F480089
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 771 | 322 | 757 | 225 |
Family's Representative Sequence
| Representative Sequence | 3300046660|Ga0495625_0008903|Ga0495625_0008903_1265_2062 |
| Length | 265 |
| Sequence | VFHYGEDNKRIHVSCQNVPVTKIKLFATFTTNRAPMQHHEHHVSSSEAIRDIVIGMSDGLTVPFALAAGLSGAITSSTLVVTAGIAEIVAGSIAMGLGGFLAGRTEQDHYRSELKREYEEVERVPEQEKLEVREVFAEFGLSETLQAQIADEMAKDKKKWVDFMMRYELGLEEPNPNRASRSAFTIGASYIVGGIIPLSPYILISHAGEALYYSCAVTLICLFIFGYFKSKMTGQPALSGAIKVVIIGTLAAGAAFGMAKLITGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 4 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 5 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 6 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 7 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 8 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 9 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 10 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 11 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 12 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 13 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 14 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 15 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 16 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 17 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 18 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 19 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 20 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 21 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 22 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 23 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 24 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 25 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 26 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 27 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 28 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 32 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 39 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 73 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 93 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 94 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 95 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 96 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 102 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 103 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 104 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 105 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 106 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 137 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 138 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 142 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 143 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 205 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 206 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 208 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 209 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 210 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 211 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 213 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 214 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 215 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 216 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 217 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 218 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 219 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 220 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 221 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 222 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 223 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 225 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 227 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 228 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 229 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 230 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 231 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 232 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 233 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 234 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 235 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 236 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 237 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 238 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 239 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 240 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 241 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 242 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 243 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 244 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 245 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 270 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 271 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 273 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 274 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 277 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 278 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 279 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 280 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 284 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 285 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 286 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 287 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 288 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 289 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 290 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 291 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 292 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 293 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 294 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 295 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 296 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 297 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 298 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 299 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 300 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 301 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 302 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 304 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 308 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 309 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 310 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 311 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 312 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 313 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 314 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 315 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 316 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 317 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 318 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 319 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 320 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 321 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 322 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.18 |
| Metatranscriptomes | 0 |
| Isolates | 1.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.19 |
| Nodule | 0 |
| Rhizoplane | 0.65 |
| Rhizosphere | 89.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2391078 | 2162886007 | Bacteria | 2689 |
| 2 | MRS1b_contig_9365721 | 2162886011 | Bacteria | 802 |
| 3 | JGI24740J21852_10031747 | 3300001979 | Bacteria | 1699 |
| 4 | JGI24737J22298_10004147 | 3300001990 | Bacteria | 5067 |
| 5 | JGI24737J22298_10005859 | 3300001990 | Bacteria | 4230 |
| 6 | JGI24735J21928_10000002 | 3300002067 | Bacteria | 624895 |
| 7 | JGI24751J29686_10000010 | 3300002459 | Bacteria | 124816 |
| 8 | JGI24751J29686_10000107 | 3300002459 | Bacteria | 44982 |
| 9 | JGI25162J39368_1000173 | 3300002737 | Bacteria | 69607 |
| 10 | JGI25162J39368_1000203 | 3300002737 | Bacteria | 62704 |
| 11 | JGI25162J39368_1000486 | 3300002737 | Bacteria | 30351 |
| 12 | JGI25157J39369_1014756 | 3300002741 | Bacteria | 967 |
| 13 | JGI25164J39214_1000997 | 3300002772 | Bacteria | 8889 |
| 14 | JGI25165J46597_1000588 | 3300003214 | Bacteria | 31654 |
| 15 | JGI25165J46597_1015710 | 3300003214 | Bacteria | 1019 |
| 16 | rootH1_10045496 | 3300003316 | Bacteria | 5208 |
| 17 | rootH1_10133118 | 3300003316 | Bacteria | 1578 |
| 18 | rootH2_10000984 | 3300003320 | Bacteria | 89440 |
| 19 | rootH2_10169248 | 3300003320 | Bacteria | 3196 |
| 20 | rootL2_10041802 | 3300003322 | Bacteria | 9397 |
| 21 | rootL2_10092734 | 3300003322 | Bacteria | 5179 |
| 22 | rootL2_10092735 | 3300003322 | Unclassified | 3676 |
| 23 | rootL2_10109435 | 3300003322 | Bacteria | 4982 |
| 24 | rootL2_10168338 | 3300003322 | Bacteria | 13097 |
| 25 | rootH1_10021683 | 3300003323 | Bacteria | 35735 |
| 26 | rootH1_10052679 | 3300003323 | Unclassified | 2851 |
| 27 | rootH1_10070424 | 3300003323 | Bacteria | 4767 |
| 28 | rootH1_10121455 | 3300003323 | Bacteria | 6700 |
| 29 | rootH1_10280973 | 3300003323 | Unclassified | 4857 |
| 30 | rootH1_10321219 | 3300003323 | Bacteria | 2731 |
| 31 | JGI25160J50197_1006062 | 3300003354 | Bacteria | 4939 |
| 32 | JGI25160J50197_1009107 | 3300003354 | Unclassified | 3712 |
| 33 | Ga0065165_1008276 | 3300005262 | Unclassified | 4909 |
| 34 | Ga0065714_10064435 | 3300005288 | Bacteria | 121919 |
| 35 | Ga0065714_10238212 | 3300005288 | Bacteria | 801 |
| 36 | Ga0065712_10000118 | 3300005290 | Bacteria | 121959 |
| 37 | Ga0065712_10072090 | 3300005290 | Bacteria | 4911 |
| 38 | Ga0065715_10089145 | 3300005293 | Bacteria | 13570 |
| 39 | Ga0065715_10157525 | 3300005293 | Bacteria | 1649 |
| 40 | Ga0065707_10001947 | 3300005295 | Bacteria | 7027 |
| 41 | Ga0065707_10329536 | 3300005295 | Bacteria | 952 |
| 42 | Ga0070658_10000041 | 3300005327 | Bacteria | 134208 |
| 43 | Ga0070658_10056700 | 3300005327 | Bacteria | 3185 |
| 44 | Ga0070658_10069446 | 3300005327 | Bacteria | 2882 |
| 45 | Ga0070658_10124132 | 3300005327 | Unclassified | 2148 |
| 46 | Ga0070658_10167905 | 3300005327 | Bacteria | 1843 |
| 47 | Ga0070683_100005232 | 3300005329 | Bacteria | 10799 |
| 48 | Ga0070683_100100762 | 3300005329 | Bacteria | 2719 |
| 49 | Ga0070690_100016186 | 3300005330 | Bacteria | 4462 |
| 50 | Ga0070670_100000172 | 3300005331 | Bacteria | 58670 |
| 51 | Ga0070670_100073834 | 3300005331 | Bacteria | 2930 |
| 52 | Ga0068869_100138990 | 3300005334 | Bacteria | 1874 |
| 53 | Ga0068869_100619318 | 3300005334 | Bacteria | 916 |
| 54 | Ga0070666_10003301 | 3300005335 | Bacteria | 9781 |
| 55 | Ga0070666_10018568 | 3300005335 | Bacteria | 4475 |
| 56 | Ga0070666_10038570 | 3300005335 | Bacteria | 3180 |
| 57 | Ga0070680_100174214 | 3300005336 | Bacteria | 1811 |
| 58 | Ga0070682_100000839 | 3300005337 | Bacteria | 17934 |
| 59 | Ga0070682_100002934 | 3300005337 | Bacteria | 9462 |
| 60 | Ga0070682_100054751 | 3300005337 | Bacteria | 2504 |
| 61 | Ga0068868_100002654 | 3300005338 | Bacteria | 12413 |
| 62 | Ga0068868_100164372 | 3300005338 | Bacteria | 1835 |
| 63 | Ga0068868_100645825 | 3300005338 | Bacteria | 942 |
| 64 | Ga0070660_100004005 | 3300005339 | Bacteria | 10169 |
| 65 | Ga0070660_100006429 | 3300005339 | Bacteria | 8145 |
| 66 | Ga0070689_100464983 | 3300005340 | Bacteria | 1078 |
| 67 | Ga0070687_100073734 | 3300005343 | Bacteria | 1841 |
| 68 | Ga0070661_100008270 | 3300005344 | Bacteria | 7183 |
| 69 | Ga0070669_100005601 | 3300005353 | Bacteria | 9077 |
| 70 | Ga0070669_100042724 | 3300005353 | Bacteria | 3299 |
| 71 | Ga0070675_100039548 | 3300005354 | Bacteria | 3849 |
| 72 | Ga0070671_100000755 | 3300005355 | Bacteria | 23162 |
| 73 | Ga0070674_100090129 | 3300005356 | Unclassified | 2211 |
| 74 | Ga0070673_100677954 | 3300005364 | Unclassified | 945 |
| 75 | Ga0070688_100000001 | 3300005365 | Bacteria | 106331 |
| 76 | Ga0070688_100484780 | 3300005365 | Bacteria | 930 |
| 77 | Ga0070659_100005958 | 3300005366 | Bacteria | 8788 |
| 78 | Ga0070659_100027729 | 3300005366 | Bacteria | 4366 |
| 79 | Ga0070659_100032312 | 3300005366 | Bacteria | 4058 |
| 80 | Ga0070667_100000002 | 3300005367 | Bacteria | 504831 |
| 81 | Ga0070667_100015230 | 3300005367 | Bacteria | 6355 |
| 82 | Ga0070709_10374286 | 3300005434 | Bacteria | 1057 |
| 83 | Ga0070714_100000141 | 3300005435 | Bacteria | 57518 |
| 84 | Ga0070713_100014049 | 3300005436 | Bacteria | 5929 |
| 85 | Ga0070713_100182537 | 3300005436 | Bacteria | 1886 |
| 86 | Ga0070701_10170175 | 3300005438 | Bacteria | 1268 |
| 87 | Ga0070705_100013532 | 3300005440 | Bacteria | 4176 |
| 88 | Ga0070700_100000316 | 3300005441 | Bacteria | 25114 |
| 89 | Ga0070700_100066212 | 3300005441 | Bacteria | 2292 |
| 90 | Ga0070694_100003332 | 3300005444 | Bacteria | 9614 |
| 91 | Ga0070708_100175680 | 3300005445 | Bacteria | 2001 |
| 92 | Ga0070708_100204996 | 3300005445 | Bacteria | 1847 |
| 93 | Ga0070708_100268903 | 3300005445 | Unclassified | 1603 |
| 94 | Ga0070663_100015752 | 3300005455 | Bacteria | 4891 |
| 95 | Ga0070663_100025567 | 3300005455 | Bacteria | 3988 |
| 96 | Ga0070678_100184423 | 3300005456 | Bacteria | 1711 |
| 97 | Ga0070662_100000355 | 3300005457 | Bacteria | 27474 |
| 98 | Ga0070662_100014364 | 3300005457 | Bacteria | 5288 |
| 99 | Ga0070681_10005292 | 3300005458 | Bacteria | 12458 |
| 100 | Ga0070681_10028068 | 3300005458 | Bacteria | 5657 |
| 101 | Ga0070681_10033530 | 3300005458 | Bacteria | 5155 |
| 102 | Ga0070681_10195056 | 3300005458 | Bacteria | 1944 |
| 103 | Ga0070681_10590540 | 3300005458 | Bacteria | 1025 |
| 104 | Ga0068867_100013911 | 3300005459 | Bacteria | 5696 |
| 105 | Ga0068867_100051398 | 3300005459 | Bacteria | 3040 |
| 106 | Ga0068867_100135043 | 3300005459 | Bacteria | 1922 |
| 107 | Ga0068867_100331576 | 3300005459 | Bacteria | 1264 |
| 108 | Ga0068867_100452692 | 3300005459 | Bacteria | 1094 |
| 109 | Ga0068867_100747107 | 3300005459 | Bacteria | 868 |
| 110 | Ga0070685_10000003 | 3300005466 | Bacteria | 283138 |
| 111 | Ga0070685_10161057 | 3300005466 | Bacteria | 1430 |
| 112 | Ga0070698_100115416 | 3300005471 | Bacteria | 2650 |
| 113 | Ga0070699_100003179 | 3300005518 | Bacteria | 14533 |
| 114 | Ga0070684_100093435 | 3300005535 | Unclassified | 2678 |
| 115 | Ga0070684_100215163 | 3300005535 | Bacteria | 1752 |
| 116 | Ga0070684_100550138 | 3300005535 | Bacteria | 1071 |
| 117 | Ga0068853_100029000 | 3300005539 | Bacteria | 4660 |
| 118 | Ga0068853_100048608 | 3300005539 | Bacteria | 3644 |
| 119 | Ga0068853_100437641 | 3300005539 | Bacteria | 1228 |
| 120 | Ga0068853_100513333 | 3300005539 | Bacteria | 1132 |
| 121 | Ga0068853_100628064 | 3300005539 | Bacteria | 1021 |
| 122 | Ga0070672_100000377 | 3300005543 | Bacteria | 25848 |
| 123 | Ga0070686_100011670 | 3300005544 | Bacteria | 4990 |
| 124 | Ga0070686_100321685 | 3300005544 | Unclassified | 1153 |
| 125 | Ga0070696_100079768 | 3300005546 | Bacteria | 2316 |
| 126 | Ga0070693_100154091 | 3300005547 | Bacteria | 1458 |
| 127 | Ga0070693_100155131 | 3300005547 | Unclassified | 1453 |
| 128 | Ga0070665_100009662 | 3300005548 | Bacteria | 9753 |
| 129 | Ga0070665_100138148 | 3300005548 | Bacteria | 2440 |
| 130 | Ga0070704_100375373 | 3300005549 | Bacteria | 1207 |
| 131 | Ga0068855_100000199 | 3300005563 | Bacteria | 77676 |
| 132 | Ga0068855_100000279 | 3300005563 | Bacteria | 63112 |
| 133 | Ga0068855_100003108 | 3300005563 | Bacteria | 20322 |
| 134 | Ga0068855_100010533 | 3300005563 | Bacteria | 11151 |
| 135 | Ga0068855_100024600 | 3300005563 | Bacteria | 7204 |
| 136 | Ga0068855_100052342 | 3300005563 | Bacteria | 4807 |
| 137 | Ga0068855_100056250 | 3300005563 | Bacteria | 4616 |
| 138 | Ga0068855_100074802 | 3300005563 | Bacteria | 3934 |
| 139 | Ga0068855_100081103 | 3300005563 | Unclassified | 3761 |
| 140 | Ga0068855_100163491 | 3300005563 | Bacteria | 2525 |
| 141 | Ga0068855_100204246 | 3300005563 | Bacteria | 2223 |
| 142 | Ga0068855_100436044 | 3300005563 | Bacteria | 1431 |
| 143 | Ga0068855_100452875 | 3300005563 | Unclassified | 1400 |
| 144 | Ga0068855_100776767 | 3300005563 | Bacteria | 1020 |
| 145 | Ga0070664_100057821 | 3300005564 | Bacteria | 3297 |
| 146 | Ga0068857_100005240 | 3300005577 | Bacteria | 11038 |
| 147 | Ga0068857_100115936 | 3300005577 | Unclassified | 2410 |
| 148 | Ga0068857_100320828 | 3300005577 | Bacteria | 1431 |
| 149 | Ga0068854_100095075 | 3300005578 | Bacteria | 2224 |
| 150 | Ga0068854_100335609 | 3300005578 | Bacteria | 1233 |
| 151 | Ga0068854_100636275 | 3300005578 | Bacteria | 914 |
| 152 | Ga0068856_100000006 | 3300005614 | Bacteria | 223827 |
| 153 | Ga0068856_100009832 | 3300005614 | Bacteria | 9290 |
| 154 | Ga0068856_100019146 | 3300005614 | Bacteria | 6645 |
| 155 | Ga0068856_100020537 | 3300005614 | Bacteria | 6414 |
| 156 | Ga0068856_100060690 | 3300005614 | Bacteria | 3736 |
| 157 | Ga0068856_100458490 | 3300005614 | Bacteria | 1295 |
| 158 | Ga0070702_100065755 | 3300005615 | Bacteria | 2124 |
| 159 | Ga0068852_100013589 | 3300005616 | Bacteria | 6233 |
| 160 | Ga0068852_100117732 | 3300005616 | Unclassified | 2426 |
| 161 | Ga0068852_100224941 | 3300005616 | Bacteria | 1786 |
| 162 | Ga0068852_100367894 | 3300005616 | Bacteria | 1408 |
| 163 | Ga0068852_100379267 | 3300005616 | Bacteria | 1387 |
| 164 | Ga0068852_100494587 | 3300005616 | Bacteria | 1217 |
| 165 | Ga0068859_100000232 | 3300005617 | Bacteria | 54896 |
| 166 | Ga0068859_100068491 | 3300005617 | Bacteria | 3583 |
| 167 | Ga0068859_100409774 | 3300005617 | Bacteria | 1451 |
| 168 | Ga0068864_100000002 | 3300005618 | Bacteria | 658857 |
| 169 | Ga0068864_100000204 | 3300005618 | Bacteria | 53587 |
| 170 | Ga0068864_100023593 | 3300005618 | Bacteria | 5168 |
| 171 | Ga0068864_100030488 | 3300005618 | Bacteria | 4571 |
| 172 | Ga0068864_100237518 | 3300005618 | Bacteria | 1688 |
| 173 | Ga0068866_10035293 | 3300005718 | Bacteria | 2442 |
| 174 | Ga0068866_10060247 | 3300005718 | Unclassified | 1967 |
| 175 | Ga0068866_10068140 | 3300005718 | Bacteria | 1870 |
| 176 | Ga0068866_10124539 | 3300005718 | Bacteria | 1457 |
| 177 | Ga0068861_100001436 | 3300005719 | Bacteria | 15053 |
| 178 | Ga0068851_10047670 | 3300005834 | Bacteria | 2171 |
| 179 | Ga0068851_10226227 | 3300005834 | Bacteria | 1053 |
| 180 | Ga0068851_10365837 | 3300005834 | Bacteria | 842 |
| 181 | Ga0068863_100051999 | 3300005841 | Unclassified | 3883 |
| 182 | Ga0068863_100406769 | 3300005841 | Unclassified | 1332 |
| 183 | Ga0068863_100446762 | 3300005841 | Unclassified | 1269 |
| 184 | Ga0068858_100002610 | 3300005842 | Bacteria | 18162 |
| 185 | Ga0068858_100087171 | 3300005842 | Bacteria | 2903 |
| 186 | Ga0068858_100624099 | 3300005842 | Bacteria | 1046 |
| 187 | Ga0068860_100000499 | 3300005843 | Bacteria | 48692 |
| 188 | Ga0068860_100004790 | 3300005843 | Bacteria | 13786 |
| 189 | Ga0068860_100152663 | 3300005843 | Bacteria | 2224 |
| 190 | Ga0068860_100338393 | 3300005843 | Unclassified | 1479 |
| 191 | Ga0068860_100788811 | 3300005843 | Bacteria | 963 |
| 192 | Ga0068860_101262279 | 3300005843 | Bacteria | 759 |
| 193 | Ga0068862_100001709 | 3300005844 | Bacteria | 19896 |
| 194 | Ga0081539_10000534 | 3300005985 | Bacteria | 78990 |
| 195 | Ga0070717_10098075 | 3300006028 | Bacteria | 2484 |
| 196 | Ga0070716_100025815 | 3300006173 | Bacteria | 3140 |
| 197 | Ga0070716_100233193 | 3300006173 | Bacteria | 1244 |
| 198 | Ga0075366_10000197 | 3300006195 | Bacteria | 26552 |
| 199 | Ga0075366_10000210 | 3300006195 | Bacteria | 25723 |
| 200 | Ga0097621_100000505 | 3300006237 | Bacteria | 27268 |
| 201 | Ga0097621_100018435 | 3300006237 | Bacteria | 5331 |
| 202 | Ga0097621_100023640 | 3300006237 | Bacteria | 4787 |
| 203 | Ga0097621_100024308 | 3300006237 | Bacteria | 4729 |
| 204 | Ga0097621_100027659 | 3300006237 | Bacteria | 4462 |
| 205 | Ga0097621_100255418 | 3300006237 | Bacteria | 1536 |
| 206 | Ga0068871_100000614 | 3300006358 | Bacteria | 24537 |
| 207 | Ga0068871_100011508 | 3300006358 | Bacteria | 6489 |
| 208 | Ga0068871_100032234 | 3300006358 | Bacteria | 4138 |
| 209 | Ga0068871_100047136 | 3300006358 | Bacteria | 3474 |
| 210 | Ga0075428_100209699 | 3300006844 | Bacteria | 2105 |
| 211 | Ga0075430_100487295 | 3300006846 | Unclassified | 1017 |
| 212 | Ga0075431_100145335 | 3300006847 | Bacteria | 2444 |
| 213 | Ga0075431_100148256 | 3300006847 | Bacteria | 2416 |
| 214 | Ga0075433_10583645 | 3300006852 | Bacteria | 982 |
| 215 | Ga0075434_100192772 | 3300006871 | Unclassified | 2058 |
| 216 | Ga0075434_100296995 | 3300006871 | Bacteria | 1635 |
| 217 | Ga0075434_100844977 | 3300006871 | Unclassified | 931 |
| 218 | Ga0097620_100000232 | 3300006931 | Bacteria | 54896 |
| 219 | Ga0097620_100068491 | 3300006931 | Bacteria | 3583 |
| 220 | Ga0097620_100409757 | 3300006931 | Bacteria | 1451 |
| 221 | Ga0105251_10016317 | 3300009011 | Unclassified | 4018 |
| 222 | Ga0105240_10000083 | 3300009093 | Bacteria | 192934 |
| 223 | Ga0105240_10000692 | 3300009093 | Bacteria | 61955 |
| 224 | Ga0105240_10004631 | 3300009093 | Bacteria | 20858 |
| 225 | Ga0105240_10005237 | 3300009093 | Bacteria | 19384 |
| 226 | Ga0105240_10031223 | 3300009093 | Bacteria | 6912 |
| 227 | Ga0105240_10163816 | 3300009093 | Unclassified | 2639 |
| 228 | Ga0105240_10170126 | 3300009093 | Bacteria | 2581 |
| 229 | Ga0105240_10240823 | 3300009093 | Bacteria | 2097 |
| 230 | Ga0105240_10310661 | 3300009093 | Bacteria | 1800 |
| 231 | Ga0105240_10348830 | 3300009093 | Unclassified | 1680 |
| 232 | Ga0105240_10383665 | 3300009093 | Bacteria | 1586 |
| 233 | Ga0105240_10556833 | 3300009093 | Bacteria | 1268 |
| 234 | Ga0105240_10704861 | 3300009093 | Bacteria | 1101 |
| 235 | Ga0105240_11038150 | 3300009093 | Bacteria | 875 |
| 236 | Ga0111539_10009141 | 3300009094 | Bacteria | 12536 |
| 237 | Ga0111539_10174955 | 3300009094 | Bacteria | 2507 |
| 238 | Ga0105245_10004153 | 3300009098 | Bacteria | 12869 |
| 239 | Ga0105245_10031079 | 3300009098 | Bacteria | 4723 |
| 240 | Ga0105245_10052236 | 3300009098 | Bacteria | 3665 |
| 241 | Ga0105247_10011594 | 3300009101 | Bacteria | 5309 |
| 242 | Ga0105247_10100625 | 3300009101 | Unclassified | 1847 |
| 243 | Ga0105247_10148509 | 3300009101 | Bacteria | 1542 |
| 244 | Ga0114129_10025727 | 3300009147 | Bacteria | 8337 |
| 245 | Ga0105243_10017206 | 3300009148 | Bacteria | 5468 |
| 246 | Ga0105243_10065566 | 3300009148 | Bacteria | 2917 |
| 247 | Ga0105241_10001713 | 3300009174 | Bacteria | 16686 |
| 248 | Ga0105241_10001784 | 3300009174 | Bacteria | 16342 |
| 249 | Ga0105241_10020736 | 3300009174 | Bacteria | 4857 |
| 250 | Ga0105241_10035486 | 3300009174 | Bacteria | 3751 |
| 251 | Ga0105241_10064507 | 3300009174 | Bacteria | 2828 |
| 252 | Ga0105241_10108168 | 3300009174 | Bacteria | 2222 |
| 253 | Ga0105241_10373739 | 3300009174 | Unclassified | 1243 |
| 254 | Ga0105241_10394710 | 3300009174 | Bacteria | 1212 |
| 255 | Ga0105242_10010571 | 3300009176 | Bacteria | 7088 |
| 256 | Ga0105242_10020526 | 3300009176 | Bacteria | 5181 |
| 257 | Ga0105242_10095184 | 3300009176 | Bacteria | 2514 |
| 258 | Ga0105242_10235115 | 3300009176 | Unclassified | 1644 |
| 259 | Ga0105242_10301285 | 3300009176 | Bacteria | 1463 |
| 260 | Ga0105242_10874891 | 3300009176 | Bacteria | 896 |
| 261 | Ga0105248_10018980 | 3300009177 | Bacteria | 7602 |
| 262 | Ga0105248_10077364 | 3300009177 | Unclassified | 3740 |
| 263 | Ga0105248_10206786 | 3300009177 | Bacteria | 2212 |
| 264 | Ga0105248_10298121 | 3300009177 | Bacteria | 1815 |
| 265 | Ga0105237_10000198 | 3300009545 | Bacteria | 85302 |
| 266 | Ga0105237_10003401 | 3300009545 | Bacteria | 18925 |
| 267 | Ga0105237_10007709 | 3300009545 | Bacteria | 11759 |
| 268 | Ga0105237_10009412 | 3300009545 | Bacteria | 10465 |
| 269 | Ga0105237_10010796 | 3300009545 | Bacteria | 9695 |
| 270 | Ga0105237_10047401 | 3300009545 | Bacteria | 4320 |
| 271 | Ga0105237_10250147 | 3300009545 | Bacteria | 1775 |
| 272 | Ga0105238_10020299 | 3300009551 | Bacteria | 6764 |
| 273 | Ga0105238_10038848 | 3300009551 | Bacteria | 4833 |
| 274 | Ga0105238_10139245 | 3300009551 | Unclassified | 2404 |
| 275 | Ga0105238_10190621 | 3300009551 | Bacteria | 2026 |
| 276 | Ga0105249_10002707 | 3300009553 | Bacteria | 15316 |
| 277 | Ga0105249_10076714 | 3300009553 | Bacteria | 3098 |
| 278 | Ga0105249_10781111 | 3300009553 | Bacteria | 1018 |
| 279 | Ga0105239_10000011 | 3300010375 | Bacteria | 337500 |
| 280 | Ga0105239_10000807 | 3300010375 | Bacteria | 44370 |
| 281 | Ga0105239_10001867 | 3300010375 | Bacteria | 27574 |
| 282 | Ga0105239_10003144 | 3300010375 | Bacteria | 20493 |
| 283 | Ga0105239_10004417 | 3300010375 | Bacteria | 16825 |
| 284 | Ga0105239_10007380 | 3300010375 | Bacteria | 12629 |
| 285 | Ga0105239_10010926 | 3300010375 | Bacteria | 10142 |
| 286 | Ga0105239_10010995 | 3300010375 | Bacteria | 10104 |
| 287 | Ga0105239_10030977 | 3300010375 | Bacteria | 5884 |
| 288 | Ga0105239_10089784 | 3300010375 | Bacteria | 3389 |
| 289 | Ga0105239_10126822 | 3300010375 | Bacteria | 2837 |
| 290 | Ga0105239_10202962 | 3300010375 | Unclassified | 2221 |
| 291 | Ga0105239_10279406 | 3300010375 | Bacteria | 1879 |
| 292 | Ga0105239_10807991 | 3300010375 | Bacteria | 1075 |
| 293 | Ga0105239_10888540 | 3300010375 | Bacteria | 1023 |
| 294 | Ga0105239_11177808 | 3300010375 | Bacteria | 883 |
| 295 | Ga0105246_10137587 | 3300011119 | Bacteria | 1832 |
| 296 | Ga0105246_10164313 | 3300011119 | Bacteria | 1694 |
| 297 | Ga0105246_10323975 | 3300011119 | Unclassified | 1253 |
| 298 | Ga0105246_10409259 | 3300011119 | Unclassified | 1129 |
| 299 | Ga0157373_10000050 | 3300013100 | Bacteria | 106011 |
| 300 | Ga0157373_10000464 | 3300013100 | Bacteria | 32220 |
| 301 | Ga0157373_10004461 | 3300013100 | Bacteria | 10534 |
| 302 | Ga0157373_10038403 | 3300013100 | Bacteria | 3432 |
| 303 | Ga0157373_10193480 | 3300013100 | Bacteria | 1433 |
| 304 | Ga0157371_10000749 | 3300013102 | Bacteria | 37566 |
| 305 | Ga0157371_10006822 | 3300013102 | Bacteria | 9332 |
| 306 | Ga0157371_10048872 | 3300013102 | Unclassified | 3006 |
| 307 | Ga0157371_10072786 | 3300013102 | Bacteria | 2434 |
| 308 | Ga0157370_10002241 | 3300013104 | Bacteria | 23522 |
| 309 | Ga0157370_10095003 | 3300013104 | Bacteria | 2797 |
| 310 | Ga0157370_10135395 | 3300013104 | Unclassified | 2296 |
| 311 | Ga0157370_10199453 | 3300013104 | Unclassified | 1856 |
| 312 | Ga0157370_10233244 | 3300013104 | Bacteria | 1703 |
| 313 | Ga0157369_10054487 | 3300013105 | Bacteria | 4318 |
| 314 | Ga0157369_10139987 | 3300013105 | Bacteria | 2561 |
| 315 | Ga0157369_10147038 | 3300013105 | Bacteria | 2492 |
| 316 | Ga0157369_10181258 | 3300013105 | Bacteria | 2216 |
| 317 | Ga0157369_10555796 | 3300013105 | Bacteria | 1186 |
| 318 | Ga0157369_10658161 | 3300013105 | Unclassified | 1080 |
| 319 | Ga0157369_10664483 | 3300013105 | Bacteria | 1074 |
| 320 | Ga0157374_10000536 | 3300013296 | Bacteria | 34007 |
| 321 | Ga0157374_10000967 | 3300013296 | Bacteria | 24929 |
| 322 | Ga0157374_10018304 | 3300013296 | Bacteria | 6181 |
| 323 | Ga0157374_10056042 | 3300013296 | Bacteria | 3679 |
| 324 | Ga0157374_10063148 | 3300013296 | Bacteria | 3473 |
| 325 | Ga0157374_10140555 | 3300013296 | Bacteria | 2344 |
| 326 | Ga0157374_10159843 | 3300013296 | Bacteria | 2194 |
| 327 | Ga0157374_10495162 | 3300013296 | Bacteria | 1226 |
| 328 | Ga0157378_10000667 | 3300013297 | Bacteria | 32316 |
| 329 | Ga0157378_10008787 | 3300013297 | Bacteria | 8792 |
| 330 | Ga0157378_10024277 | 3300013297 | Bacteria | 5332 |
| 331 | Ga0157378_10030343 | 3300013297 | Bacteria | 4778 |
| 332 | Ga0157378_10036775 | 3300013297 | Bacteria | 4333 |
| 333 | Ga0157378_10074424 | 3300013297 | Bacteria | 3056 |
| 334 | Ga0157378_10178913 | 3300013297 | Bacteria | 1994 |
| 335 | Ga0157378_10195722 | 3300013297 | Bacteria | 1909 |
| 336 | Ga0157378_10649254 | 3300013297 | Bacteria | 1071 |
| 337 | Ga0157378_10723224 | 3300013297 | Bacteria | 1016 |
| 338 | Ga0163162_10000005 | 3300013306 | Bacteria | 447195 |
| 339 | Ga0163162_10008607 | 3300013306 | Bacteria | 9947 |
| 340 | Ga0163162_10060121 | 3300013306 | Bacteria | 3834 |
| 341 | Ga0163162_10067089 | 3300013306 | Bacteria | 3638 |
| 342 | Ga0163162_10126637 | 3300013306 | Bacteria | 2661 |
| 343 | Ga0163162_10212292 | 3300013306 | Bacteria | 2065 |
| 344 | Ga0163162_10280779 | 3300013306 | Bacteria | 1797 |
| 345 | Ga0163162_10330286 | 3300013306 | Bacteria | 1657 |
| 346 | Ga0163162_10342524 | 3300013306 | Bacteria | 1627 |
| 347 | Ga0163162_10428363 | 3300013306 | Bacteria | 1455 |
| 348 | Ga0157372_10000011 | 3300013307 | Bacteria | 277202 |
| 349 | Ga0157372_10001047 | 3300013307 | Bacteria | 30262 |
| 350 | Ga0157372_10004867 | 3300013307 | Bacteria | 14272 |
| 351 | Ga0157372_10025599 | 3300013307 | Bacteria | 6419 |
| 352 | Ga0157372_10031907 | 3300013307 | Bacteria | 5773 |
| 353 | Ga0157372_10042285 | 3300013307 | Bacteria | 5039 |
| 354 | Ga0157372_10060278 | 3300013307 | Unclassified | 4246 |
| 355 | Ga0157372_10067595 | 3300013307 | Bacteria | 4016 |
| 356 | Ga0157372_10596446 | 3300013307 | Bacteria | 1288 |
| 357 | Ga0157375_10051608 | 3300013308 | Bacteria | 4040 |
| 358 | Ga0157375_10065528 | 3300013308 | Bacteria | 3621 |
| 359 | Ga0157375_10068770 | 3300013308 | Bacteria | 3545 |
| 360 | Ga0157375_10072228 | 3300013308 | Bacteria | 3467 |
| 361 | Ga0157375_10690215 | 3300013308 | Bacteria | 1175 |
| 362 | Ga0157375_10717282 | 3300013308 | Bacteria | 1153 |
| 363 | Ga0157375_10729648 | 3300013308 | Unclassified | 1143 |
| 364 | Ga0157375_10766894 | 3300013308 | Unclassified | 1115 |
| 365 | Ga0163163_10000172 | 3300014325 | Bacteria | 67754 |
| 366 | Ga0163163_10001034 | 3300014325 | Bacteria | 23573 |
| 367 | Ga0163163_10040223 | 3300014325 | Bacteria | 4565 |
| 368 | Ga0163163_10339434 | 3300014325 | Unclassified | 1557 |
| 369 | Ga0163163_10343491 | 3300014325 | Bacteria | 1548 |
| 370 | Ga0163163_10426859 | 3300014325 | Bacteria | 1385 |
| 371 | Ga0163163_10455159 | 3300014325 | Bacteria | 1340 |
| 372 | Ga0157379_10666086 | 3300014968 | Bacteria | 975 |
| 373 | Ga0157376_10036879 | 3300014969 | Bacteria | 3963 |
| 374 | Ga0157376_10045613 | 3300014969 | Bacteria | 3610 |
| 375 | Ga0157376_10107979 | 3300014969 | Bacteria | 2444 |
| 376 | Ga0157376_10315191 | 3300014969 | Bacteria | 1485 |
| 377 | Ga0182006_1000267 | 3300015261 | Bacteria | 47415 |
| 378 | Ga0163161_10007129 | 3300017792 | Bacteria | 7727 |
| 379 | Ga0213872_10007757 | 3300021361 | Bacteria | 5246 |
| 380 | Ga0213876_10004110 | 3300021384 | Bacteria | 8176 |
| 381 | Ga0209436_102005 | 3300025208 | Bacteria | 6475 |
| 382 | Ga0207427_100043 | 3300025231 | Bacteria | 249595 |
| 383 | Ga0209437_100008 | 3300025233 | Bacteria | 921142 |
| 384 | Ga0209437_100102 | 3300025233 | Bacteria | 224216 |
| 385 | Ga0209437_100299 | 3300025233 | Bacteria | 69659 |
| 386 | Ga0209646_1000017 | 3300025246 | Bacteria | 488265 |
| 387 | Ga0209026_1000287 | 3300025250 | Bacteria | 57255 |
| 388 | Ga0209026_1000314 | 3300025250 | Bacteria | 51962 |
| 389 | Ga0209026_1000609 | 3300025250 | Bacteria | 22967 |
| 390 | Ga0209233_1000366 | 3300025261 | Bacteria | 40794 |
| 391 | Ga0209233_1001432 | 3300025261 | Bacteria | 9412 |
| 392 | Ga0209233_1035303 | 3300025261 | Bacteria | 1131 |
| 393 | Ga0209130_1003592 | 3300025284 | Bacteria | 6466 |
| 394 | Ga0207426_1000363 | 3300025302 | Bacteria | 81330 |
| 395 | Ga0207426_1000589 | 3300025302 | Bacteria | 48263 |
| 396 | Ga0207656_10166036 | 3300025321 | Bacteria | 1053 |
| 397 | Ga0207642_10048644 | 3300025899 | Bacteria | 1902 |
| 398 | Ga0207710_10047459 | 3300025900 | Bacteria | 1920 |
| 399 | Ga0207710_10150944 | 3300025900 | Unclassified | 1127 |
| 400 | Ga0207680_10005691 | 3300025903 | Bacteria | 5970 |
| 401 | Ga0207680_10013425 | 3300025903 | Bacteria | 4207 |
| 402 | Ga0207680_10094569 | 3300025903 | Bacteria | 1908 |
| 403 | Ga0207680_10163379 | 3300025903 | Bacteria | 1495 |
| 404 | Ga0207647_10000043 | 3300025904 | Bacteria | 91109 |
| 405 | Ga0207647_10000392 | 3300025904 | Bacteria | 35883 |
| 406 | Ga0207647_10003538 | 3300025904 | Bacteria | 11715 |
| 407 | Ga0207647_10127031 | 3300025904 | Bacteria | 1500 |
| 408 | Ga0207647_10188236 | 3300025904 | Bacteria | 1197 |
| 409 | Ga0207699_10290678 | 3300025906 | Bacteria | 1139 |
| 410 | Ga0207645_10207646 | 3300025907 | Bacteria | 1289 |
| 411 | Ga0207705_10000068 | 3300025909 | Bacteria | 134316 |
| 412 | Ga0207705_10095062 | 3300025909 | Bacteria | 2187 |
| 413 | Ga0207705_10129411 | 3300025909 | Unclassified | 1878 |
| 414 | Ga0207705_10135521 | 3300025909 | Bacteria | 1835 |
| 415 | Ga0207705_10229340 | 3300025909 | Bacteria | 1412 |
| 416 | Ga0207654_10058939 | 3300025911 | Bacteria | 2237 |
| 417 | Ga0207654_10334520 | 3300025911 | Unclassified | 1039 |
| 418 | Ga0207654_10431531 | 3300025911 | Bacteria | 921 |
| 419 | Ga0207707_10014848 | 3300025912 | Bacteria | 6783 |
| 420 | Ga0207707_10119769 | 3300025912 | Bacteria | 2301 |
| 421 | Ga0207707_10318043 | 3300025912 | Bacteria | 1344 |
| 422 | Ga0207707_10490641 | 3300025912 | Bacteria | 1048 |
| 423 | Ga0207695_10000020 | 3300025913 | Bacteria | 723025 |
| 424 | Ga0207695_10000127 | 3300025913 | Bacteria | 227338 |
| 425 | Ga0207695_10020429 | 3300025913 | Bacteria | 7585 |
| 426 | Ga0207695_10040659 | 3300025913 | Bacteria | 4982 |
| 427 | Ga0207695_10138763 | 3300025913 | Bacteria | 2382 |
| 428 | Ga0207695_10224110 | 3300025913 | Bacteria | 1787 |
| 429 | Ga0207695_10262447 | 3300025913 | Bacteria | 1624 |
| 430 | Ga0207695_10351954 | 3300025913 | Bacteria | 1360 |
| 431 | Ga0207671_10000254 | 3300025914 | Bacteria | 79974 |
| 432 | Ga0207671_10002928 | 3300025914 | Bacteria | 17594 |
| 433 | Ga0207671_10004487 | 3300025914 | Bacteria | 13301 |
| 434 | Ga0207671_10014431 | 3300025914 | Bacteria | 6244 |
| 435 | Ga0207671_10188761 | 3300025914 | Bacteria | 1606 |
| 436 | Ga0207662_10051503 | 3300025918 | Bacteria | 2450 |
| 437 | Ga0207657_10006159 | 3300025919 | Bacteria | 12468 |
| 438 | Ga0207657_10077723 | 3300025919 | Bacteria | 2797 |
| 439 | Ga0207657_10086320 | 3300025919 | Bacteria | 2627 |
| 440 | Ga0207657_10164219 | 3300025919 | Bacteria | 1802 |
| 441 | Ga0207649_10009942 | 3300025920 | Bacteria | 5214 |
| 442 | Ga0207652_10011789 | 3300025921 | Bacteria | 7054 |
| 443 | Ga0207652_10235917 | 3300025921 | Bacteria | 1649 |
| 444 | Ga0207652_10506673 | 3300025921 | Unclassified | 1086 |
| 445 | Ga0207646_10352675 | 3300025922 | Unclassified | 1330 |
| 446 | Ga0207681_10003997 | 3300025923 | Bacteria | 9152 |
| 447 | Ga0207694_10011623 | 3300025924 | Bacteria | 6642 |
| 448 | Ga0207694_10046106 | 3300025924 | Bacteria | 3369 |
| 449 | Ga0207694_10094115 | 3300025924 | Bacteria | 2367 |
| 450 | Ga0207694_10171470 | 3300025924 | Unclassified | 1757 |
| 451 | Ga0207650_10000001 | 3300025925 | Bacteria | 1545726 |
| 452 | Ga0207650_10000002 | 3300025925 | Bacteria | 1439222 |
| 453 | Ga0207650_10216813 | 3300025925 | Bacteria | 1539 |
| 454 | Ga0207650_10336712 | 3300025925 | Bacteria | 1238 |
| 455 | Ga0207659_10041633 | 3300025926 | Bacteria | 3217 |
| 456 | Ga0207687_10012522 | 3300025927 | Bacteria | 5541 |
| 457 | Ga0207687_10110726 | 3300025927 | Bacteria | 2037 |
| 458 | Ga0207700_10012739 | 3300025928 | Bacteria | 5437 |
| 459 | Ga0207664_10007396 | 3300025929 | Bacteria | 7613 |
| 460 | Ga0207644_10000673 | 3300025931 | Bacteria | 21534 |
| 461 | Ga0207644_10002294 | 3300025931 | Bacteria | 12410 |
| 462 | Ga0207690_10003894 | 3300025932 | Bacteria | 8826 |
| 463 | Ga0207690_10139792 | 3300025932 | Bacteria | 1783 |
| 464 | Ga0207690_10319384 | 3300025932 | Bacteria | 1220 |
| 465 | Ga0207706_10000738 | 3300025933 | Bacteria | 34077 |
| 466 | Ga0207706_10005031 | 3300025933 | Bacteria | 12341 |
| 467 | Ga0207706_10190436 | 3300025933 | Unclassified | 1801 |
| 468 | Ga0207686_10033683 | 3300025934 | Unclassified | 3059 |
| 469 | Ga0207686_10041954 | 3300025934 | Bacteria | 2793 |
| 470 | Ga0207686_10150897 | 3300025934 | Bacteria | 1618 |
| 471 | Ga0207709_10034119 | 3300025935 | Bacteria | 2996 |
| 472 | Ga0207709_10445371 | 3300025935 | Unclassified | 1000 |
| 473 | Ga0207670_10000012 | 3300025936 | Bacteria | 246808 |
| 474 | Ga0207670_10731429 | 3300025936 | Bacteria | 821 |
| 475 | Ga0207669_10107736 | 3300025937 | Unclassified | 1859 |
| 476 | Ga0207704_10223540 | 3300025938 | Bacteria | 1395 |
| 477 | Ga0207665_10200533 | 3300025939 | Unclassified | 1454 |
| 478 | Ga0207691_10105989 | 3300025940 | Bacteria | 2504 |
| 479 | Ga0207711_10000765 | 3300025941 | Bacteria | 31593 |
| 480 | Ga0207711_10014165 | 3300025941 | Bacteria | 6624 |
| 481 | Ga0207711_10016292 | 3300025941 | Bacteria | 6174 |
| 482 | Ga0207711_10049413 | 3300025941 | Unclassified | 3602 |
| 483 | Ga0207711_10084621 | 3300025941 | Bacteria | 2776 |
| 484 | Ga0207711_10142602 | 3300025941 | Bacteria | 2156 |
| 485 | Ga0207689_10154073 | 3300025942 | Bacteria | 1894 |
| 486 | Ga0207661_10184629 | 3300025944 | Bacteria | 1824 |
| 487 | Ga0207667_10000346 | 3300025949 | Bacteria | 63247 |
| 488 | Ga0207667_10013817 | 3300025949 | Bacteria | 9224 |
| 489 | Ga0207667_10017117 | 3300025949 | Bacteria | 8172 |
| 490 | Ga0207667_10029813 | 3300025949 | Bacteria | 5911 |
| 491 | Ga0207667_10049745 | 3300025949 | Bacteria | 4425 |
| 492 | Ga0207667_10071445 | 3300025949 | Bacteria | 3608 |
| 493 | Ga0207667_10269299 | 3300025949 | Bacteria | 1741 |
| 494 | Ga0207667_10399166 | 3300025949 | Unclassified | 1400 |
| 495 | Ga0207667_10656550 | 3300025949 | Bacteria | 1054 |
| 496 | Ga0207651_10099358 | 3300025960 | Bacteria | 2155 |
| 497 | Ga0207651_10442717 | 3300025960 | Unclassified | 1113 |
| 498 | Ga0207712_10001316 | 3300025961 | Bacteria | 17028 |
| 499 | Ga0207640_10040001 | 3300025981 | Bacteria | 2971 |
| 500 | Ga0207640_10078886 | 3300025981 | Bacteria | 2243 |
| 501 | Ga0207640_10320052 | 3300025981 | Bacteria | 1235 |
| 502 | Ga0207640_10455240 | 3300025981 | Bacteria | 1056 |
| 503 | Ga0207658_10000001 | 3300025986 | Bacteria | 1439333 |
| 504 | Ga0207658_10072474 | 3300025986 | Bacteria | 2611 |
| 505 | Ga0207677_10019158 | 3300026023 | Bacteria | 4126 |
| 506 | Ga0207677_10112565 | 3300026023 | Bacteria | 2030 |
| 507 | Ga0207677_10228864 | 3300026023 | Bacteria | 1496 |
| 508 | Ga0207677_10333392 | 3300026023 | Bacteria | 1265 |
| 509 | Ga0207677_10462314 | 3300026023 | Bacteria | 1089 |
| 510 | Ga0207703_10010124 | 3300026035 | Bacteria | 7390 |
| 511 | Ga0207703_10208133 | 3300026035 | Bacteria | 1742 |
| 512 | Ga0207703_10533752 | 3300026035 | Bacteria | 1105 |
| 513 | Ga0207639_10003351 | 3300026041 | Bacteria | 10774 |
| 514 | Ga0207639_10036831 | 3300026041 | Bacteria | 3628 |
| 515 | Ga0207639_10387198 | 3300026041 | Bacteria | 1257 |
| 516 | Ga0207639_10475603 | 3300026041 | Bacteria | 1138 |
| 517 | Ga0207678_10001342 | 3300026067 | Bacteria | 22684 |
| 518 | Ga0207678_10060367 | 3300026067 | Bacteria | 3261 |
| 519 | Ga0207708_10000061 | 3300026075 | Bacteria | 92741 |
| 520 | Ga0207708_10040287 | 3300026075 | Bacteria | 3561 |
| 521 | Ga0207702_10000023 | 3300026078 | Bacteria | 189234 |
| 522 | Ga0207702_10023617 | 3300026078 | Bacteria | 5101 |
| 523 | Ga0207702_10062592 | 3300026078 | Unclassified | 3178 |
| 524 | Ga0207702_10146089 | 3300026078 | Bacteria | 2146 |
| 525 | Ga0207702_10352100 | 3300026078 | Bacteria | 1409 |
| 526 | Ga0207702_10495672 | 3300026078 | Bacteria | 1190 |
| 527 | Ga0207641_10039803 | 3300026088 | Bacteria | 3932 |
| 528 | Ga0207641_10368258 | 3300026088 | Unclassified | 1373 |
| 529 | Ga0207641_10623886 | 3300026088 | Bacteria | 1057 |
| 530 | Ga0207648_10020187 | 3300026089 | Bacteria | 6005 |
| 531 | Ga0207648_10041787 | 3300026089 | Unclassified | 4027 |
| 532 | Ga0207648_10107916 | 3300026089 | Bacteria | 2443 |
| 533 | Ga0207648_10142292 | 3300026089 | Bacteria | 2114 |
| 534 | Ga0207648_10170733 | 3300026089 | Bacteria | 1922 |
| 535 | Ga0207648_10442745 | 3300026089 | Bacteria | 1182 |
| 536 | Ga0207676_10000001 | 3300026095 | Bacteria | 1439222 |
| 537 | Ga0207676_10000023 | 3300026095 | Bacteria | 266848 |
| 538 | Ga0207676_10093434 | 3300026095 | Bacteria | 2476 |
| 539 | Ga0207676_10394397 | 3300026095 | Unclassified | 1292 |
| 540 | Ga0207676_10395580 | 3300026095 | Bacteria | 1290 |
| 541 | Ga0207676_10423602 | 3300026095 | Bacteria | 1249 |
| 542 | Ga0207676_10531560 | 3300026095 | Bacteria | 1121 |
| 543 | Ga0207676_10556040 | 3300026095 | Bacteria | 1097 |
| 544 | Ga0207674_10018675 | 3300026116 | Bacteria | 7531 |
| 545 | Ga0207674_10041592 | 3300026116 | Unclassified | 4752 |
| 546 | Ga0207674_10088374 | 3300026116 | Bacteria | 3092 |
| 547 | Ga0207674_10137182 | 3300026116 | Unclassified | 2407 |
| 548 | Ga0207674_10695018 | 3300026116 | Unclassified | 982 |
| 549 | Ga0207675_100003627 | 3300026118 | Bacteria | 15059 |
| 550 | Ga0207675_100422350 | 3300026118 | Bacteria | 1317 |
| 551 | Ga0207675_100450227 | 3300026118 | Bacteria | 1276 |
| 552 | Ga0207675_100628019 | 3300026118 | Bacteria | 1079 |
| 553 | Ga0207683_10204870 | 3300026121 | Bacteria | 1794 |
| 554 | Ga0207698_10027682 | 3300026142 | Bacteria | 4028 |
| 555 | Ga0207698_10081202 | 3300026142 | Bacteria | 2616 |
| 556 | Ga0207698_10304397 | 3300026142 | Bacteria | 1485 |
| 557 | Ga0268266_10023782 | 3300028379 | Bacteria | 5214 |
| 558 | Ga0268266_10165912 | 3300028379 | Bacteria | 2001 |
| 559 | Ga0268265_10000455 | 3300028380 | Bacteria | 43315 |
| 560 | Ga0268264_10000004 | 3300028381 | Bacteria | 1116842 |
| 561 | Ga0268264_10007176 | 3300028381 | Bacteria | 9332 |
| 562 | Ga0268264_10033142 | 3300028381 | Bacteria | 4241 |
| 563 | Ga0268264_10133451 | 3300028381 | Bacteria | 2205 |
| 564 | Ga0268264_10310452 | 3300028381 | Unclassified | 1488 |
| 565 | Ga0268264_10955287 | 3300028381 | Bacteria | 862 |
| 566 | Ga0307517_10015946 | 3300028786 | Bacteria | 9922 |
| 567 | Ga0307515_10000002 | 3300028794 | Bacteria | 1231751 |
| 568 | Ga0307515_10009896 | 3300028794 | Bacteria | 18361 |
| 569 | Ga0307515_10013335 | 3300028794 | Bacteria | 15375 |
| 570 | Ga0265338_10014144 | 3300028800 | Bacteria | 8920 |
| 571 | Ga0265327_10000344 | 3300031251 | Bacteria | 87965 |
| 572 | Ga0265327_10000551 | 3300031251 | Bacteria | 64082 |
| 573 | Ga0265327_10045118 | 3300031251 | Bacteria | 2345 |
| 574 | Ga0265316_10051620 | 3300031344 | Bacteria | 3230 |
| 575 | Ga0307509_10044703 | 3300031507 | Bacteria | 4783 |
| 576 | Ga0307408_100000859 | 3300031548 | Bacteria | 23895 |
| 577 | Ga0307408_100003612 | 3300031548 | Bacteria | 10539 |
| 578 | Ga0307408_100154291 | 3300031548 | Bacteria | 1816 |
| 579 | Ga0307408_100251194 | 3300031548 | Bacteria | 1459 |
| 580 | Ga0265314_10007935 | 3300031711 | Bacteria | 9157 |
| 581 | Ga0307413_10249260 | 3300031824 | Bacteria | 1316 |
| 582 | Ga0307406_10000578 | 3300031901 | Bacteria | 21116 |
| 583 | Ga0307407_10163782 | 3300031903 | Unclassified | 1458 |
| 584 | Ga0307407_10299047 | 3300031903 | Bacteria | 1121 |
| 585 | Ga0307412_10003104 | 3300031911 | Bacteria | 9221 |
| 586 | Ga0307412_10071980 | 3300031911 | Bacteria | 2361 |
| 587 | Ga0307409_100029817 | 3300031995 | Unclassified | 3911 |
| 588 | Ga0307409_100969708 | 3300031995 | Bacteria | 867 |
| 589 | Ga0307416_100002833 | 3300032002 | Bacteria | 10091 |
| 590 | Ga0307416_100082445 | 3300032002 | Bacteria | 2724 |
| 591 | Ga0307416_100101227 | 3300032002 | Unclassified | 2509 |
| 592 | Ga0307414_10003090 | 3300032004 | Bacteria | 8839 |
| 593 | Ga0307411_10040125 | 3300032005 | Unclassified | 2967 |
| 594 | Ga0307415_100001307 | 3300032126 | Bacteria | 11780 |
| 595 | Ga0307415_100065230 | 3300032126 | Bacteria | 2536 |
| 596 | Ga0307507_10000894 | 3300033179 | Bacteria | 66220 |
| 597 | Ga0307510_10001986 | 3300033180 | Bacteria | 23038 |
| 598 | Ga0373941_0014409 | 3300035115 | Bacteria | 2111 |
| 599 | Ga0316574_0447586 | 3300035398 | Unclassified | 809 |
| 600 | Ga0373925_0362181 | 3300037068 | Bacteria | 1179 |
| 601 | Ga0395899_0000177 | 3300037312 | Bacteria | 94226 |
| 602 | Ga0395899_0000853 | 3300037312 | Bacteria | 29193 |
| 603 | Ga0395899_0004174 | 3300037312 | Bacteria | 11342 |
| 604 | Ga0395899_0006897 | 3300037312 | Bacteria | 8797 |
| 605 | Ga0395899_0022689 | 3300037312 | Bacteria | 4754 |
| 606 | Ga0395899_0060313 | 3300037312 | Bacteria | 2795 |
| 607 | Ga0395899_0113912 | 3300037312 | Bacteria | 1942 |
| 608 | Ga0395899_0115396 | 3300037312 | Bacteria | 1927 |
| 609 | Ga0395900_0000139 | 3300037418 | Bacteria | 122708 |
| 610 | Ga0395900_0001986 | 3300037418 | Bacteria | 23094 |
| 611 | Ga0395900_0003729 | 3300037418 | Bacteria | 16354 |
| 612 | Ga0395900_0018576 | 3300037418 | Bacteria | 7091 |
| 613 | Ga0395900_0154595 | 3300037418 | Unclassified | 2343 |
| 614 | Ga0395900_0272592 | 3300037418 | Bacteria | 1686 |
| 615 | Ga0395900_0468161 | 3300037418 | Bacteria | 1214 |
| 616 | Ga0395898_0005317 | 3300037466 | Bacteria | 13919 |
| 617 | Ga0395898_0018675 | 3300037466 | Bacteria | 7068 |
| 618 | Ga0395898_0032257 | 3300037466 | Bacteria | 5228 |
| 619 | Ga0395898_0398735 | 3300037466 | Bacteria | 1312 |
| 620 | Ga0395905_0000169 | 3300037471 | Bacteria | 106579 |
| 621 | Ga0395905_0013551 | 3300037471 | Bacteria | 7811 |
| 622 | Ga0395905_0019014 | 3300037471 | Bacteria | 6514 |
| 623 | Ga0436364_0874301 | 3300037853 | Bacteria | 1409 |
| 624 | Ga0395901_0000838 | 3300038443 | Bacteria | 33913 |
| 625 | Ga0395901_0006768 | 3300038443 | Bacteria | 11578 |
| 626 | Ga0395901_0032319 | 3300038443 | Bacteria | 5400 |
| 627 | Ga0395901_0084537 | 3300038443 | Bacteria | 3316 |
| 628 | Ga0395901_0394157 | 3300038443 | Unclassified | 1423 |
| 629 | Ga0395901_0707879 | 3300038443 | Bacteria | 1004 |
| 630 | Ga0436365_1919188 | 3300039437 | Bacteria | 11957 |
| 631 | Ga0436361_0616042 | 3300039447 | Bacteria | 10564 |
| 632 | Ga0439448_0000952 | 3300042005 | Bacteria | 7141 |
| 633 | Ga0439449_0102220 | 3300042007 | Unclassified | 1060 |
| 634 | Ga0439455_0032835 | 3300042012 | Bacteria | 1299 |
| 635 | Ga0439459_0049740 | 3300042438 | Unclassified | 917 |
| 636 | Ga0466969_0026309 | 3300044656 | Bacteria | 2985 |
| 637 | Ga0466972_0039698 | 3300044658 | Bacteria | 2296 |
| 638 | Ga0466966_0002350 | 3300044684 | Bacteria | 12351 |
| 639 | Ga0453684_0049946 | 3300044712 | Bacteria | 5508 |
| 640 | Ga0466959_0033047 | 3300045049 | Bacteria | 3828 |
| 641 | Ga0466959_0060585 | 3300045049 | Bacteria | 2754 |
| 642 | Ga0451576_1168387 | 3300045051 | Bacteria | 804 |
| 643 | Ga0466967_0153352 | 3300045976 | Bacteria | 2156 |
| 644 | Ga0495638_0202920 | 3300046460 | Bacteria | 1118 |
| 645 | Ga0495651_0280442 | 3300046462 | Bacteria | 1126 |
| 646 | Ga0495650_0000036 | 3300046471 | Bacteria | 400633 |
| 647 | Ga0495650_0038648 | 3300046471 | Bacteria | 2066 |
| 648 | Ga0495650_0142101 | 3300046471 | Bacteria | 868 |
| 649 | Ga0495585_0000704 | 3300046492 | Bacteria | 30119 |
| 650 | Ga0495606_0000143 | 3300046507 | Bacteria | 123231 |
| 651 | Ga0495606_0004123 | 3300046507 | Bacteria | 14756 |
| 652 | Ga0495606_0012660 | 3300046507 | Bacteria | 6735 |
| 653 | Ga0495606_0018189 | 3300046507 | Bacteria | 5281 |
| 654 | Ga0495606_0037648 | 3300046507 | Bacteria | 3283 |
| 655 | Ga0495610_0001747 | 3300046512 | Bacteria | 19026 |
| 656 | Ga0495616_0006658 | 3300046513 | Bacteria | 6974 |
| 657 | Ga0495616_0008524 | 3300046513 | Bacteria | 6062 |
| 658 | Ga0495616_0009958 | 3300046513 | Bacteria | 5525 |
| 659 | Ga0495631_0002540 | 3300046518 | Bacteria | 10248 |
| 660 | Ga0495631_0027483 | 3300046518 | Bacteria | 2603 |
| 661 | Ga0495632_0065365 | 3300046519 | Unclassified | 1757 |
| 662 | Ga0495648_0010424 | 3300046524 | Bacteria | 7079 |
| 663 | Ga0495648_0029392 | 3300046524 | Bacteria | 3648 |
| 664 | Ga0495648_0044082 | 3300046524 | Bacteria | 2787 |
| 665 | Ga0495652_0211389 | 3300046529 | Bacteria | 1464 |
| 666 | Ga0495587_0138852 | 3300046536 | Bacteria | 1388 |
| 667 | Ga0495609_0016092 | 3300046538 | Bacteria | 3489 |
| 668 | Ga0495633_0000079 | 3300046558 | Bacteria | 127941 |
| 669 | Ga0495668_0000010 | 3300046616 | Bacteria | 487308 |
| 670 | Ga0495668_0000433 | 3300046616 | Bacteria | 54007 |
| 671 | Ga0495668_0297876 | 3300046616 | Bacteria | 884 |
| 672 | Ga0495625_0000009 | 3300046660 | Bacteria | 404954 |
| 673 | Ga0495625_0000791 | 3300046660 | Bacteria | 43870 |
| 674 | Ga0495625_0000932 | 3300046660 | Bacteria | 39330 |
| 675 | Ga0495625_0008903 | 3300046660 | Bacteria | 8486 |
| 676 | Ga0495625_0044684 | 3300046660 | Bacteria | 3205 |
| 677 | Ga0495625_0073561 | 3300046660 | Bacteria | 2395 |
| 678 | Ga0495625_0119685 | 3300046660 | Bacteria | 1793 |
| 679 | Ga0495625_0130416 | 3300046660 | Bacteria | 1703 |
| 680 | Ga0495661_0016299 | 3300046665 | Bacteria | 4929 |
| 681 | Ga0495661_0048242 | 3300046665 | Bacteria | 2588 |
| 682 | Ga0495661_0057144 | 3300046665 | Bacteria | 2331 |
| 683 | Ga0495669_0124170 | 3300046684 | Unclassified | 1212 |
| 684 | Ga0495649_0000008 | 3300046694 | Bacteria | 483706 |
| 685 | Ga0495649_0098266 | 3300046694 | Bacteria | 1557 |
| 686 | Ga0495649_0123979 | 3300046694 | Bacteria | 1365 |
| 687 | Ga0495636_0165490 | 3300047318 | Bacteria | 998 |
| 688 | Ga0495683_0007331 | 3300047323 | Bacteria | 5978 |
| 689 | Ga0495687_002785 | 3300047443 | Bacteria | 13508 |
| 690 | Ga0495687_005561 | 3300047443 | Bacteria | 7988 |
| 691 | Ga0495685_027293 | 3300047447 | Bacteria | 1964 |
| 692 | Ga0495686_0000107 | 3300047472 | Bacteria | 174386 |
| 693 | Ga0495686_0000673 | 3300047472 | Bacteria | 46191 |
| 694 | Ga0495686_0006124 | 3300047472 | Bacteria | 9314 |
| 695 | Ga0495686_0057141 | 3300047472 | Bacteria | 2436 |
| 696 | Ga0495686_0073217 | 3300047472 | Bacteria | 2105 |
| 697 | Ga0495686_0153722 | 3300047472 | Bacteria | 1349 |
| 698 | Ga0496102_0226286 | 3300048905 | Bacteria | 1764 |
| 699 | Ga0496104_0558215 | 3300048907 | Bacteria | 1056 |
| 700 | Ga0496108_0079183 | 3300048911 | Unclassified | 2782 |
| 701 | Ga0496111_0280739 | 3300048914 | Unclassified | 1235 |
| 702 | Ga0496126_0000024 | 3300048929 | Bacteria | 462877 |
| 703 | Ga0496126_0424263 | 3300048929 | Unclassified | 1075 |
| 704 | Ga0495678_111944 | 3300049459 | Bacteria | 929 |
| 705 | Ga0495682_0029619 | 3300049460 | Bacteria | 2028 |
| 706 | Ga0501291_006870 | 3300049514 | Bacteria | 1528 |
| 707 | Ga0501297_007527 | 3300049520 | Unclassified | 1185 |
| 708 | Ga0501298_004133 | 3300049521 | Unclassified | 2277 |
| 709 | Ga0501299_023837 | 3300049522 | Unclassified | 1138 |
| 710 | Ga0501032_0015253 | 3300049569 | Bacteria | 5425 |
| 711 | Ga0501047_0166437 | 3300049581 | Bacteria | 2075 |
| 712 | Ga0501067_0045071 | 3300049583 | Bacteria | 2450 |
| 713 | Ga0501198_005615 | 3300049649 | Unclassified | 1770 |
| 714 | Ga0501202_004419 | 3300049652 | Unclassified | 2461 |
| 715 | Ga0501207_002239 | 3300049654 | Unclassified | 2485 |
| 716 | Ga0501214_034984 | 3300049659 | Unclassified | 706 |
| 717 | Ga0501216_007077 | 3300049660 | Unclassified | 1737 |
| 718 | Ga0501217_000924 | 3300049661 | Bacteria | 5251 |
| 719 | Ga0501223_002194 | 3300049663 | Unclassified | 4379 |
| 720 | Ga0501227_000370 | 3300049665 | Bacteria | 9439 |
| 721 | Ga0501227_083097 | 3300049665 | Bacteria | 841 |
| 722 | Ga0501233_002952 | 3300049668 | Unclassified | 3036 |
| 723 | Ga0501236_010870 | 3300049670 | Unclassified | 1200 |
| 724 | Ga0501257_002411 | 3300049686 | Bacteria | 3940 |
| 725 | Ga0501259_006855 | 3300049688 | Unclassified | 1818 |
| 726 | Ga0501261_031759 | 3300049690 | Bacteria | 801 |
| 727 | Ga0501221_016794 | 3300049704 | Unclassified | 1390 |
| 728 | Ga0501225_0016490 | 3300049705 | Unclassified | 2054 |
| 729 | Ga0501234_000506 | 3300049707 | Bacteria | 5986 |
| 730 | Ga0501245_003271 | 3300049708 | Unclassified | 2195 |
| 731 | Ga0501271_006854 | 3300049768 | Bacteria | 1138 |
| 732 | Ga0501283_002273 | 3300049779 | Unclassified | 2493 |
| 733 | Ga0501044_0215037 | 3300049823 | Bacteria | 1875 |
| 734 | nmdc:mga0k408_152_c1 | 3300050493 | Bacteria | 35351 |
| 735 | nmdc:mga0k408_52352_c1 | 3300050493 | Bacteria | 2366 |
| 736 | nmdc:mga08y16_22785_c1 | 3300050511 | Bacteria | 6610 |
| 737 | nmdc:mga08y16_256953_c1 | 3300050511 | Bacteria | 1804 |
| 738 | nmdc:mga0n895_208125_c1 | 3300050512 | Unclassified | 1987 |
| 739 | nmdc:mga0n895_45178_c1 | 3300050512 | Bacteria | 4297 |
| 740 | nmdc:mga0a205_301389_c1 | 3300050515 | Unclassified | 1476 |
| 741 | nmdc:mga0a205_63792_c1 | 3300050515 | Unclassified | 3558 |
| 742 | Ga0500644_0000081 | 3300053088 | Bacteria | 58662 |
| 743 | Ga0500646_0005142 | 3300053090 | Bacteria | 3312 |
| 744 | Ga0500569_000086 | 3300053109 | Bacteria | 14960 |
| 745 | Ga0500569_104085 | 3300053109 | Bacteria | 933 |
| 746 | Ga0500608_011092 | 3300053122 | Bacteria | 3898 |
| 747 | Ga0500614_127780 | 3300053123 | Bacteria | 753 |
| 748 | Ga0500618_000040 | 3300053125 | Bacteria | 112548 |
| 749 | Ga0500652_036884 | 3300053131 | Bacteria | 1949 |
| 750 | Ga0500559_0038101 | 3300053136 | Bacteria | 2087 |
| 751 | Ga0500564_007177 | 3300053138 | Bacteria | 4708 |
| 752 | Ga0500568_0054376 | 3300053139 | Bacteria | 1566 |
| 753 | Ga0500590_031986 | 3300053148 | Bacteria | 2728 |
| 754 | Ga0500622_0000291 | 3300053156 | Bacteria | 51275 |
| 755 | Ga0500634_0017478 | 3300053161 | Bacteria | 3840 |
| 756 | Ga0500636_0160121 | 3300053177 | Bacteria | 1228 |
| 757 | Ga0500661_006091 | 3300055283 | Bacteria | 2250 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005563 | Ga0068855_100436044 | Ga0068855_1004360441 | 173 |
| 2 | 3300013296 | Ga0157374_10495162 | Ga0157374_104951621 | 177 |
| 3 | 3300009093 | Ga0105240_11038150 | Ga0105240_110381502 | 179 |
| 4 | 3300025922 | Ga0207646_10352675 | Ga0207646_103526752 | 180 |
| 5 | 3300005563 | Ga0068855_100010533 | Ga0068855_1000105335 | 183 |
| 6 | 3300025949 | Ga0207667_10029813 | Ga0207667_100298133 | 183 |
| 7 | 3300005535 | Ga0070684_100093435 | Ga0070684_1000934353 | 185 |
| 8 | 3300006358 | Ga0068871_100011508 | Ga0068871_1000115082 | 185 |
| 9 | 3300026089 | Ga0207648_10041787 | Ga0207648_100417875 | 185 |
| 10 | 3300005563 | Ga0068855_100003108 | Ga0068855_1000031089 | 188 |
| 11 | 3300005842 | Ga0068858_100002610 | Ga0068858_1000026106 | 188 |
| 12 | 3300005843 | Ga0068860_100004790 | Ga0068860_1000047904 | 188 |
| 13 | 3300009093 | Ga0105240_10005237 | Ga0105240_100052375 | 188 |
| 14 | 3300009093 | Ga0105240_10163816 | Ga0105240_101638161 | 188 |
| 15 | 3300009176 | Ga0105242_10874891 | Ga0105242_108748911 | 188 |
| 16 | 3300013296 | Ga0157374_10056042 | Ga0157374_100560422 | 188 |
| 17 | 3300013297 | Ga0157378_10178913 | Ga0157378_101789132 | 188 |
| 18 | 3300014969 | Ga0157376_10107979 | Ga0157376_101079792 | 188 |
| 19 | 3300025903 | Ga0207680_10005691 | Ga0207680_100056911 | 188 |
| 20 | 3300025913 | Ga0207695_10040659 | Ga0207695_100406593 | 188 |
| 21 | 3300025934 | Ga0207686_10041954 | Ga0207686_100419541 | 188 |
| 22 | 3300025934 | Ga0207686_10150897 | Ga0207686_101508972 | 188 |
| 23 | 3300025949 | Ga0207667_10049745 | Ga0207667_100497452 | 188 |
| 24 | 3300028381 | Ga0268264_10007176 | Ga0268264_100071765 | 188 |
| 25 | 3300031711 | Ga0265314_10007935 | Ga0265314_100079352 | 190 |
| 26 | 3300009098 | Ga0105245_10052236 | Ga0105245_100522362 | 191 |
| 27 | 3300009101 | Ga0105247_10148509 | Ga0105247_101485092 | 191 |
| 28 | 3300009147 | Ga0114129_10025727 | Ga0114129_100257272 | 191 |
| 29 | 3300009176 | Ga0105242_10095184 | Ga0105242_100951842 | 191 |
| 30 | 3300013306 | Ga0163162_10342524 | Ga0163162_103425242 | 191 |
| 31 | 3300014325 | Ga0163163_10040223 | Ga0163163_100402234 | 191 |
| 32 | 3300014968 | Ga0157379_10666086 | Ga0157379_106660861 | 191 |
| 33 | 3300045051 | Ga0451576_1168387 | Ga0451576_1168387_134_763 | 191 |
| 34 | 3300005327 | Ga0070658_10124132 | Ga0070658_101241322 | 192 |
| 35 | 3300005455 | Ga0070663_100025567 | Ga0070663_1000255672 | 192 |
| 36 | 3300005563 | Ga0068855_100081103 | Ga0068855_1000811032 | 192 |
| 37 | 3300005616 | Ga0068852_100117732 | Ga0068852_1001177323 | 192 |
| 38 | 3300013104 | Ga0157370_10199453 | Ga0157370_101994532 | 192 |
| 39 | 3300013105 | Ga0157369_10658161 | Ga0157369_106581612 | 192 |
| 40 | 3300013307 | Ga0157372_10067595 | Ga0157372_100675952 | 192 |
| 41 | 3300025909 | Ga0207705_10129411 | Ga0207705_101294112 | 192 |
| 42 | 3300025921 | Ga0207652_10506673 | Ga0207652_105066732 | 192 |
| 43 | 3300026067 | Ga0207678_10001342 | Ga0207678_100013427 | 192 |
| 44 | 3300053148 | Ga0500590_031986 | Ga0500590_031986_2045_2683 | 194 |
| 45 | 3300005327 | Ga0070658_10069446 | Ga0070658_100694462 | 195 |
| 46 | 3300025909 | Ga0207705_10229340 | Ga0207705_102293403 | 195 |
| 47 | 3300049659 | Ga0501214_034984 | Ga0501214_034984_18_659 | 195 |
| 48 | 3300005356 | Ga0070674_100090129 | Ga0070674_1000901293 | 196 |
| 49 | 3300005445 | Ga0070708_100204996 | Ga0070708_1002049962 | 196 |
| 50 | 3300005718 | Ga0068866_10060247 | Ga0068866_100602473 | 196 |
| 51 | 3300009176 | Ga0105242_10235115 | Ga0105242_102351153 | 196 |
| 52 | 3300025937 | Ga0207669_10107736 | Ga0207669_101077363 | 196 |
| 53 | 3300025981 | Ga0207640_10455240 | Ga0207640_104552402 | 196 |
| 54 | 3300037312 | Ga0395899_0060313 | Ga0395899_0060313_1610_2299 | 196 |
| 55 | 3300037418 | Ga0395900_0018576 | Ga0395900_0018576_4289_4978 | 196 |
| 56 | 3300037471 | Ga0395905_0000169 | Ga0395905_0000169_9410_10099 | 196 |
| 57 | 3300038443 | Ga0395901_0032319 | Ga0395901_0032319_3235_3924 | 196 |
| 58 | 3300005548 | Ga0070665_100138148 | Ga0070665_1001381483 | 198 |
| 59 | 3300013105 | Ga0157369_10181258 | Ga0157369_101812582 | 198 |
| 60 | 3300005438 | Ga0070701_10170175 | Ga0070701_101701751 | 199 |
| 61 | 3300005535 | Ga0070684_100550138 | Ga0070684_1005501381 | 199 |
| 62 | 3300005544 | Ga0070686_100011670 | Ga0070686_1000116701 | 199 |
| 63 | 3300009093 | Ga0105240_10556833 | Ga0105240_105568332 | 199 |
| 64 | 3300025913 | Ga0207695_10351954 | Ga0207695_103519542 | 199 |
| 65 | 3300025932 | Ga0207690_10319384 | Ga0207690_103193842 | 199 |
| 66 | 3300037312 | Ga0395899_0022689 | Ga0395899_0022689_1854_2558 | 199 |
| 67 | 3300037418 | Ga0395900_0272592 | Ga0395900_0272592_632_1336 | 199 |
| 68 | 3300037466 | Ga0395898_0018675 | Ga0395898_0018675_5308_6012 | 199 |
| 69 | 3300038443 | Ga0395901_0006768 | Ga0395901_0006768_4351_5055 | 199 |
| 70 | 3300009093 | Ga0105240_10240823 | Ga0105240_102408232 | 200 |
| 71 | 3300025913 | Ga0207695_10262447 | Ga0207695_102624472 | 200 |
| 72 | 3300026023 | Ga0207677_10333392 | Ga0207677_103333922 | 200 |
| 73 | 3300028379 | Ga0268266_10165912 | Ga0268266_101659121 | 200 |
| 74 | 3300005329 | Ga0070683_100100762 | Ga0070683_1001007622 | 201 |
| 75 | 3300005535 | Ga0070684_100215163 | Ga0070684_1002151632 | 201 |
| 76 | 3300005834 | Ga0068851_10365837 | Ga0068851_103658371 | 201 |
| 77 | 3300013100 | Ga0157373_10000050 | Ga0157373_10000050102 | 201 |
| 78 | 3300013307 | Ga0157372_10031907 | Ga0157372_100319072 | 201 |
| 79 | 3300025944 | Ga0207661_10184629 | Ga0207661_101846291 | 201 |
| 80 | 3300005435 | Ga0070714_100000141 | Ga0070714_1000001415 | 202 |
| 81 | 3300005459 | Ga0068867_100452692 | Ga0068867_1004526922 | 202 |
| 82 | 3300005718 | Ga0068866_10035293 | Ga0068866_100352931 | 202 |
| 83 | 3300011119 | Ga0105246_10323975 | Ga0105246_103239752 | 202 |
| 84 | 3300025925 | Ga0207650_10216813 | Ga0207650_102168132 | 202 |
| 85 | 3300025929 | Ga0207664_10007396 | Ga0207664_100073965 | 202 |
| 86 | 3300026023 | Ga0207677_10112565 | Ga0207677_101125652 | 202 |
| 87 | 3300047443 | Ga0495687_005561 | Ga0495687_005561_389_1078 | 203 |
| 88 | 3300006173 | Ga0070716_100233193 | Ga0070716_1002331932 | 204 |
| 89 | 3300048929 | Ga0496126_0000024 | Ga0496126_0000024_166162_166902 | 205 |
| 90 | iso_pu_bacteria | 2929177148 | 2929179218 | 205 |
| 91 | iso_pu_bacteria | 2929921140 | 2929925485 | 205 |
| 92 | iso_pu_bacteria | 2945977869 | 2945981623 | 205 |
| 93 | iso_pu_bacteria | 2946013367 | 2946018974 | 205 |
| 94 | iso_pu_bacteria | 8003151029 | 8003155918 | 205 |
| 95 | 3300009551 | Ga0105238_10190621 | Ga0105238_101906212 | 206 |
| 96 | 3300031251 | Ga0265327_10000551 | Ga0265327_1000055136 | 206 |
| 97 | 3300037068 | Ga0373925_0362181 | Ga0373925_0362181_76_786 | 206 |
| 98 | 3300049569 | Ga0501032_0015253 | Ga0501032_0015253_3531_4232 | 206 |
| 99 | iso_pu_bacteria | 2599185184 | 2599478095 | 206 |
| 100 | iso_pu_bacteria | 2919437846 | 2919440241 | 206 |
| 101 | iso_pu_bacteria | 2928078545 | 2928080057 | 206 |
| 102 | iso_pu_bacteria | 2928147474 | 2928147485 | 206 |
| 103 | iso_pu_bacteria | 2929239360 | 2929240655 | 206 |
| 104 | iso_pu_bacteria | 2932082852 | 2932083596 | 206 |
| 105 | 3300005331 | Ga0070670_100073834 | Ga0070670_1000738344 | 208 |
| 106 | 3300005334 | Ga0068869_100138990 | Ga0068869_1001389902 | 208 |
| 107 | 3300005338 | Ga0068868_100645825 | Ga0068868_1006458252 | 208 |
| 108 | 3300005365 | Ga0070688_100484780 | Ga0070688_1004847801 | 208 |
| 109 | 3300005458 | Ga0070681_10590540 | Ga0070681_105905402 | 208 |
| 110 | 3300005466 | Ga0070685_10161057 | Ga0070685_101610571 | 208 |
| 111 | 3300005563 | Ga0068855_100776767 | Ga0068855_1007767671 | 208 |
| 112 | 3300005616 | Ga0068852_100367894 | Ga0068852_1003678942 | 208 |
| 113 | 3300005718 | Ga0068866_10124539 | Ga0068866_101245392 | 208 |
| 114 | 3300006195 | Ga0075366_10000197 | Ga0075366_1000019713 | 208 |
| 115 | 3300006237 | Ga0097621_100018435 | Ga0097621_1000184352 | 208 |
| 116 | 3300006237 | Ga0097621_100024308 | Ga0097621_1000243083 | 208 |
| 117 | 3300006358 | Ga0068871_100032234 | Ga0068871_1000322344 | 208 |
| 118 | 3300009098 | Ga0105245_10031079 | Ga0105245_100310794 | 208 |
| 119 | 3300009174 | Ga0105241_10020736 | Ga0105241_100207362 | 208 |
| 120 | 3300013297 | Ga0157378_10723224 | Ga0157378_107232242 | 208 |
| 121 | 3300013306 | Ga0163162_10126637 | Ga0163162_101266372 | 208 |
| 122 | 3300013308 | Ga0157375_10051608 | Ga0157375_100516086 | 208 |
| 123 | 3300014325 | Ga0163163_10426859 | Ga0163163_104268592 | 208 |
| 124 | 3300014969 | Ga0157376_10036879 | Ga0157376_100368791 | 208 |
| 125 | 3300025912 | Ga0207707_10490641 | Ga0207707_104906411 | 208 |
| 126 | 3300025919 | Ga0207657_10164219 | Ga0207657_101642192 | 208 |
| 127 | 3300025924 | Ga0207694_10094115 | Ga0207694_100941152 | 208 |
| 128 | 3300025925 | Ga0207650_10336712 | Ga0207650_103367122 | 208 |
| 129 | 3300025927 | Ga0207687_10110726 | Ga0207687_101107262 | 208 |
| 130 | 3300025940 | Ga0207691_10105989 | Ga0207691_101059892 | 208 |
| 131 | 3300025942 | Ga0207689_10154073 | Ga0207689_101540731 | 208 |
| 132 | 3300025949 | Ga0207667_10656550 | Ga0207667_106565502 | 208 |
| 133 | 3300026023 | Ga0207677_10462314 | Ga0207677_104623142 | 208 |
| 134 | 3300026095 | Ga0207676_10423602 | Ga0207676_104236021 | 208 |
| 135 | 3300026095 | Ga0207676_10531560 | Ga0207676_105315602 | 208 |
| 136 | 3300026116 | Ga0207674_10088374 | Ga0207674_100883742 | 208 |
| 137 | 3300026142 | Ga0207698_10304397 | Ga0207698_103043972 | 208 |
| 138 | 3300050493 | nmdc:mga0k408_152_c1 | nmdc:mga0k408_152_c1_10056_10754 | 208 |
| 139 | iso_pu_bacteria | 2738541302 | 2738852226 | 208 |
| 140 | iso_pu_bacteria | 2849281842 | 2849285489 | 208 |
| 141 | 3300003322 | rootL2_10041802 | rootL2_100418029 | 209 |
| 142 | 3300003323 | rootH1_10070424 | rootH1_100704244 | 209 |
| 143 | 3300003354 | JGI25160J50197_1006062 | JGI25160J50197_10060623 | 209 |
| 144 | 3300003354 | JGI25160J50197_1009107 | JGI25160J50197_10091074 | 209 |
| 145 | 3300005262 | Ga0065165_1008276 | Ga0065165_10082764 | 209 |
| 146 | 3300010375 | Ga0105239_10279406 | Ga0105239_102794062 | 209 |
| 147 | 3300013104 | Ga0157370_10233244 | Ga0157370_102332442 | 209 |
| 148 | 3300025208 | Ga0209436_102005 | Ga0209436_1020053 | 209 |
| 149 | 3300025284 | Ga0209130_1003592 | Ga0209130_10035923 | 209 |
| 150 | 3300025302 | Ga0207426_1000363 | Ga0207426_100036356 | 209 |
| 151 | 3300025302 | Ga0207426_1000589 | Ga0207426_100058929 | 209 |
| 152 | 3300031344 | Ga0265316_10051620 | Ga0265316_100516202 | 209 |
| 153 | 3300044658 | Ga0466972_0039698 | Ga0466972_0039698_123_806 | 209 |
| 154 | 3300045049 | Ga0466959_0033047 | Ga0466959_0033047_2668_3351 | 209 |
| 155 | 3300049581 | Ga0501047_0166437 | Ga0501047_0166437_345_1028 | 209 |
| 156 | 3300053131 | Ga0500652_036884 | Ga0500652_036884_1076_1759 | 209 |
| 157 | 3300053139 | Ga0500568_0054376 | Ga0500568_0054376_250_933 | 209 |
| 158 | iso_pu_bacteria | 2914759650 | 2914763436 | 209 |
| 159 | 3300001979 | JGI24740J21852_10031747 | JGI24740J21852_100317472 | 210 |
| 160 | 3300001990 | JGI24737J22298_10004147 | JGI24737J22298_100041475 | 210 |
| 161 | 3300001990 | JGI24737J22298_10005859 | JGI24737J22298_100058592 | 210 |
| 162 | 3300002067 | JGI24735J21928_10000002 | JGI24735J21928_1000000252 | 210 |
| 163 | 3300002737 | JGI25162J39368_1000173 | JGI25162J39368_100017375 | 210 |
| 164 | 3300002737 | JGI25162J39368_1000203 | JGI25162J39368_10002038 | 210 |
| 165 | 3300002737 | JGI25162J39368_1000486 | JGI25162J39368_100048623 | 210 |
| 166 | 3300002741 | JGI25157J39369_1014756 | JGI25157J39369_10147562 | 210 |
| 167 | 3300002772 | JGI25164J39214_1000997 | JGI25164J39214_10009974 | 210 |
| 168 | 3300003214 | JGI25165J46597_1000588 | JGI25165J46597_100058813 | 210 |
| 169 | 3300003214 | JGI25165J46597_1015710 | JGI25165J46597_10157101 | 210 |
| 170 | 3300003316 | rootH1_10045496 | rootH1_100454966 | 210 |
| 171 | 3300003320 | rootH2_10000984 | rootH2_1000098461 | 210 |
| 172 | 3300003320 | rootH2_10169248 | rootH2_101692482 | 210 |
| 173 | 3300003322 | rootL2_10168338 | rootL2_101683385 | 210 |
| 174 | 3300003323 | rootH1_10021683 | rootH1_1002168316 | 210 |
| 175 | 3300003323 | rootH1_10052679 | rootH1_100526791 | 210 |
| 176 | 3300003323 | rootH1_10121455 | rootH1_101214553 | 210 |
| 177 | 3300005327 | Ga0070658_10000041 | Ga0070658_1000004160 | 210 |
| 178 | 3300005327 | Ga0070658_10167905 | Ga0070658_101679052 | 210 |
| 179 | 3300005366 | Ga0070659_100032312 | Ga0070659_1000323122 | 210 |
| 180 | 3300005455 | Ga0070663_100015752 | Ga0070663_1000157523 | 210 |
| 181 | 3300005457 | Ga0070662_100000355 | Ga0070662_10000035528 | 210 |
| 182 | 3300005539 | Ga0068853_100029000 | Ga0068853_1000290001 | 210 |
| 183 | 3300005539 | Ga0068853_100513333 | Ga0068853_1005133331 | 210 |
| 184 | 3300005539 | Ga0068853_100628064 | Ga0068853_1006280641 | 210 |
| 185 | 3300005563 | Ga0068855_100000199 | Ga0068855_10000019923 | 210 |
| 186 | 3300005563 | Ga0068855_100000279 | Ga0068855_10000027940 | 210 |
| 187 | 3300005563 | Ga0068855_100024600 | Ga0068855_1000246006 | 210 |
| 188 | 3300005563 | Ga0068855_100052342 | Ga0068855_1000523423 | 210 |
| 189 | 3300005563 | Ga0068855_100074802 | Ga0068855_1000748023 | 210 |
| 190 | 3300005563 | Ga0068855_100163491 | Ga0068855_1001634913 | 210 |
| 191 | 3300005563 | Ga0068855_100204246 | Ga0068855_1002042463 | 210 |
| 192 | 3300005578 | Ga0068854_100095075 | Ga0068854_1000950752 | 210 |
| 193 | 3300005578 | Ga0068854_100335609 | Ga0068854_1003356092 | 210 |
| 194 | 3300005614 | Ga0068856_100000006 | Ga0068856_10000000658 | 210 |
| 195 | 3300005614 | Ga0068856_100009832 | Ga0068856_1000098322 | 210 |
| 196 | 3300005614 | Ga0068856_100019146 | Ga0068856_1000191462 | 210 |
| 197 | 3300005614 | Ga0068856_100060690 | Ga0068856_1000606904 | 210 |
| 198 | 3300005616 | Ga0068852_100224941 | Ga0068852_1002249413 | 210 |
| 199 | 3300005616 | Ga0068852_100494587 | Ga0068852_1004945872 | 210 |
| 200 | 3300005718 | Ga0068866_10068140 | Ga0068866_100681402 | 210 |
| 201 | 3300006195 | Ga0075366_10000210 | Ga0075366_1000021011 | 210 |
| 202 | 3300009093 | Ga0105240_10000083 | Ga0105240_10000083161 | 210 |
| 203 | 3300009093 | Ga0105240_10004631 | Ga0105240_1000463115 | 210 |
| 204 | 3300009093 | Ga0105240_10031223 | Ga0105240_100312236 | 210 |
| 205 | 3300009093 | Ga0105240_10170126 | Ga0105240_101701263 | 210 |
| 206 | 3300009093 | Ga0105240_10310661 | Ga0105240_103106611 | 210 |
| 207 | 3300009093 | Ga0105240_10383665 | Ga0105240_103836652 | 210 |
| 208 | 3300009174 | Ga0105241_10001713 | Ga0105241_1000171313 | 210 |
| 209 | 3300009174 | Ga0105241_10001784 | Ga0105241_1000178412 | 210 |
| 210 | 3300009174 | Ga0105241_10064507 | Ga0105241_100645073 | 210 |
| 211 | 3300009174 | Ga0105241_10108168 | Ga0105241_101081683 | 210 |
| 212 | 3300009174 | Ga0105241_10394710 | Ga0105241_103947101 | 210 |
| 213 | 3300009176 | Ga0105242_10010571 | Ga0105242_100105712 | 210 |
| 214 | 3300009545 | Ga0105237_10000198 | Ga0105237_1000019842 | 210 |
| 215 | 3300009545 | Ga0105237_10003401 | Ga0105237_100034019 | 210 |
| 216 | 3300009545 | Ga0105237_10007709 | Ga0105237_100077097 | 210 |
| 217 | 3300009545 | Ga0105237_10009412 | Ga0105237_1000941212 | 210 |
| 218 | 3300009545 | Ga0105237_10047401 | Ga0105237_100474012 | 210 |
| 219 | 3300009545 | Ga0105237_10250147 | Ga0105237_102501472 | 210 |
| 220 | 3300009551 | Ga0105238_10139245 | Ga0105238_101392452 | 210 |
| 221 | 3300010375 | Ga0105239_10000011 | Ga0105239_10000011307 | 210 |
| 222 | 3300010375 | Ga0105239_10001867 | Ga0105239_1000186721 | 210 |
| 223 | 3300010375 | Ga0105239_10003144 | Ga0105239_100031445 | 210 |
| 224 | 3300010375 | Ga0105239_10007380 | Ga0105239_1000738015 | 210 |
| 225 | 3300010375 | Ga0105239_10010926 | Ga0105239_1001092610 | 210 |
| 226 | 3300010375 | Ga0105239_10010995 | Ga0105239_100109952 | 210 |
| 227 | 3300010375 | Ga0105239_10030977 | Ga0105239_100309771 | 210 |
| 228 | 3300010375 | Ga0105239_10089784 | Ga0105239_100897843 | 210 |
| 229 | 3300010375 | Ga0105239_10126822 | Ga0105239_101268223 | 210 |
| 230 | 3300010375 | Ga0105239_10807991 | Ga0105239_108079912 | 210 |
| 231 | 3300011119 | Ga0105246_10164313 | Ga0105246_101643132 | 210 |
| 232 | 3300013100 | Ga0157373_10000464 | Ga0157373_100004643 | 210 |
| 233 | 3300013100 | Ga0157373_10038403 | Ga0157373_100384032 | 210 |
| 234 | 3300013102 | Ga0157371_10000749 | Ga0157371_1000074916 | 210 |
| 235 | 3300013102 | Ga0157371_10072786 | Ga0157371_100727862 | 210 |
| 236 | 3300013104 | Ga0157370_10002241 | Ga0157370_100022419 | 210 |
| 237 | 3300013105 | Ga0157369_10054487 | Ga0157369_100544872 | 210 |
| 238 | 3300013105 | Ga0157369_10139987 | Ga0157369_101399873 | 210 |
| 239 | 3300013105 | Ga0157369_10555796 | Ga0157369_105557962 | 210 |
| 240 | 3300013296 | Ga0157374_10000536 | Ga0157374_1000053612 | 210 |
| 241 | 3300013296 | Ga0157374_10000967 | Ga0157374_1000096712 | 210 |
| 242 | 3300013296 | Ga0157374_10159843 | Ga0157374_101598433 | 210 |
| 243 | 3300013297 | Ga0157378_10024277 | Ga0157378_100242773 | 210 |
| 244 | 3300013297 | Ga0157378_10030343 | Ga0157378_100303433 | 210 |
| 245 | 3300013306 | Ga0163162_10000005 | Ga0163162_10000005189 | 210 |
| 246 | 3300013306 | Ga0163162_10008607 | Ga0163162_100086073 | 210 |
| 247 | 3300013306 | Ga0163162_10212292 | Ga0163162_102122922 | 210 |
| 248 | 3300013306 | Ga0163162_10330286 | Ga0163162_103302862 | 210 |
| 249 | 3300013307 | Ga0157372_10000011 | Ga0157372_10000011197 | 210 |
| 250 | 3300013307 | Ga0157372_10001047 | Ga0157372_1000104714 | 210 |
| 251 | 3300013307 | Ga0157372_10004867 | Ga0157372_100048674 | 210 |
| 252 | 3300013307 | Ga0157372_10042285 | Ga0157372_100422854 | 210 |
| 253 | 3300013308 | Ga0157375_10065528 | Ga0157375_100655282 | 210 |
| 254 | 3300013308 | Ga0157375_10068770 | Ga0157375_100687703 | 210 |
| 255 | 3300013308 | Ga0157375_10072228 | Ga0157375_100722283 | 210 |
| 256 | 3300014325 | Ga0163163_10339434 | Ga0163163_103394341 | 210 |
| 257 | 3300014969 | Ga0157376_10045613 | Ga0157376_100456133 | 210 |
| 258 | 3300017792 | Ga0163161_10007129 | Ga0163161_100071298 | 210 |
| 259 | 3300021361 | Ga0213872_10007757 | Ga0213872_100077575 | 210 |
| 260 | 3300025231 | Ga0207427_100043 | Ga0207427_100043156 | 210 |
| 261 | 3300025233 | Ga0209437_100008 | Ga0209437_100008782 | 210 |
| 262 | 3300025233 | Ga0209437_100102 | Ga0209437_10010255 | 210 |
| 263 | 3300025233 | Ga0209437_100299 | Ga0209437_10029973 | 210 |
| 264 | 3300025250 | Ga0209026_1000287 | Ga0209026_100028720 | 210 |
| 265 | 3300025250 | Ga0209026_1000609 | Ga0209026_100060910 | 210 |
| 266 | 3300025261 | Ga0209233_1000366 | Ga0209233_100036638 | 210 |
| 267 | 3300025261 | Ga0209233_1001432 | Ga0209233_10014325 | 210 |
| 268 | 3300025261 | Ga0209233_1035303 | Ga0209233_10353032 | 210 |
| 269 | 3300025899 | Ga0207642_10048644 | Ga0207642_100486442 | 210 |
| 270 | 3300025904 | Ga0207647_10000043 | Ga0207647_1000004337 | 210 |
| 271 | 3300025904 | Ga0207647_10000392 | Ga0207647_1000039216 | 210 |
| 272 | 3300025904 | Ga0207647_10127031 | Ga0207647_101270311 | 210 |
| 273 | 3300025909 | Ga0207705_10000068 | Ga0207705_1000006865 | 210 |
| 274 | 3300025909 | Ga0207705_10095062 | Ga0207705_100950623 | 210 |
| 275 | 3300025911 | Ga0207654_10058939 | Ga0207654_100589392 | 210 |
| 276 | 3300025913 | Ga0207695_10000127 | Ga0207695_10000127161 | 210 |
| 277 | 3300025913 | Ga0207695_10020429 | Ga0207695_100204295 | 210 |
| 278 | 3300025913 | Ga0207695_10138763 | Ga0207695_101387633 | 210 |
| 279 | 3300025913 | Ga0207695_10224110 | Ga0207695_102241101 | 210 |
| 280 | 3300025914 | Ga0207671_10000254 | Ga0207671_1000025441 | 210 |
| 281 | 3300025914 | Ga0207671_10002928 | Ga0207671_100029289 | 210 |
| 282 | 3300025914 | Ga0207671_10004487 | Ga0207671_100044875 | 210 |
| 283 | 3300025914 | Ga0207671_10188761 | Ga0207671_101887611 | 210 |
| 284 | 3300025919 | Ga0207657_10077723 | Ga0207657_100777232 | 210 |
| 285 | 3300025924 | Ga0207694_10171470 | Ga0207694_101714702 | 210 |
| 286 | 3300025931 | Ga0207644_10002294 | Ga0207644_1000229414 | 210 |
| 287 | 3300025932 | Ga0207690_10139792 | Ga0207690_101397922 | 210 |
| 288 | 3300025933 | Ga0207706_10000738 | Ga0207706_1000073816 | 210 |
| 289 | 3300025949 | Ga0207667_10000346 | Ga0207667_1000034624 | 210 |
| 290 | 3300025949 | Ga0207667_10013817 | Ga0207667_100138178 | 210 |
| 291 | 3300025949 | Ga0207667_10017117 | Ga0207667_100171174 | 210 |
| 292 | 3300025949 | Ga0207667_10071445 | Ga0207667_100714453 | 210 |
| 293 | 3300025981 | Ga0207640_10078886 | Ga0207640_100788862 | 210 |
| 294 | 3300025981 | Ga0207640_10320052 | Ga0207640_103200521 | 210 |
| 295 | 3300026041 | Ga0207639_10475603 | Ga0207639_104756032 | 210 |
| 296 | 3300026067 | Ga0207678_10060367 | Ga0207678_100603673 | 210 |
| 297 | 3300026078 | Ga0207702_10000023 | Ga0207702_1000002342 | 210 |
| 298 | 3300026078 | Ga0207702_10062592 | Ga0207702_100625923 | 210 |
| 299 | 3300026078 | Ga0207702_10146089 | Ga0207702_101460892 | 210 |
| 300 | 3300026078 | Ga0207702_10495672 | Ga0207702_104956722 | 210 |
| 301 | 3300026142 | Ga0207698_10081202 | Ga0207698_100812023 | 210 |
| 302 | 3300028786 | Ga0307517_10015946 | Ga0307517_100159465 | 210 |
| 303 | 3300028794 | Ga0307515_10009896 | Ga0307515_1000989618 | 210 |
| 304 | 3300028794 | Ga0307515_10013335 | Ga0307515_100133352 | 210 |
| 305 | 3300028800 | Ga0265338_10014144 | Ga0265338_100141442 | 210 |
| 306 | 3300031507 | Ga0307509_10044703 | Ga0307509_100447034 | 210 |
| 307 | 3300033179 | Ga0307507_10000894 | Ga0307507_100008948 | 210 |
| 308 | 3300033180 | Ga0307510_10001986 | Ga0307510_100019864 | 210 |
| 309 | 3300035115 | Ga0373941_0014409 | Ga0373941_0014409_538_1227 | 210 |
| 310 | 3300035398 | Ga0316574_0447586 | Ga0316574_0447586_49_738 | 210 |
| 311 | 3300037312 | Ga0395899_0000177 | Ga0395899_0000177_15588_16277 | 210 |
| 312 | 3300037312 | Ga0395899_0000853 | Ga0395899_0000853_19151_19840 | 210 |
| 313 | 3300037312 | Ga0395899_0006897 | Ga0395899_0006897_6982_7671 | 210 |
| 314 | 3300037418 | Ga0395900_0000139 | Ga0395900_0000139_16935_17624 | 210 |
| 315 | 3300037418 | Ga0395900_0001986 | Ga0395900_0001986_15986_16675 | 210 |
| 316 | 3300037466 | Ga0395898_0032257 | Ga0395898_0032257_3440_4129 | 210 |
| 317 | 3300037466 | Ga0395898_0398735 | Ga0395898_0398735_120_809 | 210 |
| 318 | 3300037471 | Ga0395905_0013551 | Ga0395905_0013551_6420_7109 | 210 |
| 319 | 3300038443 | Ga0395901_0000838 | Ga0395901_0000838_4595_5284 | 210 |
| 320 | 3300039447 | Ga0436361_0616042 | Ga0436361_0616042_1478_2167 | 210 |
| 321 | 3300042005 | Ga0439448_0000952 | Ga0439448_0000952_578_1267 | 210 |
| 322 | 3300044656 | Ga0466969_0026309 | Ga0466969_0026309_1000_1689 | 210 |
| 323 | 3300044684 | Ga0466966_0002350 | Ga0466966_0002350_4112_4801 | 210 |
| 324 | 3300045049 | Ga0466959_0060585 | Ga0466959_0060585_1378_2067 | 210 |
| 325 | 3300046460 | Ga0495638_0202920 | Ga0495638_0202920_331_1017 | 210 |
| 326 | 3300046462 | Ga0495651_0280442 | Ga0495651_0280442_401_1090 | 210 |
| 327 | 3300046471 | Ga0495650_0000036 | Ga0495650_0000036_209592_210281 | 210 |
| 328 | 3300046471 | Ga0495650_0038648 | Ga0495650_0038648_428_1114 | 210 |
| 329 | 3300046471 | Ga0495650_0142101 | Ga0495650_0142101_101_790 | 210 |
| 330 | 3300046492 | Ga0495585_0000704 | Ga0495585_0000704_11461_12150 | 210 |
| 331 | 3300046507 | Ga0495606_0000143 | Ga0495606_0000143_71200_71889 | 210 |
| 332 | 3300046507 | Ga0495606_0004123 | Ga0495606_0004123_7865_8554 | 210 |
| 333 | 3300046507 | Ga0495606_0012660 | Ga0495606_0012660_1368_2057 | 210 |
| 334 | 3300046507 | Ga0495606_0018189 | Ga0495606_0018189_74_763 | 210 |
| 335 | 3300046507 | Ga0495606_0037648 | Ga0495606_0037648_2569_3258 | 210 |
| 336 | 3300046512 | Ga0495610_0001747 | Ga0495610_0001747_7722_8411 | 210 |
| 337 | 3300046513 | Ga0495616_0006658 | Ga0495616_0006658_4438_5124 | 210 |
| 338 | 3300046513 | Ga0495616_0008524 | Ga0495616_0008524_3590_4279 | 210 |
| 339 | 3300046513 | Ga0495616_0009958 | Ga0495616_0009958_947_1636 | 210 |
| 340 | 3300046518 | Ga0495631_0002540 | Ga0495631_0002540_3818_4507 | 210 |
| 341 | 3300046518 | Ga0495631_0027483 | Ga0495631_0027483_1368_2054 | 210 |
| 342 | 3300046519 | Ga0495632_0065365 | Ga0495632_0065365_213_899 | 210 |
| 343 | 3300046524 | Ga0495648_0010424 | Ga0495648_0010424_1592_2281 | 210 |
| 344 | 3300046524 | Ga0495648_0029392 | Ga0495648_0029392_87_776 | 210 |
| 345 | 3300046524 | Ga0495648_0044082 | Ga0495648_0044082_139_828 | 210 |
| 346 | 3300046529 | Ga0495652_0211389 | Ga0495652_0211389_213_902 | 210 |
| 347 | 3300046536 | Ga0495587_0138852 | Ga0495587_0138852_549_1238 | 210 |
| 348 | 3300046538 | Ga0495609_0016092 | Ga0495609_0016092_124_813 | 210 |
| 349 | 3300046558 | Ga0495633_0000079 | Ga0495633_0000079_90544_91233 | 210 |
| 350 | 3300046616 | Ga0495668_0000010 | Ga0495668_0000010_284128_284817 | 210 |
| 351 | 3300046660 | Ga0495625_0000009 | Ga0495625_0000009_29333_30022 | 210 |
| 352 | 3300046660 | Ga0495625_0000791 | Ga0495625_0000791_12710_13399 | 210 |
| 353 | 3300046660 | Ga0495625_0000932 | Ga0495625_0000932_7385_8074 | 210 |
| 354 | 3300046660 | Ga0495625_0044684 | Ga0495625_0044684_904_1590 | 210 |
| 355 | 3300046660 | Ga0495625_0073561 | Ga0495625_0073561_360_1049 | 210 |
| 356 | 3300046660 | Ga0495625_0119685 | Ga0495625_0119685_20_709 | 210 |
| 357 | 3300046660 | Ga0495625_0130416 | Ga0495625_0130416_888_1574 | 210 |
| 358 | 3300046665 | Ga0495661_0016299 | Ga0495661_0016299_167_856 | 210 |
| 359 | 3300046665 | Ga0495661_0048242 | Ga0495661_0048242_970_1656 | 210 |
| 360 | 3300046665 | Ga0495661_0057144 | Ga0495661_0057144_632_1318 | 210 |
| 361 | 3300046694 | Ga0495649_0000008 | Ga0495649_0000008_218536_219225 | 210 |
| 362 | 3300046694 | Ga0495649_0123979 | Ga0495649_0123979_598_1287 | 210 |
| 363 | 3300047323 | Ga0495683_0007331 | Ga0495683_0007331_1673_2362 | 210 |
| 364 | 3300047443 | Ga0495687_002785 | Ga0495687_002785_589_1278 | 210 |
| 365 | 3300047472 | Ga0495686_0000107 | Ga0495686_0000107_29299_29985 | 210 |
| 366 | 3300047472 | Ga0495686_0000673 | Ga0495686_0000673_13321_14007 | 210 |
| 367 | 3300047472 | Ga0495686_0057141 | Ga0495686_0057141_1362_2051 | 210 |
| 368 | 3300047472 | Ga0495686_0073217 | Ga0495686_0073217_291_980 | 210 |
| 369 | 3300047472 | Ga0495686_0153722 | Ga0495686_0153722_391_1080 | 210 |
| 370 | 3300048929 | Ga0496126_0424263 | Ga0496126_0424263_219_908 | 210 |
| 371 | 3300049459 | Ga0495678_111944 | Ga0495678_111944_132_818 | 210 |
| 372 | 3300049460 | Ga0495682_0029619 | Ga0495682_0029619_1037_1726 | 210 |
| 373 | 3300050493 | nmdc:mga0k408_52352_c1 | nmdc:mga0k408_52352_c1_512_1201 | 210 |
| 374 | 3300053088 | Ga0500644_0000081 | Ga0500644_0000081_2280_2966 | 210 |
| 375 | 3300053090 | Ga0500646_0005142 | Ga0500646_0005142_2356_3042 | 210 |
| 376 | 3300053109 | Ga0500569_000086 | Ga0500569_000086_14047_14733 | 210 |
| 377 | 3300053109 | Ga0500569_104085 | Ga0500569_104085_199_885 | 210 |
| 378 | 3300053122 | Ga0500608_011092 | Ga0500608_011092_120_809 | 210 |
| 379 | 3300053123 | Ga0500614_127780 | Ga0500614_127780_32_721 | 210 |
| 380 | 3300053125 | Ga0500618_000040 | Ga0500618_000040_34644_35333 | 210 |
| 381 | 3300053136 | Ga0500559_0038101 | Ga0500559_0038101_66_752 | 210 |
| 382 | 3300053161 | Ga0500634_0017478 | Ga0500634_0017478_1943_2629 | 210 |
| 383 | 3300053177 | Ga0500636_0160121 | Ga0500636_0160121_176_862 | 210 |
| 384 | 3300055283 | Ga0500661_006091 | Ga0500661_006091_1469_2155 | 210 |
| 385 | 3300005327 | Ga0070658_10056700 | Ga0070658_100567002 | 211 |
| 386 | 3300005330 | Ga0070690_100016186 | Ga0070690_1000161865 | 211 |
| 387 | 3300005335 | Ga0070666_10003301 | Ga0070666_100033016 | 211 |
| 388 | 3300005338 | Ga0068868_100002654 | Ga0068868_1000026544 | 211 |
| 389 | 3300005339 | Ga0070660_100004005 | Ga0070660_1000040055 | 211 |
| 390 | 3300005366 | Ga0070659_100005958 | Ga0070659_1000059586 | 211 |
| 391 | 3300005367 | Ga0070667_100015230 | Ga0070667_1000152302 | 211 |
| 392 | 3300005458 | Ga0070681_10033530 | Ga0070681_100335303 | 211 |
| 393 | 3300005458 | Ga0070681_10195056 | Ga0070681_101950562 | 211 |
| 394 | 3300005539 | Ga0068853_100437641 | Ga0068853_1004376412 | 211 |
| 395 | 3300005544 | Ga0070686_100321685 | Ga0070686_1003216852 | 211 |
| 396 | 3300005547 | Ga0070693_100155131 | Ga0070693_1001551311 | 211 |
| 397 | 3300005549 | Ga0070704_100375373 | Ga0070704_1003753732 | 211 |
| 398 | 3300005563 | Ga0068855_100452875 | Ga0068855_1004528751 | 211 |
| 399 | 3300005577 | Ga0068857_100005240 | Ga0068857_1000052407 | 211 |
| 400 | 3300005843 | Ga0068860_100338393 | Ga0068860_1003383932 | 211 |
| 401 | 3300006237 | Ga0097621_100000505 | Ga0097621_10000050512 | 211 |
| 402 | 3300006358 | Ga0068871_100000614 | Ga0068871_1000006144 | 211 |
| 403 | 3300009093 | Ga0105240_10348830 | Ga0105240_103488302 | 211 |
| 404 | 3300009093 | Ga0105240_10704861 | Ga0105240_107048612 | 211 |
| 405 | 3300009098 | Ga0105245_10004153 | Ga0105245_1000415318 | 211 |
| 406 | 3300009176 | Ga0105242_10020526 | Ga0105242_100205262 | 211 |
| 407 | 3300009177 | Ga0105248_10077364 | Ga0105248_100773644 | 211 |
| 408 | 3300009545 | Ga0105237_10010796 | Ga0105237_100107962 | 211 |
| 409 | 3300009551 | Ga0105238_10038848 | Ga0105238_100388481 | 211 |
| 410 | 3300010375 | Ga0105239_10000807 | Ga0105239_100008072 | 211 |
| 411 | 3300010375 | Ga0105239_10202962 | Ga0105239_102029623 | 211 |
| 412 | 3300013296 | Ga0157374_10018304 | Ga0157374_100183043 | 211 |
| 413 | 3300013296 | Ga0157374_10140555 | Ga0157374_101405551 | 211 |
| 414 | 3300013297 | Ga0157378_10000667 | Ga0157378_1000066737 | 211 |
| 415 | 3300013297 | Ga0157378_10649254 | Ga0157378_106492541 | 211 |
| 416 | 3300013308 | Ga0157375_10766894 | Ga0157375_107668942 | 211 |
| 417 | 3300015261 | Ga0182006_1000267 | Ga0182006_10002676 | 211 |
| 418 | 3300025900 | Ga0207710_10047459 | Ga0207710_100474592 | 211 |
| 419 | 3300025903 | Ga0207680_10163379 | Ga0207680_101633791 | 211 |
| 420 | 3300025904 | Ga0207647_10003538 | Ga0207647_100035382 | 211 |
| 421 | 3300025912 | Ga0207707_10014848 | Ga0207707_100148484 | 211 |
| 422 | 3300025912 | Ga0207707_10119769 | Ga0207707_101197693 | 211 |
| 423 | 3300025914 | Ga0207671_10014431 | Ga0207671_100144312 | 211 |
| 424 | 3300025919 | Ga0207657_10086320 | Ga0207657_100863202 | 211 |
| 425 | 3300025921 | Ga0207652_10011789 | Ga0207652_100117892 | 211 |
| 426 | 3300025921 | Ga0207652_10235917 | Ga0207652_102359172 | 211 |
| 427 | 3300025924 | Ga0207694_10046106 | Ga0207694_100461062 | 211 |
| 428 | 3300025927 | Ga0207687_10012522 | Ga0207687_100125223 | 211 |
| 429 | 3300025932 | Ga0207690_10003894 | Ga0207690_100038946 | 211 |
| 430 | 3300025941 | Ga0207711_10016292 | Ga0207711_100162922 | 211 |
| 431 | 3300025941 | Ga0207711_10049413 | Ga0207711_100494133 | 211 |
| 432 | 3300025949 | Ga0207667_10399166 | Ga0207667_103991662 | 211 |
| 433 | 3300025986 | Ga0207658_10072474 | Ga0207658_100724742 | 211 |
| 434 | 3300026023 | Ga0207677_10019158 | Ga0207677_100191583 | 211 |
| 435 | 3300026035 | Ga0207703_10010124 | Ga0207703_100101244 | 211 |
| 436 | 3300026041 | Ga0207639_10003351 | Ga0207639_100033512 | 211 |
| 437 | 3300026041 | Ga0207639_10387198 | Ga0207639_103871982 | 211 |
| 438 | 3300026095 | Ga0207676_10395580 | Ga0207676_103955802 | 211 |
| 439 | 3300026116 | Ga0207674_10018675 | Ga0207674_100186753 | 211 |
| 440 | 3300028381 | Ga0268264_10310452 | Ga0268264_103104522 | 211 |
| 441 | 3300046616 | Ga0495668_0297876 | Ga0495668_0297876_133_825 | 211 |
| 442 | 3300046660 | Ga0495625_0008903 | Ga0495625_0008903_1265_2062 | 211 |
| 443 | 3300046684 | Ga0495669_0124170 | Ga0495669_0124170_494_1189 | 211 |
| 444 | 3300046694 | Ga0495649_0098266 | Ga0495649_0098266_84_785 | 211 |
| 445 | 3300047318 | Ga0495636_0165490 | Ga0495636_0165490_267_959 | 211 |
| 446 | 3300047447 | Ga0495685_027293 | Ga0495685_027293_729_1421 | 211 |
| 447 | 3300053156 | Ga0500622_0000291 | Ga0500622_0000291_39222_39983 | 211 |
| 448 | 3300003322 | rootL2_10092734 | rootL2_100927343 | 212 |
| 449 | 3300003323 | rootH1_10280973 | rootH1_102809732 | 212 |
| 450 | 3300005295 | Ga0065707_10329536 | Ga0065707_103295361 | 212 |
| 451 | 3300005335 | Ga0070666_10018568 | Ga0070666_100185684 | 212 |
| 452 | 3300005337 | Ga0070682_100000839 | Ga0070682_10000083912 | 212 |
| 453 | 3300005340 | Ga0070689_100464983 | Ga0070689_1004649831 | 212 |
| 454 | 3300005353 | Ga0070669_100005601 | Ga0070669_1000056017 | 212 |
| 455 | 3300005355 | Ga0070671_100000755 | Ga0070671_1000007553 | 212 |
| 456 | 3300005367 | Ga0070667_100000002 | Ga0070667_100000002100 | 212 |
| 457 | 3300005466 | Ga0070685_10000003 | Ga0070685_1000000318 | 212 |
| 458 | 3300005548 | Ga0070665_100009662 | Ga0070665_1000096629 | 212 |
| 459 | 3300005616 | Ga0068852_100379267 | Ga0068852_1003792671 | 212 |
| 460 | 3300005618 | Ga0068864_100000002 | Ga0068864_100000002380 | 212 |
| 461 | 3300005843 | Ga0068860_100000499 | Ga0068860_10000049918 | 212 |
| 462 | 3300005844 | Ga0068862_100001709 | Ga0068862_1000017094 | 212 |
| 463 | 3300009101 | Ga0105247_10011594 | Ga0105247_100115945 | 212 |
| 464 | 3300009553 | Ga0105249_10076714 | Ga0105249_100767145 | 212 |
| 465 | 3300013100 | Ga0157373_10193480 | Ga0157373_101934802 | 212 |
| 466 | 3300013102 | Ga0157371_10048872 | Ga0157371_100488723 | 212 |
| 467 | 3300013105 | Ga0157369_10664483 | Ga0157369_106644831 | 212 |
| 468 | 3300013307 | Ga0157372_10060278 | Ga0157372_100602784 | 212 |
| 469 | 3300014325 | Ga0163163_10001034 | Ga0163163_100010349 | 212 |
| 470 | 3300025246 | Ga0209646_1000017 | Ga0209646_1000017151 | 212 |
| 471 | 3300025250 | Ga0209026_1000314 | Ga0209026_10003144 | 212 |
| 472 | 3300025903 | Ga0207680_10094569 | Ga0207680_100945692 | 212 |
| 473 | 3300025904 | Ga0207647_10188236 | Ga0207647_101882362 | 212 |
| 474 | 3300025909 | Ga0207705_10135521 | Ga0207705_101355212 | 212 |
| 475 | 3300025923 | Ga0207681_10003997 | Ga0207681_100039977 | 212 |
| 476 | 3300025925 | Ga0207650_10000002 | Ga0207650_10000002375 | 212 |
| 477 | 3300025931 | Ga0207644_10000673 | Ga0207644_100006733 | 212 |
| 478 | 3300025936 | Ga0207670_10731429 | Ga0207670_107314291 | 212 |
| 479 | 3300025941 | Ga0207711_10000765 | Ga0207711_1000076516 | 212 |
| 480 | 3300025986 | Ga0207658_10000001 | Ga0207658_10000001977 | 212 |
| 481 | 3300026035 | Ga0207703_10208133 | Ga0207703_102081331 | 212 |
| 482 | 3300026088 | Ga0207641_10039803 | Ga0207641_100398035 | 212 |
| 483 | 3300026095 | Ga0207676_10000001 | Ga0207676_10000001375 | 212 |
| 484 | 3300028379 | Ga0268266_10023782 | Ga0268266_100237825 | 212 |
| 485 | 3300028380 | Ga0268265_10000455 | Ga0268265_1000045511 | 212 |
| 486 | 3300028381 | Ga0268264_10000004 | Ga0268264_10000004393 | 212 |
| 487 | 3300031548 | Ga0307408_100000859 | Ga0307408_10000085911 | 212 |
| 488 | 3300037312 | Ga0395899_0004174 | Ga0395899_0004174_2176_2871 | 212 |
| 489 | 3300037312 | Ga0395899_0113912 | Ga0395899_0113912_689_1384 | 212 |
| 490 | 3300037312 | Ga0395899_0115396 | Ga0395899_0115396_336_1103 | 212 |
| 491 | 3300037418 | Ga0395900_0003729 | Ga0395900_0003729_10660_11355 | 212 |
| 492 | 3300037418 | Ga0395900_0154595 | Ga0395900_0154595_35_730 | 212 |
| 493 | 3300037466 | Ga0395898_0005317 | Ga0395898_0005317_8225_8920 | 212 |
| 494 | 3300037471 | Ga0395905_0019014 | Ga0395905_0019014_336_1031 | 212 |
| 495 | 3300038443 | Ga0395901_0084537 | Ga0395901_0084537_2332_3027 | 212 |
| 496 | 3300038443 | Ga0395901_0707879 | Ga0395901_0707879_35_730 | 212 |
| 497 | 3300003316 | rootH1_10133118 | rootH1_101331181 | 213 |
| 498 | 3300003322 | rootL2_10109435 | rootL2_101094352 | 213 |
| 499 | 3300003323 | rootH1_10321219 | rootH1_103212193 | 213 |
| 500 | 3300005288 | Ga0065714_10238212 | Ga0065714_102382121 | 213 |
| 501 | 3300005290 | Ga0065712_10072090 | Ga0065712_100720903 | 213 |
| 502 | 3300005337 | Ga0070682_100054751 | Ga0070682_1000547512 | 213 |
| 503 | 3300005365 | Ga0070688_100000001 | Ga0070688_10000000131 | 213 |
| 504 | 3300005434 | Ga0070709_10374286 | Ga0070709_103742862 | 213 |
| 505 | 3300005436 | Ga0070713_100014049 | Ga0070713_1000140496 | 213 |
| 506 | 3300005445 | Ga0070708_100268903 | Ga0070708_1002689032 | 213 |
| 507 | 3300005459 | Ga0068867_100331576 | Ga0068867_1003315762 | 213 |
| 508 | 3300005543 | Ga0070672_100000377 | Ga0070672_10000037713 | 213 |
| 509 | 3300005546 | Ga0070696_100079768 | Ga0070696_1000797681 | 213 |
| 510 | 3300005614 | Ga0068856_100458490 | Ga0068856_1004584902 | 213 |
| 511 | 3300005618 | Ga0068864_100000204 | Ga0068864_10000020452 | 213 |
| 512 | 3300005618 | Ga0068864_100023593 | Ga0068864_1000235933 | 213 |
| 513 | 3300005834 | Ga0068851_10226227 | Ga0068851_102262271 | 213 |
| 514 | 3300006028 | Ga0070717_10098075 | Ga0070717_100980752 | 213 |
| 515 | 3300006237 | Ga0097621_100023640 | Ga0097621_1000236403 | 213 |
| 516 | 3300006237 | Ga0097621_100255418 | Ga0097621_1002554182 | 213 |
| 517 | 3300006358 | Ga0068871_100047136 | Ga0068871_1000471363 | 213 |
| 518 | 3300006844 | Ga0075428_100209699 | Ga0075428_1002096992 | 213 |
| 519 | 3300006846 | Ga0075430_100487295 | Ga0075430_1004872952 | 213 |
| 520 | 3300006847 | Ga0075431_100145335 | Ga0075431_1001453352 | 213 |
| 521 | 3300009011 | Ga0105251_10016317 | Ga0105251_100163172 | 213 |
| 522 | 3300009093 | Ga0105240_10000692 | Ga0105240_1000069229 | 213 |
| 523 | 3300010375 | Ga0105239_10004417 | Ga0105239_100044179 | 213 |
| 524 | 3300011119 | Ga0105246_10137587 | Ga0105246_101375872 | 213 |
| 525 | 3300013104 | Ga0157370_10135395 | Ga0157370_101353952 | 213 |
| 526 | 3300013297 | Ga0157378_10036775 | Ga0157378_100367752 | 213 |
| 527 | 3300013297 | Ga0157378_10074424 | Ga0157378_100744244 | 213 |
| 528 | 3300013297 | Ga0157378_10195722 | Ga0157378_101957222 | 213 |
| 529 | 3300013306 | Ga0163162_10280779 | Ga0163162_102807792 | 213 |
| 530 | 3300013308 | Ga0157375_10690215 | Ga0157375_106902151 | 213 |
| 531 | 3300013308 | Ga0157375_10729648 | Ga0157375_107296481 | 213 |
| 532 | 3300025321 | Ga0207656_10166036 | Ga0207656_101660361 | 213 |
| 533 | 3300025906 | Ga0207699_10290678 | Ga0207699_102906782 | 213 |
| 534 | 3300025907 | Ga0207645_10207646 | Ga0207645_102076462 | 213 |
| 535 | 3300025913 | Ga0207695_10000020 | Ga0207695_1000002030 | 213 |
| 536 | 3300025928 | Ga0207700_10012739 | Ga0207700_100127392 | 213 |
| 537 | 3300025936 | Ga0207670_10000012 | Ga0207670_1000001275 | 213 |
| 538 | 3300025938 | Ga0207704_10223540 | Ga0207704_102235403 | 213 |
| 539 | 3300026035 | Ga0207703_10533752 | Ga0207703_105337521 | 213 |
| 540 | 3300026078 | Ga0207702_10352100 | Ga0207702_103521002 | 213 |
| 541 | 3300026089 | Ga0207648_10442745 | Ga0207648_104427452 | 213 |
| 542 | 3300026095 | Ga0207676_10000023 | Ga0207676_1000002351 | 213 |
| 543 | 3300026116 | Ga0207674_10041592 | Ga0207674_100415924 | 213 |
| 544 | 3300028794 | Ga0307515_10000002 | Ga0307515_10000002691 | 213 |
| 545 | 3300031995 | Ga0307409_100969708 | Ga0307409_1009697082 | 213 |
| 546 | 3300032002 | Ga0307416_100101227 | Ga0307416_1001012272 | 213 |
| 547 | 3300037418 | Ga0395900_0468161 | Ga0395900_0468161_370_1068 | 213 |
| 548 | 3300037853 | Ga0436364_0874301 | Ga0436364_0874301_181_903 | 213 |
| 549 | 3300044712 | Ga0453684_0049946 | Ga0453684_0049946_211_921 | 213 |
| 550 | 3300046616 | Ga0495668_0000433 | Ga0495668_0000433_45392_46102 | 213 |
| 551 | 3300049823 | Ga0501044_0215037 | Ga0501044_0215037_216_911 | 213 |
| 552 | 3300053138 | Ga0500564_007177 | Ga0500564_007177_2401_3096 | 213 |
| 553 | 2162886007 | SwRhRL2b_contig_2391078 | SwRhRL2b_0625.00000870 | 214 |
| 554 | 2162886011 | MRS1b_contig_9365721 | MRS1b_0463.00001610 | 214 |
| 555 | 3300002459 | JGI24751J29686_10000010 | JGI24751J29686_1000001022 | 214 |
| 556 | 3300002459 | JGI24751J29686_10000107 | JGI24751J29686_1000010731 | 214 |
| 557 | 3300003322 | rootL2_10092735 | rootL2_100927352 | 214 |
| 558 | 3300005288 | Ga0065714_10064435 | Ga0065714_1006443536 | 214 |
| 559 | 3300005290 | Ga0065712_10000118 | Ga0065712_1000011837 | 214 |
| 560 | 3300005293 | Ga0065715_10089145 | Ga0065715_100891458 | 214 |
| 561 | 3300005293 | Ga0065715_10157525 | Ga0065715_101575251 | 214 |
| 562 | 3300005295 | Ga0065707_10001947 | Ga0065707_100019474 | 214 |
| 563 | 3300005329 | Ga0070683_100005232 | Ga0070683_1000052326 | 214 |
| 564 | 3300005331 | Ga0070670_100000172 | Ga0070670_10000017230 | 214 |
| 565 | 3300005334 | Ga0068869_100619318 | Ga0068869_1006193181 | 214 |
| 566 | 3300005335 | Ga0070666_10038570 | Ga0070666_100385702 | 214 |
| 567 | 3300005336 | Ga0070680_100174214 | Ga0070680_1001742141 | 214 |
| 568 | 3300005337 | Ga0070682_100002934 | Ga0070682_1000029342 | 214 |
| 569 | 3300005338 | Ga0068868_100164372 | Ga0068868_1001643722 | 214 |
| 570 | 3300005339 | Ga0070660_100006429 | Ga0070660_1000064294 | 214 |
| 571 | 3300005343 | Ga0070687_100073734 | Ga0070687_1000737343 | 214 |
| 572 | 3300005344 | Ga0070661_100008270 | Ga0070661_1000082701 | 214 |
| 573 | 3300005353 | Ga0070669_100042724 | Ga0070669_1000427243 | 214 |
| 574 | 3300005354 | Ga0070675_100039548 | Ga0070675_1000395482 | 214 |
| 575 | 3300005364 | Ga0070673_100677954 | Ga0070673_1006779542 | 214 |
| 576 | 3300005366 | Ga0070659_100027729 | Ga0070659_1000277293 | 214 |
| 577 | 3300005436 | Ga0070713_100182537 | Ga0070713_1001825373 | 214 |
| 578 | 3300005440 | Ga0070705_100013532 | Ga0070705_1000135323 | 214 |
| 579 | 3300005441 | Ga0070700_100000316 | Ga0070700_10000031619 | 214 |
| 580 | 3300005441 | Ga0070700_100066212 | Ga0070700_1000662123 | 214 |
| 581 | 3300005444 | Ga0070694_100003332 | Ga0070694_1000033327 | 214 |
| 582 | 3300005445 | Ga0070708_100175680 | Ga0070708_1001756803 | 214 |
| 583 | 3300005456 | Ga0070678_100184423 | Ga0070678_1001844232 | 214 |
| 584 | 3300005457 | Ga0070662_100014364 | Ga0070662_1000143644 | 214 |
| 585 | 3300005458 | Ga0070681_10005292 | Ga0070681_100052927 | 214 |
| 586 | 3300005458 | Ga0070681_10028068 | Ga0070681_100280683 | 214 |
| 587 | 3300005459 | Ga0068867_100013911 | Ga0068867_1000139113 | 214 |
| 588 | 3300005459 | Ga0068867_100051398 | Ga0068867_1000513985 | 214 |
| 589 | 3300005459 | Ga0068867_100135043 | Ga0068867_1001350432 | 214 |
| 590 | 3300005459 | Ga0068867_100747107 | Ga0068867_1007471071 | 214 |
| 591 | 3300005471 | Ga0070698_100115416 | Ga0070698_1001154164 | 214 |
| 592 | 3300005518 | Ga0070699_100003179 | Ga0070699_1000031793 | 214 |
| 593 | 3300005539 | Ga0068853_100048608 | Ga0068853_1000486081 | 214 |
| 594 | 3300005547 | Ga0070693_100154091 | Ga0070693_1001540912 | 214 |
| 595 | 3300005563 | Ga0068855_100056250 | Ga0068855_1000562502 | 214 |
| 596 | 3300005564 | Ga0070664_100057821 | Ga0070664_1000578212 | 214 |
| 597 | 3300005577 | Ga0068857_100115936 | Ga0068857_1001159362 | 214 |
| 598 | 3300005577 | Ga0068857_100320828 | Ga0068857_1003208282 | 214 |
| 599 | 3300005578 | Ga0068854_100636275 | Ga0068854_1006362751 | 214 |
| 600 | 3300005614 | Ga0068856_100020537 | Ga0068856_1000205372 | 214 |
| 601 | 3300005615 | Ga0070702_100065755 | Ga0070702_1000657552 | 214 |
| 602 | 3300005616 | Ga0068852_100013589 | Ga0068852_1000135895 | 214 |
| 603 | 3300005617 | Ga0068859_100000232 | Ga0068859_10000023223 | 214 |
| 604 | 3300005617 | Ga0068859_100068491 | Ga0068859_1000684913 | 214 |
| 605 | 3300005617 | Ga0068859_100409774 | Ga0068859_1004097742 | 214 |
| 606 | 3300005618 | Ga0068864_100030488 | Ga0068864_1000304883 | 214 |
| 607 | 3300005618 | Ga0068864_100237518 | Ga0068864_1002375183 | 214 |
| 608 | 3300005719 | Ga0068861_100001436 | Ga0068861_1000014368 | 214 |
| 609 | 3300005834 | Ga0068851_10047670 | Ga0068851_100476702 | 214 |
| 610 | 3300005841 | Ga0068863_100051999 | Ga0068863_1000519992 | 214 |
| 611 | 3300005841 | Ga0068863_100406769 | Ga0068863_1004067692 | 214 |
| 612 | 3300005841 | Ga0068863_100446762 | Ga0068863_1004467622 | 214 |
| 613 | 3300005842 | Ga0068858_100087171 | Ga0068858_1000871712 | 214 |
| 614 | 3300005842 | Ga0068858_100624099 | Ga0068858_1006240992 | 214 |
| 615 | 3300005843 | Ga0068860_100152663 | Ga0068860_1001526632 | 214 |
| 616 | 3300005843 | Ga0068860_100788811 | Ga0068860_1007888111 | 214 |
| 617 | 3300005843 | Ga0068860_101262279 | Ga0068860_1012622791 | 214 |
| 618 | 3300005985 | Ga0081539_10000534 | Ga0081539_1000053458 | 214 |
| 619 | 3300006173 | Ga0070716_100025815 | Ga0070716_1000258153 | 214 |
| 620 | 3300006237 | Ga0097621_100027659 | Ga0097621_1000276593 | 214 |
| 621 | 3300006847 | Ga0075431_100148256 | Ga0075431_1001482563 | 214 |
| 622 | 3300006852 | Ga0075433_10583645 | Ga0075433_105836452 | 214 |
| 623 | 3300006871 | Ga0075434_100192772 | Ga0075434_1001927723 | 214 |
| 624 | 3300006871 | Ga0075434_100296995 | Ga0075434_1002969951 | 214 |
| 625 | 3300006871 | Ga0075434_100844977 | Ga0075434_1008449772 | 214 |
| 626 | 3300006931 | Ga0097620_100000232 | Ga0097620_10000023223 | 214 |
| 627 | 3300006931 | Ga0097620_100068491 | Ga0097620_1000684913 | 214 |
| 628 | 3300006931 | Ga0097620_100409757 | Ga0097620_1004097572 | 214 |
| 629 | 3300009094 | Ga0111539_10009141 | Ga0111539_100091413 | 214 |
| 630 | 3300009094 | Ga0111539_10174955 | Ga0111539_101749553 | 214 |
| 631 | 3300009101 | Ga0105247_10100625 | Ga0105247_101006251 | 214 |
| 632 | 3300009148 | Ga0105243_10017206 | Ga0105243_100172064 | 214 |
| 633 | 3300009148 | Ga0105243_10065566 | Ga0105243_100655661 | 214 |
| 634 | 3300009174 | Ga0105241_10035486 | Ga0105241_100354863 | 214 |
| 635 | 3300009174 | Ga0105241_10373739 | Ga0105241_103737392 | 214 |
| 636 | 3300009176 | Ga0105242_10301285 | Ga0105242_103012852 | 214 |
| 637 | 3300009177 | Ga0105248_10018980 | Ga0105248_100189804 | 214 |
| 638 | 3300009177 | Ga0105248_10206786 | Ga0105248_102067862 | 214 |
| 639 | 3300009177 | Ga0105248_10298121 | Ga0105248_102981213 | 214 |
| 640 | 3300009551 | Ga0105238_10020299 | Ga0105238_100202993 | 214 |
| 641 | 3300009553 | Ga0105249_10002707 | Ga0105249_100027073 | 214 |
| 642 | 3300009553 | Ga0105249_10781111 | Ga0105249_107811111 | 214 |
| 643 | 3300010375 | Ga0105239_10888540 | Ga0105239_108885401 | 214 |
| 644 | 3300010375 | Ga0105239_11177808 | Ga0105239_111778081 | 214 |
| 645 | 3300011119 | Ga0105246_10409259 | Ga0105246_104092592 | 214 |
| 646 | 3300013100 | Ga0157373_10004461 | Ga0157373_100044612 | 214 |
| 647 | 3300013102 | Ga0157371_10006822 | Ga0157371_100068227 | 214 |
| 648 | 3300013104 | Ga0157370_10095003 | Ga0157370_100950032 | 214 |
| 649 | 3300013105 | Ga0157369_10147038 | Ga0157369_101470383 | 214 |
| 650 | 3300013296 | Ga0157374_10063148 | Ga0157374_100631483 | 214 |
| 651 | 3300013297 | Ga0157378_10008787 | Ga0157378_100087872 | 214 |
| 652 | 3300013306 | Ga0163162_10060121 | Ga0163162_100601212 | 214 |
| 653 | 3300013306 | Ga0163162_10067089 | Ga0163162_100670893 | 214 |
| 654 | 3300013306 | Ga0163162_10428363 | Ga0163162_104283633 | 214 |
| 655 | 3300013307 | Ga0157372_10025599 | Ga0157372_100255992 | 214 |
| 656 | 3300013307 | Ga0157372_10596446 | Ga0157372_105964461 | 214 |
| 657 | 3300013308 | Ga0157375_10717282 | Ga0157375_107172822 | 214 |
| 658 | 3300014325 | Ga0163163_10000172 | Ga0163163_100001723 | 214 |
| 659 | 3300014325 | Ga0163163_10343491 | Ga0163163_103434912 | 214 |
| 660 | 3300014325 | Ga0163163_10455159 | Ga0163163_104551592 | 214 |
| 661 | 3300014969 | Ga0157376_10315191 | Ga0157376_103151912 | 214 |
| 662 | 3300021384 | Ga0213876_10004110 | Ga0213876_100041102 | 214 |
| 663 | 3300025900 | Ga0207710_10150944 | Ga0207710_101509441 | 214 |
| 664 | 3300025903 | Ga0207680_10013425 | Ga0207680_100134252 | 214 |
| 665 | 3300025911 | Ga0207654_10334520 | Ga0207654_103345201 | 214 |
| 666 | 3300025911 | Ga0207654_10431531 | Ga0207654_104315312 | 214 |
| 667 | 3300025912 | Ga0207707_10318043 | Ga0207707_103180431 | 214 |
| 668 | 3300025918 | Ga0207662_10051503 | Ga0207662_100515031 | 214 |
| 669 | 3300025919 | Ga0207657_10006159 | Ga0207657_100061593 | 214 |
| 670 | 3300025920 | Ga0207649_10009942 | Ga0207649_100099421 | 214 |
| 671 | 3300025924 | Ga0207694_10011623 | Ga0207694_100116233 | 214 |
| 672 | 3300025925 | Ga0207650_10000001 | Ga0207650_10000001490 | 214 |
| 673 | 3300025926 | Ga0207659_10041633 | Ga0207659_100416332 | 214 |
| 674 | 3300025933 | Ga0207706_10005031 | Ga0207706_100050318 | 214 |
| 675 | 3300025933 | Ga0207706_10190436 | Ga0207706_101904362 | 214 |
| 676 | 3300025934 | Ga0207686_10033683 | Ga0207686_100336831 | 214 |
| 677 | 3300025935 | Ga0207709_10034119 | Ga0207709_100341192 | 214 |
| 678 | 3300025935 | Ga0207709_10445371 | Ga0207709_104453712 | 214 |
| 679 | 3300025939 | Ga0207665_10200533 | Ga0207665_102005332 | 214 |
| 680 | 3300025941 | Ga0207711_10014165 | Ga0207711_100141653 | 214 |
| 681 | 3300025941 | Ga0207711_10084621 | Ga0207711_100846213 | 214 |
| 682 | 3300025941 | Ga0207711_10142602 | Ga0207711_101426022 | 214 |
| 683 | 3300025949 | Ga0207667_10269299 | Ga0207667_102692992 | 214 |
| 684 | 3300025960 | Ga0207651_10099358 | Ga0207651_100993583 | 214 |
| 685 | 3300025960 | Ga0207651_10442717 | Ga0207651_104427171 | 214 |
| 686 | 3300025961 | Ga0207712_10001316 | Ga0207712_100013163 | 214 |
| 687 | 3300025981 | Ga0207640_10040001 | Ga0207640_100400013 | 214 |
| 688 | 3300026023 | Ga0207677_10228864 | Ga0207677_102288642 | 214 |
| 689 | 3300026041 | Ga0207639_10036831 | Ga0207639_100368312 | 214 |
| 690 | 3300026075 | Ga0207708_10000061 | Ga0207708_1000006165 | 214 |
| 691 | 3300026075 | Ga0207708_10040287 | Ga0207708_100402873 | 214 |
| 692 | 3300026078 | Ga0207702_10023617 | Ga0207702_100236174 | 214 |
| 693 | 3300026088 | Ga0207641_10368258 | Ga0207641_103682583 | 214 |
| 694 | 3300026088 | Ga0207641_10623886 | Ga0207641_106238861 | 214 |
| 695 | 3300026089 | Ga0207648_10020187 | Ga0207648_100201873 | 214 |
| 696 | 3300026089 | Ga0207648_10107916 | Ga0207648_101079163 | 214 |
| 697 | 3300026089 | Ga0207648_10142292 | Ga0207648_101422925 | 214 |
| 698 | 3300026089 | Ga0207648_10170733 | Ga0207648_101707332 | 214 |
| 699 | 3300026095 | Ga0207676_10093434 | Ga0207676_100934342 | 214 |
| 700 | 3300026095 | Ga0207676_10394397 | Ga0207676_103943972 | 214 |
| 701 | 3300026095 | Ga0207676_10556040 | Ga0207676_105560402 | 214 |
| 702 | 3300026116 | Ga0207674_10137182 | Ga0207674_101371821 | 214 |
| 703 | 3300026116 | Ga0207674_10695018 | Ga0207674_106950181 | 214 |
| 704 | 3300026118 | Ga0207675_100003627 | Ga0207675_1000036277 | 214 |
| 705 | 3300026118 | Ga0207675_100422350 | Ga0207675_1004223502 | 214 |
| 706 | 3300026118 | Ga0207675_100450227 | Ga0207675_1004502272 | 214 |
| 707 | 3300026118 | Ga0207675_100628019 | Ga0207675_1006280192 | 214 |
| 708 | 3300026121 | Ga0207683_10204870 | Ga0207683_102048702 | 214 |
| 709 | 3300026142 | Ga0207698_10027682 | Ga0207698_100276822 | 214 |
| 710 | 3300028381 | Ga0268264_10033142 | Ga0268264_100331422 | 214 |
| 711 | 3300028381 | Ga0268264_10133451 | Ga0268264_101334511 | 214 |
| 712 | 3300028381 | Ga0268264_10955287 | Ga0268264_109552871 | 214 |
| 713 | 3300031251 | Ga0265327_10000344 | Ga0265327_1000034425 | 214 |
| 714 | 3300031251 | Ga0265327_10045118 | Ga0265327_100451182 | 214 |
| 715 | 3300031548 | Ga0307408_100003612 | Ga0307408_1000036123 | 214 |
| 716 | 3300031548 | Ga0307408_100154291 | Ga0307408_1001542912 | 214 |
| 717 | 3300031548 | Ga0307408_100251194 | Ga0307408_1002511941 | 214 |
| 718 | 3300031824 | Ga0307413_10249260 | Ga0307413_102492602 | 214 |
| 719 | 3300031901 | Ga0307406_10000578 | Ga0307406_1000057821 | 214 |
| 720 | 3300031903 | Ga0307407_10163782 | Ga0307407_101637821 | 214 |
| 721 | 3300031903 | Ga0307407_10299047 | Ga0307407_102990472 | 214 |
| 722 | 3300031911 | Ga0307412_10003104 | Ga0307412_100031043 | 214 |
| 723 | 3300031911 | Ga0307412_10071980 | Ga0307412_100719803 | 214 |
| 724 | 3300031995 | Ga0307409_100029817 | Ga0307409_1000298173 | 214 |
| 725 | 3300032002 | Ga0307416_100002833 | Ga0307416_1000028339 | 214 |
| 726 | 3300032002 | Ga0307416_100082445 | Ga0307416_1000824452 | 214 |
| 727 | 3300032004 | Ga0307414_10003090 | Ga0307414_100030903 | 214 |
| 728 | 3300032005 | Ga0307411_10040125 | Ga0307411_100401253 | 214 |
| 729 | 3300032126 | Ga0307415_100001307 | Ga0307415_1000013073 | 214 |
| 730 | 3300032126 | Ga0307415_100065230 | Ga0307415_1000652303 | 214 |
| 731 | 3300038443 | Ga0395901_0394157 | Ga0395901_0394157_640_1338 | 214 |
| 732 | 3300039437 | Ga0436365_1919188 | Ga0436365_1919188_4469_5185 | 214 |
| 733 | 3300042007 | Ga0439449_0102220 | Ga0439449_0102220_283_981 | 214 |
| 734 | 3300042012 | Ga0439455_0032835 | Ga0439455_0032835_221_925 | 214 |
| 735 | 3300042438 | Ga0439459_0049740 | Ga0439459_0049740_169_873 | 214 |
| 736 | 3300045976 | Ga0466967_0153352 | Ga0466967_0153352_844_1548 | 214 |
| 737 | 3300047472 | Ga0495686_0006124 | Ga0495686_0006124_6936_7637 | 214 |
| 738 | 3300048905 | Ga0496102_0226286 | Ga0496102_0226286_827_1525 | 214 |
| 739 | 3300048907 | Ga0496104_0558215 | Ga0496104_0558215_56_754 | 214 |
| 740 | 3300048911 | Ga0496108_0079183 | Ga0496108_0079183_1168_1866 | 214 |
| 741 | 3300048914 | Ga0496111_0280739 | Ga0496111_0280739_134_832 | 214 |
| 742 | 3300049514 | Ga0501291_006870 | Ga0501291_006870_169_867 | 214 |
| 743 | 3300049520 | Ga0501297_007527 | Ga0501297_007527_218_916 | 214 |
| 744 | 3300049521 | Ga0501298_004133 | Ga0501298_004133_568_1266 | 214 |
| 745 | 3300049522 | Ga0501299_023837 | Ga0501299_023837_288_986 | 214 |
| 746 | 3300049583 | Ga0501067_0045071 | Ga0501067_0045071_1094_1792 | 214 |
| 747 | 3300049649 | Ga0501198_005615 | Ga0501198_005615_994_1692 | 214 |
| 748 | 3300049652 | Ga0501202_004419 | Ga0501202_004419_920_1618 | 214 |
| 749 | 3300049654 | Ga0501207_002239 | Ga0501207_002239_779_1477 | 214 |
| 750 | 3300049660 | Ga0501216_007077 | Ga0501216_007077_947_1645 | 214 |
| 751 | 3300049661 | Ga0501217_000924 | Ga0501217_000924_1962_2660 | 214 |
| 752 | 3300049663 | Ga0501223_002194 | Ga0501223_002194_791_1489 | 214 |
| 753 | 3300049665 | Ga0501227_000370 | Ga0501227_000370_7012_7710 | 214 |
| 754 | 3300049665 | Ga0501227_083097 | Ga0501227_083097_23_721 | 214 |
| 755 | 3300049668 | Ga0501233_002952 | Ga0501233_002952_1735_2433 | 214 |
| 756 | 3300049670 | Ga0501236_010870 | Ga0501236_010870_451_1149 | 214 |
| 757 | 3300049686 | Ga0501257_002411 | Ga0501257_002411_3144_3911 | 214 |
| 758 | 3300049688 | Ga0501259_006855 | Ga0501259_006855_603_1301 | 214 |
| 759 | 3300049690 | Ga0501261_031759 | Ga0501261_031759_45_743 | 214 |
| 760 | 3300049704 | Ga0501221_016794 | Ga0501221_016794_498_1196 | 214 |
| 761 | 3300049705 | Ga0501225_0016490 | Ga0501225_0016490_1330_2028 | 214 |
| 762 | 3300049707 | Ga0501234_000506 | Ga0501234_000506_3140_3838 | 214 |
| 763 | 3300049708 | Ga0501245_003271 | Ga0501245_003271_361_1059 | 214 |
| 764 | 3300049768 | Ga0501271_006854 | Ga0501271_006854_272_970 | 214 |
| 765 | 3300049779 | Ga0501283_002273 | Ga0501283_002273_925_1623 | 214 |
| 766 | 3300050511 | nmdc:mga08y16_22785_c1 | nmdc:mga08y16_22785_c1_535_1233 | 214 |
| 767 | 3300050511 | nmdc:mga08y16_256953_c1 | nmdc:mga08y16_256953_c1_738_1436 | 214 |
| 768 | 3300050512 | nmdc:mga0n895_208125_c1 | nmdc:mga0n895_208125_c1_405_1103 | 214 |
| 769 | 3300050512 | nmdc:mga0n895_45178_c1 | nmdc:mga0n895_45178_c1_830_1528 | 214 |
| 770 | 3300050515 | nmdc:mga0a205_301389_c1 | nmdc:mga0a205_301389_c1_617_1315 | 214 |
| 771 | 3300050515 | nmdc:mga0a205_63792_c1 | nmdc:mga0a205_63792_c1_387_1085 | 214 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6iu4-assembly1.cif.gz_A | crystal structure of iron transporter vit1 with cobalt ion | 0.8123 | 15 | 212 |
| 6iu4-assembly1.cif.gz_A | crystal structure of iron transporter vit1 with cobalt ion | 0.7525 | 15 | 212 |
| 6iu9-assembly4.cif.gz_H | crystal structure of cytoplasmic metal binding domain with iron ions | 0.6088 | 74 | 124 |
| 6iu9-assembly4.cif.gz_H | crystal structure of cytoplasmic metal binding domain with iron ions | 0.4399 | 74 | 124 |
| 2npk-assembly1.cif.gz_A | an unusual twin-his arrangement in the pore of ammonia channels is essential for substrate conductance | 0.4207 | 112 | 213 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1K5I4_32_243_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.8363 | 18 | 209 | 1.20.1260.10 |
| af_Q4DKQ8_55_270_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.8034 | 18 | 209 | 1.20.1260.10 |
| af_K7MU65_40_256_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.7967 | 18 | 209 | 1.20.1260.10 |
| af_Q6ERE5_80_240_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.7952 | 68 | 208 | 1.20.1260.10 |
| af_Q59SS1_143_307_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.7849 | 69 | 207 | 1.20.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F6UXV6-F1-model_v4 | Rubrerythrin family protein | 0.9328 | 11 | 212 |
GO:0005384
GO:0012505 GO:0016020 GO:0030026 |
| AF-A0A1F5ECY8-F1-model_v4 | VIT family protein | 0.9324 | 15 | 213 |
GO:0005384
GO:0012505 GO:0016020 GO:0030026 |
| AF-A0A661A5F6-F1-model_v4 | Rubrerythrin family protein | 0.932 | 15 | 212 |
GO:0005384
GO:0012505 GO:0016020 GO:0030026 |
| AF-A0A2M6WWZ7-F1-model_v4 | Rubrerythrin family protein | 0.9298 | 16 | 212 |
GO:0005384
GO:0012505 GO:0016020 GO:0030026 |
| AF-A0A7X8ASS7-F1-model_v4 | Rubrerythrin family protein | 0.9256 | 11 | 212 |
GO:0005384
GO:0012505 GO:0016020 GO:0016491 GO:0030026 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar