916 Ga0207648_101079163 214
697 3300026089 Ga0207648_10142292 Ga0207648_101422925 214
698 3300026089 Ga0207648_10170733 Ga0207648_101707332 214
699 3300026095 Ga0207676_10093434 Ga0207676_100934342 214
700 3300026095 Ga0207676_10394397 Ga0207676_103943972 214
701 3300026095 Ga0207676_10556040 Ga0207676_105560402 214
702 3300026116 Ga0207674_10137182 Ga0207674_101371821 214
703 3300026116 Ga0207674_10695018 Ga0207674_106950181 214
704 3300026118 Ga0207675_100003627 Ga0207675_1000036277 214
705 3300026118 Ga0207675_100422350 Ga0207675_1004223502 214
706 3300026118 Ga0207675_100450227 Ga0207675_1004502272 214
707 3300026118 Ga0207675_100628019 Ga0207675_1006280192 214
708 3300026121 Ga0207683_10204870 Ga0207683_102048702 214
709 3300026142 Ga0207698_10027682 Ga0207698_100276822 214
710 3300028381 Ga0268264_10033142 Ga0268264_100331422 214
711 3300028381 Ga0268264_10133451 Ga0268264_101334511 214
712 3300028381 Ga0268264_10955287 Ga0268264_109552871 214
713 3300031251 Ga0265327_10000344 Ga0265327_1000034425 214
714 3300031251 Ga0265327_10045118 Ga0265327_100451182 214
715 3300031548 Ga0307408_100003612 Ga0307408_1000036123 214
716 3300031548 Ga0307408_100154291 Ga0307408_1001542912 214
717 3300031548 Ga0307408_100251194 Ga0307408_1002511941 214
718 3300031824 Ga0307413_10249260 Ga0307413_102492602 214
719 3300031901 Ga0307406_10000578 Ga0307406_1000057821 214
720 3300031903 Ga0307407_10163782 Ga0307407_101637821 214
721 3300031903 Ga0307407_10299047 Ga0307407_102990472 214
722 3300031911 Ga0307412_10003104 Ga0307412_100031043 214
723 3300031911 Ga0307412_10071980 Ga0307412_100719803 214
724 3300031995 Ga0307409_100029817 Ga0307409_1000298173 214
725 3300032002 Ga0307416_100002833 Ga0307416_1000028339 214
726 3300032002 Ga0307416_100082445 Ga0307416_1000824452 214
727 3300032004 Ga0307414_10003090 Ga0307414_100030903 214
728 3300032005 Ga0307411_10040125 Ga0307411_100401253 214
729 3300032126 Ga0307415_100001307 Ga0307415_1000013073 214
730 3300032126 Ga0307415_100065230 Ga0307415_1000652303 214
731 3300038443 Ga0395901_0394157 Ga0395901_0394157_640_1338 214
732 3300039437 Ga0436365_1919188 Ga0436365_1919188_4469_5185 214
733 3300042007 Ga0439449_0102220 Ga0439449_0102220_283_981 214
734 3300042012 Ga0439455_0032835 Ga0439455_0032835_221_925 214
735 3300042438 Ga0439459_0049740 Ga0439459_0049740_169_873 214
736 3300045976 Ga0466967_0153352 Ga0466967_0153352_844_1548 214
737 3300047472 Ga0495686_0006124 Ga0495686_0006124_6936_7637 214
738 3300048905 Ga0496102_0226286 Ga0496102_0226286_827_1525 214
739 3300048907 Ga0496104_0558215 Ga0496104_0558215_56_754 214
740 3300048911 Ga0496108_0079183 Ga0496108_0079183_1168_1866 214
741 3300048914 Ga0496111_0280739 Ga0496111_0280739_134_832 214
742 3300049514 Ga0501291_006870 Ga0501291_006870_169_867 214
743 3300049520 Ga0501297_007527 Ga0501297_007527_218_916 214
744 3300049521 Ga0501298_004133 Ga0501298_004133_568_1266 214
745 3300049522 Ga0501299_023837 Ga0501299_023837_288_986 214
746 3300049583 Ga0501067_0045071 Ga0501067_0045071_1094_1792 214
747 3300049649 Ga0501198_005615 Ga0501198_005615_994_1692 214
748 3300049652 Ga0501202_004419 Ga0501202_004419_920_1618 214
749 3300049654 Ga0501207_002239 Ga0501207_002239_779_1477 214
750 3300049660 Ga0501216_007077 Ga0501216_007077_947_1645 214
751 3300049661 Ga0501217_000924 Ga0501217_000924_1962_2660 214
752 3300049663 Ga0501223_002194 Ga0501223_002194_791_1489 214
753 3300049665 Ga0501227_000370 Ga0501227_000370_7012_7710 214
754 3300049665 Ga0501227_083097 Ga0501227_083097_23_721 214
755 3300049668 Ga0501233_002952 Ga0501233_002952_1735_2433 214
756 3300049670 Ga0501236_010870 Ga0501236_010870_451_1149 214
757 3300049686 Ga0501257_002411 Ga0501257_002411_3144_3911 214
758 3300049688 Ga0501259_006855 Ga0501259_006855_603_1301 214
759 3300049690 Ga0501261_031759 Ga0501261_031759_45_743 214
760 3300049704 Ga0501221_016794 Ga0501221_016794_498_1196 214
761 3300049705 Ga0501225_0016490 Ga0501225_0016490_1330_2028 214
762 3300049707 Ga0501234_000506 Ga0501234_000506_3140_3838 214
763 3300049708 Ga0501245_003271 Ga0501245_003271_361_1059 214
764 3300049768 Ga0501271_006854 Ga0501271_006854_272_970 214
765 3300049779 Ga0501283_002273 Ga0501283_002273_925_1623 214
766 3300050511 nmdc:mga08y16_22785_c1 nmdc:mga08y16_22785_c1_535_1233 214
767 3300050511 nmdc:mga08y16_256953_c1 nmdc:mga08y16_256953_c1_738_1436 214
768 3300050512 nmdc:mga0n895_208125_c1 nmdc:mga0n895_208125_c1_405_1103 214
769 3300050512 nmdc:mga0n895_45178_c1 nmdc:mga0n895_45178_c1_830_1528 214
770 3300050515 nmdc:mga0a205_301389_c1 nmdc:mga0a205_301389_c1_617_1315 214
771 3300050515 nmdc:mga0a205_63792_c1 nmdc:mga0a205_63792_c1_387_1085 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01988

VIT1

VIT family

49

260

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iu4-assembly1.cif.gz_A crystal structure of iron transporter vit1 with cobalt ion 0.8123 15 212
6iu4-assembly1.cif.gz_A crystal structure of iron transporter vit1 with cobalt ion 0.7525 15 212
6iu9-assembly4.cif.gz_H crystal structure of cytoplasmic metal binding domain with iron ions 0.6088 74 124
6iu9-assembly4.cif.gz_H crystal structure of cytoplasmic metal binding domain with iron ions 0.4399 74 124
2npk-assembly1.cif.gz_A an unusual twin-his arrangement in the pore of ammonia channels is essential for substrate conductance 0.4207 112 213
ID Description Score Start End Superfamily
af_I1K5I4_32_243_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8363 18 209 1.20.1260.10
af_Q4DKQ8_55_270_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8034 18 209 1.20.1260.10
af_K7MU65_40_256_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7967 18 209 1.20.1260.10
af_Q6ERE5_80_240_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7952 68 208 1.20.1260.10
af_Q59SS1_143_307_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7849 69 207 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A1F6UXV6-F1-model_v4 Rubrerythrin family protein 0.9328 11 212 GO:0005384
GO:0012505
GO:0016020
GO:0030026
AF-A0A1F5ECY8-F1-model_v4 VIT family protein 0.9324 15 213 GO:0005384
GO:0012505
GO:0016020
GO:0030026
AF-A0A661A5F6-F1-model_v4 Rubrerythrin family protein 0.932 15 212 GO:0005384
GO:0012505
GO:0016020
GO:0030026
AF-A0A2M6WWZ7-F1-model_v4 Rubrerythrin family protein 0.9298 16 212 GO:0005384
GO:0012505
GO:0016020
GO:0030026
AF-A0A7X8ASS7-F1-model_v4 Rubrerythrin family protein 0.9256 11 212 GO:0005384
GO:0012505
GO:0016020
GO:0016491
GO:0030026
GO:0046872

Feature Viewer

pLDDT pTM Quality
83.97 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map