F480097
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 771 | 416 | 666 | 289 |
Family's Representative Sequence
| Representative Sequence | 3300053131|Ga0500652_003553|Ga0500652_003553_1056_2099 |
| Length | 336 |
| Sequence | VTNDALQSLLDLLDLERIEQDIFRGTSLPAIVPRVFGGQVAAQALVAAGRTVPQDRAAHSLHAYFLRTGDPGAPIVYEVDRIRDGRSFTTRRVVAVQHGQPIFHLSASFQAYEDGLDHQEPMPPAPDPETLPSAEELLPAHADKFPDPGVLDRLLESRAAVDLRYVDDPPYLTAGRGPREPRSQVWFRTRGKLADDPLLHVCLATYVSDMTLLDSVLLAHGRGGWAVGDVVGASLDHAMWFHRPFRADEWLLYDQQSPSASGGRGLGTARIYTSDGRLAVSVIQEGVVRVPRSHESLCGAAPGPLLRAAAPVPPRPGDTPSAGRGWSPRPCLRPRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 2 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 3 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 4 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 5 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 6 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 7 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 8 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 9 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 10 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 11 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 12 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 13 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 14 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 15 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 16 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 17 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 18 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 19 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 20 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 21 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 22 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 23 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 24 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 25 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 26 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 27 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 28 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 29 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 30 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 31 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 32 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 33 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 34 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 35 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 36 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 37 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 38 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 39 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 40 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 41 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 42 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 43 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 44 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 45 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 46 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 47 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 48 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 49 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 50 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 51 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 52 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 53 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 54 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 55 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 56 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 57 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 58 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 59 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 60 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 61 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 62 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 63 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 64 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 65 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 66 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 67 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 68 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 69 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 70 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 71 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 72 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 73 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 74 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 75 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 76 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 77 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 78 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 79 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 80 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 81 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 82 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 83 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 84 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 85 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 86 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 87 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 88 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 89 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 90 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 91 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 92 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 93 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 95 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 96 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 106 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 109 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 110 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 111 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 114 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 116 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 117 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 118 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 119 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 120 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 121 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 122 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 123 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 124 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 125 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 126 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 127 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 129 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 145 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 148 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 149 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 151 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 185 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 189 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 191 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 192 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 194 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 195 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 196 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 197 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 199 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 200 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 201 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 202 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 204 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 205 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 206 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 207 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 209 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 210 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 211 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 212 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 213 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 214 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 215 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 216 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 217 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 218 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 219 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 220 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 221 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 222 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 223 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 224 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 225 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 226 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 227 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 228 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 229 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 230 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 231 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 232 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 233 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 234 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 235 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 236 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 237 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 238 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 239 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 240 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 241 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 242 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 243 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 244 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 245 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 246 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 247 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 248 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 249 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 250 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 251 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 252 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 253 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 254 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 255 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 256 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 257 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 258 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 259 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 260 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 261 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 262 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 263 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 264 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 265 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 266 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 267 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 337 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 338 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 339 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 341 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 342 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 343 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 375 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 377 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 378 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 379 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 380 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 381 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 382 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 383 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 384 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 385 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 386 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 387 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 388 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 389 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 391 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 392 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 395 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 396 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 397 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 398 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 399 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 400 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 401 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 402 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 403 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 404 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 405 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 406 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 407 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 408 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 409 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 410 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 411 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 412 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 413 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 414 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 415 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 416 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.86 |
| Metatranscriptomes | 0.52 |
| Isolates | 13.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.28 |
| Nodule | 0.65 |
| Rhizoplane | 0.91 |
| Rhizosphere | 79.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10045223 | 3300003316 | Bacteria | 2736 |
| 2 | rootL2_10041909 | 3300003322 | Bacteria | 1575 |
| 3 | rootH1_10025603 | 3300003323 | Bacteria | 3007 |
| 4 | Ga0006562J51391_1012167 | 3300003578 | Bacteria | 2276 |
| 5 | Ga0006562J51391_1012168 | 3300003578 | Bacteria | 2366 |
| 6 | Ga0055524_1000125 | 3300003775 | Bacteria | 90042 |
| 7 | Ga0055524_1001949 | 3300003775 | Bacteria | 11103 |
| 8 | Ga0055530_10000470 | 3300003791 | Bacteria | 35231 |
| 9 | Ga0055530_10000982 | 3300003791 | Bacteria | 22949 |
| 10 | Ga0055540_1000011 | 3300003792 | Bacteria | 282927 |
| 11 | Ga0055531_10006358 | 3300003794 | Bacteria | 6722 |
| 12 | Ga0070658_10019015 | 3300005327 | Bacteria | 5503 |
| 13 | Ga0070658_10197740 | 3300005327 | Bacteria | 1695 |
| 14 | Ga0070683_100092324 | 3300005329 | Bacteria | 2843 |
| 15 | Ga0070683_100107341 | 3300005329 | Bacteria | 2632 |
| 16 | Ga0070683_100143575 | 3300005329 | Bacteria | 2261 |
| 17 | Ga0068869_100087313 | 3300005334 | Bacteria | 2339 |
| 18 | Ga0070666_10014615 | 3300005335 | Bacteria | 4999 |
| 19 | Ga0070666_10108909 | 3300005335 | Bacteria | 1914 |
| 20 | Ga0070666_10345016 | 3300005335 | Bacteria | 1065 |
| 21 | Ga0070660_100220279 | 3300005339 | Bacteria | 1542 |
| 22 | Ga0070691_10105788 | 3300005341 | Bacteria | 1402 |
| 23 | Ga0070661_100014282 | 3300005344 | Bacteria | 5595 |
| 24 | Ga0070661_100070230 | 3300005344 | Bacteria | 2575 |
| 25 | Ga0070668_100004875 | 3300005347 | Bacteria | 9944 |
| 26 | Ga0070659_100160886 | 3300005366 | Bacteria | 1836 |
| 27 | Ga0070714_100006279 | 3300005435 | Bacteria | 9160 |
| 28 | Ga0070663_100002126 | 3300005455 | Bacteria | 11093 |
| 29 | Ga0070662_100098265 | 3300005457 | Bacteria | 2211 |
| 30 | Ga0070681_10364717 | 3300005458 | Bacteria | 1355 |
| 31 | Ga0070698_100284442 | 3300005471 | Bacteria | 1585 |
| 32 | Ga0070699_100130736 | 3300005518 | Bacteria | 2213 |
| 33 | Ga0070699_100460891 | 3300005518 | Bacteria | 1153 |
| 34 | Ga0070679_100146277 | 3300005530 | Bacteria | 2341 |
| 35 | Ga0070679_100181044 | 3300005530 | Bacteria | 2080 |
| 36 | Ga0070684_100042466 | 3300005535 | Bacteria | 3925 |
| 37 | Ga0068853_100134802 | 3300005539 | Bacteria | 2213 |
| 38 | Ga0070696_100066186 | 3300005546 | Bacteria | 2534 |
| 39 | Ga0070665_100222134 | 3300005548 | Bacteria | 1889 |
| 40 | Ga0068855_100000529 | 3300005563 | Bacteria | 46748 |
| 41 | Ga0068855_100088273 | 3300005563 | Bacteria | 3582 |
| 42 | Ga0070664_100117185 | 3300005564 | Bacteria | 2329 |
| 43 | Ga0068857_100147745 | 3300005577 | Bacteria | 2127 |
| 44 | Ga0068854_100076320 | 3300005578 | Bacteria | 2463 |
| 45 | Ga0068852_100003179 | 3300005616 | Bacteria | 11467 |
| 46 | Ga0068852_100019746 | 3300005616 | Bacteria | 5342 |
| 47 | Ga0068852_100131459 | 3300005616 | Bacteria | 2306 |
| 48 | Ga0068859_100094899 | 3300005617 | Bacteria | 3035 |
| 49 | Ga0068864_100029974 | 3300005618 | Bacteria | 4611 |
| 50 | Ga0068864_100167090 | 3300005618 | Bacteria | 2004 |
| 51 | Ga0068861_100192734 | 3300005719 | Bacteria | 1705 |
| 52 | Ga0068863_100000329 | 3300005841 | Bacteria | 48080 |
| 53 | Ga0068858_100040358 | 3300005842 | Bacteria | 4328 |
| 54 | Ga0068860_100001239 | 3300005843 | Bacteria | 27857 |
| 55 | Ga0068860_100020336 | 3300005843 | Bacteria | 6429 |
| 56 | Ga0068860_100167261 | 3300005843 | Bacteria | 2123 |
| 57 | Ga0075367_10013040 | 3300006178 | Bacteria | 4454 |
| 58 | Ga0068871_100140116 | 3300006358 | Bacteria | 2056 |
| 59 | Ga0068865_100112234 | 3300006881 | Bacteria | 2013 |
| 60 | Ga0097620_100094904 | 3300006931 | Bacteria | 3035 |
| 61 | Ga0079104_1000465 | 3300006946 | Bacteria | 45434 |
| 62 | Ga0105250_10019755 | 3300009092 | Bacteria | 2724 |
| 63 | Ga0105240_10000055 | 3300009093 | Bacteria | 225380 |
| 64 | Ga0105240_10118849 | 3300009093 | Bacteria | 3185 |
| 65 | Ga0105245_10054003 | 3300009098 | Bacteria | 3608 |
| 66 | Ga0105241_10022485 | 3300009174 | Bacteria | 4671 |
| 67 | Ga0105241_10037299 | 3300009174 | Bacteria | 3661 |
| 68 | Ga0105241_10054043 | 3300009174 | Bacteria | 3073 |
| 69 | Ga0105242_10020314 | 3300009176 | Bacteria | 5208 |
| 70 | Ga0105248_10000001 | 3300009177 | Bacteria | 1881304 |
| 71 | Ga0105248_10481541 | 3300009177 | Bacteria | 1399 |
| 72 | Ga0105248_10628547 | 3300009177 | Bacteria | 1211 |
| 73 | Ga0105238_10006649 | 3300009551 | Bacteria | 11526 |
| 74 | Ga0105239_10001057 | 3300010375 | Bacteria | 38270 |
| 75 | Ga0105239_10005950 | 3300010375 | Bacteria | 14194 |
| 76 | Ga0105239_10009775 | 3300010375 | Bacteria | 10781 |
| 77 | Ga0105239_10390480 | 3300010375 | Bacteria | 1574 |
| 78 | Ga0157373_10318067 | 3300013100 | Bacteria | 1107 |
| 79 | Ga0157370_10186313 | 3300013104 | Bacteria | 1927 |
| 80 | Ga0157369_10003278 | 3300013105 | Bacteria | 19270 |
| 81 | Ga0157378_10051537 | 3300013297 | Bacteria | 3662 |
| 82 | Ga0157378_10198260 | 3300013297 | Bacteria | 1897 |
| 83 | Ga0157378_10401142 | 3300013297 | Bacteria | 1351 |
| 84 | Ga0163162_10220711 | 3300013306 | Bacteria | 2025 |
| 85 | Ga0163162_10352641 | 3300013306 | Bacteria | 1604 |
| 86 | Ga0157372_10002133 | 3300013307 | Bacteria | 21498 |
| 87 | Ga0157372_10097036 | 3300013307 | Bacteria | 3360 |
| 88 | Ga0163163_10000589 | 3300014325 | Bacteria | 32012 |
| 89 | Ga0163163_10000949 | 3300014325 | Bacteria | 24604 |
| 90 | Ga0163163_10080560 | 3300014325 | Bacteria | 3256 |
| 91 | Ga0182008_10021356 | 3300014497 | Bacteria | 3324 |
| 92 | Ga0157379_10004509 | 3300014968 | Bacteria | 11944 |
| 93 | Ga0157376_10202977 | 3300014969 | Bacteria | 1825 |
| 94 | Ga0182007_10000885 | 3300015262 | Bacteria | 16618 |
| 95 | Ga0183367_1006 | 3300015688 | Bacteria | 648044 |
| 96 | Ga0206353_10549273 | 3300020082 | Bacteria | 3749 |
| 97 | Ga0206353_11306600 | 3300020082 | Bacteria | 3289 |
| 98 | Ga0213875_10003010 | 3300021388 | Bacteria | 9792 |
| 99 | Ga0209565_1010883 | 3300025263 | Bacteria | 2241 |
| 100 | Ga0209758_1006832 | 3300025297 | Bacteria | 7992 |
| 101 | Ga0209050_1000532 | 3300025298 | Bacteria | 63063 |
| 102 | Ga0209050_1002916 | 3300025298 | Bacteria | 13427 |
| 103 | Ga0209256_1000113 | 3300025299 | Bacteria | 175296 |
| 104 | Ga0207426_1000981 | 3300025302 | Bacteria | 28122 |
| 105 | Ga0207426_1003579 | 3300025302 | Bacteria | 8265 |
| 106 | Ga0209051_1000020 | 3300025303 | Bacteria | 508628 |
| 107 | Ga0209257_1000085 | 3300025304 | Bacteria | 291117 |
| 108 | Ga0207680_10000055 | 3300025903 | Bacteria | 54114 |
| 109 | Ga0207680_10075123 | 3300025903 | Bacteria | 2107 |
| 110 | Ga0207680_10135284 | 3300025903 | Bacteria | 1628 |
| 111 | Ga0207647_10001611 | 3300025904 | Bacteria | 17347 |
| 112 | Ga0207705_10147245 | 3300025909 | Bacteria | 1762 |
| 113 | Ga0207695_10000012 | 3300025913 | Bacteria | 840961 |
| 114 | Ga0207695_10000295 | 3300025913 | Bacteria | 123533 |
| 115 | Ga0207671_10007226 | 3300025914 | Bacteria | 9671 |
| 116 | Ga0207671_10152670 | 3300025914 | Bacteria | 1785 |
| 117 | Ga0207660_10296679 | 3300025917 | Bacteria | 1286 |
| 118 | Ga0207649_10001154 | 3300025920 | Bacteria | 15927 |
| 119 | Ga0207649_10030222 | 3300025920 | Bacteria | 3206 |
| 120 | Ga0207649_10151701 | 3300025920 | Bacteria | 1597 |
| 121 | Ga0207652_10095039 | 3300025921 | Bacteria | 2625 |
| 122 | Ga0207694_10000006 | 3300025924 | Bacteria | 631109 |
| 123 | Ga0207694_10116323 | 3300025924 | Bacteria | 2131 |
| 124 | Ga0207687_10031945 | 3300025927 | Unclassified | 3562 |
| 125 | Ga0207664_10005792 | 3300025929 | Bacteria | 8449 |
| 126 | Ga0207706_10033851 | 3300025933 | Bacteria | 4548 |
| 127 | Ga0207686_10038384 | 3300025934 | Bacteria | 2898 |
| 128 | Ga0207711_10000001 | 3300025941 | Bacteria | 1325674 |
| 129 | Ga0207689_10077006 | 3300025942 | Bacteria | 2742 |
| 130 | Ga0207667_10000026 | 3300025949 | Bacteria | 343713 |
| 131 | Ga0207667_10005003 | 3300025949 | Bacteria | 16195 |
| 132 | Ga0207667_10314455 | 3300025949 | Bacteria | 1600 |
| 133 | Ga0207668_10001856 | 3300025972 | Bacteria | 12337 |
| 134 | Ga0207677_10182372 | 3300026023 | Bacteria | 1652 |
| 135 | Ga0207703_10158300 | 3300026035 | Bacteria | 1981 |
| 136 | Ga0207639_10037822 | 3300026041 | Bacteria | 3587 |
| 137 | Ga0207639_10057543 | 3300026041 | Bacteria | 2985 |
| 138 | Ga0207678_10000442 | 3300026067 | Bacteria | 37718 |
| 139 | Ga0207641_10028963 | 3300026088 | Bacteria | 4578 |
| 140 | Ga0207676_10119532 | 3300026095 | Bacteria | 2219 |
| 141 | Ga0207674_10001063 | 3300026116 | Bacteria | 35707 |
| 142 | Ga0207683_10100074 | 3300026121 | Bacteria | 2588 |
| 143 | Ga0207698_10006997 | 3300026142 | Bacteria | 7061 |
| 144 | Ga0207698_10007799 | 3300026142 | Bacteria | 6727 |
| 145 | Ga0209281_1000195 | 3300027111 | Bacteria | 139144 |
| 146 | Ga0209974_10011278 | 3300027876 | Bacteria | 3006 |
| 147 | Ga0268266_10152934 | 3300028379 | Unclassified | 2081 |
| 148 | Ga0268264_10005559 | 3300028381 | Bacteria | 10676 |
| 149 | Ga0265337_1001356 | 3300028556 | Bacteria | 12072 |
| 150 | Ga0265334_10002334 | 3300028573 | Bacteria | 8932 |
| 151 | Ga0265318_10000149 | 3300028577 | Bacteria | 63245 |
| 152 | Ga0265318_10001785 | 3300028577 | Bacteria | 12233 |
| 153 | Ga0307515_10000123 | 3300028794 | Bacteria | 186601 |
| 154 | Ga0307515_10000541 | 3300028794 | Bacteria | 88944 |
| 155 | Ga0307515_10018885 | 3300028794 | Bacteria | 12446 |
| 156 | Ga0307515_10174876 | 3300028794 | Bacteria | 2122 |
| 157 | Ga0265338_10029699 | 3300028800 | Bacteria | 5412 |
| 158 | Ga0307511_10000477 | 3300030521 | Bacteria | 43424 |
| 159 | Ga0307511_10155622 | 3300030521 | Bacteria | 1298 |
| 160 | Ga0307512_10004449 | 3300030522 | Bacteria | 15346 |
| 161 | Ga0307512_10027900 | 3300030522 | Bacteria | 4959 |
| 162 | Ga0307512_10030676 | 3300030522 | Bacteria | 4672 |
| 163 | Ga0307512_10108440 | 3300030522 | Bacteria | 1842 |
| 164 | Ga0307512_10231252 | 3300030522 | Bacteria | 950 |
| 165 | Ga0265330_10040068 | 3300031235 | Bacteria | 2081 |
| 166 | Ga0265325_10148880 | 3300031241 | Bacteria | 1108 |
| 167 | Ga0265331_10039331 | 3300031250 | Bacteria | 2307 |
| 168 | Ga0265331_10040757 | 3300031250 | Bacteria | 2258 |
| 169 | Ga0265316_10027475 | 3300031344 | Bacteria | 4711 |
| 170 | Ga0307513_10014726 | 3300031456 | Bacteria | 9512 |
| 171 | Ga0307513_10017114 | 3300031456 | Bacteria | 8708 |
| 172 | Ga0307513_10057319 | 3300031456 | Bacteria | 4151 |
| 173 | Ga0307513_10071416 | 3300031456 | Bacteria | 3623 |
| 174 | Ga0307513_10074353 | 3300031456 | Bacteria | 3534 |
| 175 | Ga0307513_10177778 | 3300031456 | Bacteria | 1996 |
| 176 | Ga0307513_10344365 | 3300031456 | Bacteria | 1240 |
| 177 | Ga0307509_10009963 | 3300031507 | Bacteria | 11741 |
| 178 | Ga0307509_10096821 | 3300031507 | Bacteria | 3001 |
| 179 | Ga0307408_100141032 | 3300031548 | Bacteria | 1892 |
| 180 | Ga0265313_10000757 | 3300031595 | Bacteria | 32971 |
| 181 | Ga0307508_10002336 | 3300031616 | Bacteria | 20114 |
| 182 | Ga0307508_10004731 | 3300031616 | Bacteria | 13174 |
| 183 | Ga0307508_10140605 | 3300031616 | Bacteria | 2017 |
| 184 | Ga0307508_10365789 | 3300031616 | Bacteria | 1033 |
| 185 | Ga0307514_10010004 | 3300031649 | Bacteria | 7942 |
| 186 | Ga0307514_10015139 | 3300031649 | Bacteria | 6373 |
| 187 | Ga0307514_10015662 | 3300031649 | Bacteria | 6249 |
| 188 | Ga0307514_10024583 | 3300031649 | Bacteria | 4874 |
| 189 | Ga0307514_10234409 | 3300031649 | Bacteria | 1108 |
| 190 | Ga0316575_10005400 | 3300031665 | Bacteria | 4558 |
| 191 | Ga0316575_10007710 | 3300031665 | Bacteria | 3905 |
| 192 | Ga0316575_10039379 | 3300031665 | Bacteria | 1865 |
| 193 | Ga0316579_10003704 | 3300031691 | Bacteria | 6011 |
| 194 | Ga0316579_10088414 | 3300031691 | Bacteria | 1478 |
| 195 | Ga0265314_10052245 | 3300031711 | Bacteria | 2842 |
| 196 | Ga0316576_10000837 | 3300031727 | Bacteria | 15551 |
| 197 | Ga0316576_10001885 | 3300031727 | Bacteria | 11657 |
| 198 | Ga0316576_10003035 | 3300031727 | Bacteria | 9763 |
| 199 | Ga0316576_10004532 | 3300031727 | Bacteria | 8351 |
| 200 | Ga0316576_10194612 | 3300031727 | Bacteria | 1528 |
| 201 | Ga0316578_10000481 | 3300031728 | Bacteria | 13412 |
| 202 | Ga0316578_10010371 | 3300031728 | Bacteria | 4835 |
| 203 | Ga0316578_10010470 | 3300031728 | Bacteria | 4814 |
| 204 | Ga0316578_10022534 | 3300031728 | Bacteria | 3513 |
| 205 | Ga0316578_10128277 | 3300031728 | Bacteria | 1525 |
| 206 | Ga0316578_10137122 | 3300031728 | Bacteria | 1473 |
| 207 | Ga0307516_10016228 | 3300031730 | Bacteria | 7796 |
| 208 | Ga0307516_10020560 | 3300031730 | Bacteria | 6817 |
| 209 | Ga0307516_10024509 | 3300031730 | Bacteria | 6161 |
| 210 | Ga0307516_10034989 | 3300031730 | Bacteria | 5043 |
| 211 | Ga0316577_10003164 | 3300031733 | Bacteria | 8277 |
| 212 | Ga0316577_10132188 | 3300031733 | Bacteria | 1404 |
| 213 | Ga0307518_10000376 | 3300031838 | Bacteria | 34192 |
| 214 | Ga0307412_10154109 | 3300031911 | Unclassified | 1699 |
| 215 | Ga0316583_10009058 | 3300032133 | Bacteria | 3589 |
| 216 | Ga0316583_10014027 | 3300032133 | Bacteria | 2890 |
| 217 | Ga0316583_10040669 | 3300032133 | Bacteria | 1646 |
| 218 | Ga0316585_10000539 | 3300032137 | Bacteria | 9148 |
| 219 | Ga0316585_10017204 | 3300032137 | Bacteria | 2184 |
| 220 | Ga0316585_10095014 | 3300032137 | Bacteria | 976 |
| 221 | Ga0316580_10005182 | 3300032139 | Bacteria | 3795 |
| 222 | Ga0316580_10008164 | 3300032139 | Bacteria | 3133 |
| 223 | Ga0307507_10007895 | 3300033179 | Bacteria | 15065 |
| 224 | Ga0307507_10018099 | 3300033179 | Bacteria | 8039 |
| 225 | Ga0307507_10035329 | 3300033179 | Bacteria | 5136 |
| 226 | Ga0307507_10099678 | 3300033179 | Bacteria | 2438 |
| 227 | Ga0307507_10179740 | 3300033179 | Bacteria | 1515 |
| 228 | Ga0307510_10020300 | 3300033180 | Bacteria | 7768 |
| 229 | Ga0307510_10034631 | 3300033180 | Bacteria | 5651 |
| 230 | Ga0307510_10142764 | 3300033180 | Bacteria | 2033 |
| 231 | Ga0316574_0008845 | 3300035398 | Bacteria | 5614 |
| 232 | Ga0316574_0011686 | 3300035398 | Bacteria | 4999 |
| 233 | Ga0316574_0045314 | 3300035398 | Bacteria | 2723 |
| 234 | Ga0316574_0051175 | 3300035398 | Bacteria | 2574 |
| 235 | Ga0316574_0109984 | 3300035398 | Bacteria | 1766 |
| 236 | Ga0316582_0002166 | 3300036647 | Bacteria | 9103 |
| 237 | Ga0316582_0013088 | 3300036647 | Bacteria | 4657 |
| 238 | Ga0316582_0096226 | 3300036647 | Bacteria | 1955 |
| 239 | Ga0316584_0001840 | 3300036712 | Bacteria | 13122 |
| 240 | Ga0316584_0005975 | 3300036712 | Bacteria | 8221 |
| 241 | Ga0316584_0056723 | 3300036712 | Bacteria | 2932 |
| 242 | Ga0316584_0071703 | 3300036712 | Bacteria | 2595 |
| 243 | Ga0316584_0123743 | 3300036712 | Bacteria | 1932 |
| 244 | Ga0316584_0407841 | 3300036712 | Bacteria | 967 |
| 245 | Ga0395898_0004973 | 3300037466 | Bacteria | 14423 |
| 246 | Ga0395898_0035553 | 3300037466 | Bacteria | 4951 |
| 247 | Ga0316581_0017017 | 3300037588 | Bacteria | 2095 |
| 248 | Ga0436364_0896138 | 3300037853 | Bacteria | 37377 |
| 249 | Ga0395901_0578250 | 3300038443 | Bacteria | 1135 |
| 250 | Ga0400484_27811 | 3300038725 | Bacteria | 7745 |
| 251 | Ga0400490_31308 | 3300038726 | Bacteria | 8615 |
| 252 | Ga0400490_51610 | 3300038726 | Bacteria | 2474 |
| 253 | Ga0400491_26268 | 3300038727 | Bacteria | 3208 |
| 254 | Ga0400485_00947 | 3300038735 | Bacteria | 1158 |
| 255 | Ga0400485_06984 | 3300038735 | Bacteria | 14026 |
| 256 | Ga0400485_07748 | 3300038735 | Bacteria | 63267 |
| 257 | Ga0400486_00966 | 3300038742 | Bacteria | 11287 |
| 258 | Ga0400486_01623 | 3300038742 | Bacteria | 34748 |
| 259 | Ga0400483_077455 | 3300039062 | Bacteria | 1921 |
| 260 | Ga0400489_08878 | 3300039093 | Bacteria | 10167 |
| 261 | Ga0400487_04533 | 3300039110 | Bacteria | 51421 |
| 262 | Ga0400487_35172 | 3300039110 | Bacteria | 5181 |
| 263 | Ga0436365_0198870 | 3300039437 | Bacteria | 9397 |
| 264 | Ga0436365_0704399 | 3300039437 | Bacteria | 1668 |
| 265 | Ga0439436_0003702 | 3300041404 | Bacteria | 4660 |
| 266 | Ga0439436_0004032 | 3300041404 | Bacteria | 4500 |
| 267 | Ga0439439_0003783 | 3300041406 | Bacteria | 3363 |
| 268 | Ga0439439_0004751 | 3300041406 | Bacteria | 3075 |
| 269 | Ga0451843_0686416 | 3300041509 | Bacteria | 1232 |
| 270 | Ga0451853_0034159 | 3300041512 | Bacteria | 2320 |
| 271 | Ga0451853_1117734 | 3300041512 | Bacteria | 4880 |
| 272 | Ga0451853_1420060 | 3300041512 | Bacteria | 1845 |
| 273 | Ga0439433_0009056 | 3300041999 | Bacteria | 2166 |
| 274 | Ga0439448_0026804 | 3300042005 | Bacteria | 1813 |
| 275 | Ga0439449_0079815 | 3300042007 | Bacteria | 1206 |
| 276 | Ga0439455_0013856 | 3300042012 | Bacteria | 1833 |
| 277 | Ga0439457_001353 | 3300042014 | Bacteria | 7368 |
| 278 | Ga0439457_003193 | 3300042014 | Bacteria | 4513 |
| 279 | Ga0439462_0005937 | 3300042015 | Bacteria | 3023 |
| 280 | Ga0450919_001212 | 3300042121 | Bacteria | 3365 |
| 281 | Ga0450923_028966 | 3300042125 | Bacteria | 1120 |
| 282 | Ga0450894_000487 | 3300042131 | Bacteria | 6771 |
| 283 | Ga0450899_000635 | 3300042135 | Bacteria | 3973 |
| 284 | Ga0450903_000044 | 3300042138 | Bacteria | 24233 |
| 285 | Ga0439434_0066787 | 3300042435 | Bacteria | 1129 |
| 286 | Ga0439435_0069861 | 3300042436 | Bacteria | 1038 |
| 287 | Ga0450918_000071 | 3300042531 | Bacteria | 20844 |
| 288 | Ga0466969_0012487 | 3300044656 | Bacteria | 4478 |
| 289 | Ga0466972_0009323 | 3300044658 | Bacteria | 4934 |
| 290 | Ga0466972_0009968 | 3300044658 | Bacteria | 4770 |
| 291 | Ga0466972_0029298 | 3300044658 | Bacteria | 2710 |
| 292 | Ga0466965_0028690 | 3300044683 | Bacteria | 2704 |
| 293 | Ga0466966_0026339 | 3300044684 | Bacteria | 3796 |
| 294 | Ga0466961_0005851 | 3300044693 | Bacteria | 7791 |
| 295 | Ga0466961_0009568 | 3300044693 | Bacteria | 6169 |
| 296 | Ga0466961_0050467 | 3300044693 | Bacteria | 2657 |
| 297 | Ga0466961_0065796 | 3300044693 | Bacteria | 2303 |
| 298 | Ga0466961_0106706 | 3300044693 | Bacteria | 1763 |
| 299 | Ga0466963_0010858 | 3300044694 | Bacteria | 5530 |
| 300 | Ga0466963_0016533 | 3300044694 | Bacteria | 4589 |
| 301 | Ga0466964_0004728 | 3300044706 | Bacteria | 5032 |
| 302 | Ga0466971_0004505 | 3300044719 | Bacteria | 6022 |
| 303 | Ga0466970_0007537 | 3300044765 | Bacteria | 5458 |
| 304 | Ga0466970_0026797 | 3300044765 | Bacteria | 3021 |
| 305 | Ga0466970_0045023 | 3300044765 | Bacteria | 2349 |
| 306 | Ga0466957_0004601 | 3300044842 | Bacteria | 7709 |
| 307 | Ga0466957_0240331 | 3300044842 | Bacteria | 1201 |
| 308 | Ga0466960_0003551 | 3300044901 | Bacteria | 6007 |
| 309 | Ga0466959_0016300 | 3300045049 | Bacteria | 5426 |
| 310 | Ga0466959_0178054 | 3300045049 | Bacteria | 1489 |
| 311 | Ga0466959_0271661 | 3300045049 | Bacteria | 1165 |
| 312 | Ga0466958_0000949 | 3300045836 | Bacteria | 13098 |
| 313 | Ga0466967_0098312 | 3300045976 | Bacteria | 2672 |
| 314 | Ga0466967_0329022 | 3300045976 | Bacteria | 1475 |
| 315 | Ga0495617_011356 | 3300046452 | Bacteria | 3038 |
| 316 | Ga0495592_0008020 | 3300046454 | Bacteria | 7928 |
| 317 | Ga0495592_0034890 | 3300046454 | Bacteria | 3790 |
| 318 | Ga0495603_0008979 | 3300046455 | Bacteria | 6043 |
| 319 | Ga0495603_0027757 | 3300046455 | Bacteria | 3414 |
| 320 | Ga0495603_0040823 | 3300046455 | Bacteria | 2776 |
| 321 | Ga0495629_0005181 | 3300046459 | Bacteria | 9754 |
| 322 | Ga0495629_0008226 | 3300046459 | Bacteria | 7669 |
| 323 | Ga0495629_0009617 | 3300046459 | Bacteria | 7061 |
| 324 | Ga0495629_0042604 | 3300046459 | Bacteria | 3189 |
| 325 | Ga0495629_0080985 | 3300046459 | Bacteria | 2266 |
| 326 | Ga0495629_0088166 | 3300046459 | Bacteria | 2164 |
| 327 | Ga0495629_0093414 | 3300046459 | Bacteria | 2099 |
| 328 | Ga0495638_0056895 | 3300046460 | Bacteria | 2426 |
| 329 | Ga0495651_0016521 | 3300046462 | Bacteria | 5717 |
| 330 | Ga0495651_0051428 | 3300046462 | Bacteria | 3176 |
| 331 | Ga0495651_0055301 | 3300046462 | Bacteria | 3050 |
| 332 | Ga0495651_0393266 | 3300046462 | Bacteria | 907 |
| 333 | Ga0495653_0069989 | 3300046463 | Bacteria | 2627 |
| 334 | Ga0495580_0226943 | 3300046472 | Bacteria | 1282 |
| 335 | Ga0495582_0060789 | 3300046473 | Bacteria | 2085 |
| 336 | Ga0495605_0010454 | 3300046474 | Bacteria | 5190 |
| 337 | Ga0495605_0080485 | 3300046474 | Bacteria | 1525 |
| 338 | Ga0495662_0033617 | 3300046476 | Bacteria | 2477 |
| 339 | Ga0495585_0003711 | 3300046492 | Bacteria | 10210 |
| 340 | Ga0495585_0101034 | 3300046492 | Bacteria | 1542 |
| 341 | Ga0495594_0020165 | 3300046499 | Bacteria | 3550 |
| 342 | Ga0495594_0083629 | 3300046499 | Bacteria | 1784 |
| 343 | Ga0495596_0042641 | 3300046500 | Bacteria | 1788 |
| 344 | Ga0495607_0034738 | 3300046501 | Bacteria | 3056 |
| 345 | Ga0495607_0157468 | 3300046501 | Bacteria | 1157 |
| 346 | Ga0495606_0065930 | 3300046507 | Bacteria | 2298 |
| 347 | Ga0495610_0065508 | 3300046512 | Bacteria | 1714 |
| 348 | Ga0495616_0049594 | 3300046513 | Bacteria | 2103 |
| 349 | Ga0495618_0079366 | 3300046514 | Bacteria | 2093 |
| 350 | Ga0495618_0236669 | 3300046514 | Bacteria | 1149 |
| 351 | Ga0495618_0247349 | 3300046514 | Bacteria | 1119 |
| 352 | Ga0495620_0023355 | 3300046515 | Bacteria | 2958 |
| 353 | Ga0495620_0080750 | 3300046515 | Bacteria | 1316 |
| 354 | Ga0495620_0097889 | 3300046515 | Bacteria | 1171 |
| 355 | Ga0495628_0087105 | 3300046516 | Bacteria | 2421 |
| 356 | Ga0495628_0129113 | 3300046516 | Bacteria | 1935 |
| 357 | Ga0495628_0280343 | 3300046516 | Bacteria | 1238 |
| 358 | Ga0495631_0004707 | 3300046518 | Bacteria | 7210 |
| 359 | Ga0495631_0076484 | 3300046518 | Bacteria | 1445 |
| 360 | Ga0495643_0006842 | 3300046522 | Bacteria | 7437 |
| 361 | Ga0495643_0033285 | 3300046522 | Bacteria | 2853 |
| 362 | Ga0495644_0050512 | 3300046523 | Bacteria | 1561 |
| 363 | Ga0495666_0057086 | 3300046526 | Bacteria | 1869 |
| 364 | Ga0495642_0128126 | 3300046528 | Bacteria | 1092 |
| 365 | Ga0495652_0005221 | 3300046529 | Bacteria | 12276 |
| 366 | Ga0495652_0042608 | 3300046529 | Bacteria | 3913 |
| 367 | Ga0495652_0062020 | 3300046529 | Bacteria | 3154 |
| 368 | Ga0495652_0231649 | 3300046529 | Bacteria | 1381 |
| 369 | Ga0495654_0044614 | 3300046530 | Bacteria | 2192 |
| 370 | Ga0495640_0001063 | 3300046533 | Bacteria | 21350 |
| 371 | Ga0495640_0003870 | 3300046533 | Bacteria | 11976 |
| 372 | Ga0495640_0030392 | 3300046533 | Bacteria | 3868 |
| 373 | Ga0495586_0090813 | 3300046535 | Bacteria | 1687 |
| 374 | Ga0495587_0006177 | 3300046536 | Bacteria | 7820 |
| 375 | Ga0495609_0021000 | 3300046538 | Bacteria | 3013 |
| 376 | Ga0495597_0026120 | 3300046542 | Bacteria | 2683 |
| 377 | Ga0495622_0010612 | 3300046557 | Bacteria | 4249 |
| 378 | Ga0495633_0020737 | 3300046558 | Bacteria | 3300 |
| 379 | Ga0495667_0072253 | 3300046559 | Bacteria | 2249 |
| 380 | Ga0495667_0138279 | 3300046559 | Bacteria | 1570 |
| 381 | Ga0495668_0032366 | 3300046616 | Bacteria | 2942 |
| 382 | Ga0495634_0036275 | 3300046642 | Bacteria | 3372 |
| 383 | Ga0495625_0000990 | 3300046660 | Bacteria | 37644 |
| 384 | Ga0495625_0010878 | 3300046660 | Bacteria | 7477 |
| 385 | Ga0495635_0024955 | 3300046663 | Bacteria | 4165 |
| 386 | Ga0495635_0046803 | 3300046663 | Bacteria | 2984 |
| 387 | Ga0495635_0102549 | 3300046663 | Bacteria | 1955 |
| 388 | Ga0495661_0032971 | 3300046665 | Bacteria | 3269 |
| 389 | Ga0495588_0008854 | 3300046674 | Bacteria | 4629 |
| 390 | Ga0495588_0040166 | 3300046674 | Bacteria | 2385 |
| 391 | Ga0495588_0076053 | 3300046674 | Bacteria | 1749 |
| 392 | Ga0495588_0170600 | 3300046674 | Bacteria | 1150 |
| 393 | Ga0495588_0227710 | 3300046674 | Bacteria | 984 |
| 394 | Ga0495657_0002793 | 3300046675 | Bacteria | 14515 |
| 395 | Ga0495657_0028974 | 3300046675 | Bacteria | 3886 |
| 396 | Ga0495657_0035922 | 3300046675 | Bacteria | 3430 |
| 397 | Ga0495623_0097418 | 3300046679 | Bacteria | 1796 |
| 398 | Ga0495646_0001039 | 3300046680 | Bacteria | 16059 |
| 399 | Ga0495613_0001088 | 3300046689 | Bacteria | 20750 |
| 400 | Ga0495613_0012265 | 3300046689 | Bacteria | 6368 |
| 401 | Ga0495613_0020348 | 3300046689 | Bacteria | 4947 |
| 402 | Ga0495613_0042223 | 3300046689 | Bacteria | 3375 |
| 403 | Ga0495613_0054375 | 3300046689 | Bacteria | 2943 |
| 404 | Ga0495613_0136081 | 3300046689 | Bacteria | 1757 |
| 405 | Ga0495613_0161908 | 3300046689 | Bacteria | 1591 |
| 406 | Ga0495624_0030537 | 3300046690 | Bacteria | 3509 |
| 407 | Ga0495624_0154461 | 3300046690 | Bacteria | 1403 |
| 408 | Ga0495670_0004047 | 3300046691 | Bacteria | 7186 |
| 409 | Ga0495670_0030384 | 3300046691 | Bacteria | 2684 |
| 410 | Ga0495670_0142498 | 3300046691 | Bacteria | 1254 |
| 411 | Ga0495671_0081712 | 3300046692 | Bacteria | 1583 |
| 412 | Ga0495671_0138531 | 3300046692 | Bacteria | 1186 |
| 413 | Ga0495589_0015789 | 3300046794 | Bacteria | 3881 |
| 414 | Ga0495589_0029656 | 3300046794 | Bacteria | 2758 |
| 415 | Ga0495589_0041542 | 3300046794 | Bacteria | 2294 |
| 416 | Ga0495589_0055002 | 3300046794 | Bacteria | 1961 |
| 417 | Ga0495589_0061613 | 3300046794 | Bacteria | 1841 |
| 418 | Ga0495589_0075812 | 3300046794 | Bacteria | 1640 |
| 419 | Ga0495600_0001432 | 3300046809 | Bacteria | 13189 |
| 420 | Ga0495600_0006928 | 3300046809 | Bacteria | 6914 |
| 421 | Ga0495600_0194664 | 3300046809 | Bacteria | 1303 |
| 422 | Ga0495581_0028479 | 3300047315 | Bacteria | 3238 |
| 423 | Ga0495604_0003476 | 3300047317 | Bacteria | 12558 |
| 424 | Ga0495636_0001203 | 3300047318 | Bacteria | 9793 |
| 425 | Ga0495636_0006555 | 3300047318 | Bacteria | 4575 |
| 426 | Ga0495674_0102132 | 3300047319 | Bacteria | 2439 |
| 427 | Ga0495676_0013737 | 3300047321 | Bacteria | 7265 |
| 428 | Ga0495676_0016662 | 3300047321 | Bacteria | 6511 |
| 429 | Ga0495676_0034152 | 3300047321 | Bacteria | 4270 |
| 430 | Ga0495676_0232604 | 3300047321 | Bacteria | 1265 |
| 431 | Ga0495680_0017759 | 3300047322 | Bacteria | 6057 |
| 432 | Ga0495687_002438 | 3300047443 | Bacteria | 14954 |
| 433 | Ga0495687_006538 | 3300047443 | Bacteria | 7118 |
| 434 | Ga0495687_111154 | 3300047443 | Bacteria | 1007 |
| 435 | Ga0495675_0035650 | 3300047444 | Bacteria | 3177 |
| 436 | Ga0495677_0017529 | 3300047445 | Bacteria | 2596 |
| 437 | Ga0495679_026603 | 3300047446 | Bacteria | 1919 |
| 438 | Ga0495685_007903 | 3300047447 | Bacteria | 3522 |
| 439 | Ga0495685_009879 | 3300047447 | Bacteria | 3194 |
| 440 | Ga0495685_022960 | 3300047447 | Bacteria | 2146 |
| 441 | Ga0495685_038735 | 3300047447 | Bacteria | 1632 |
| 442 | Ga0495681_0001091 | 3300047470 | Bacteria | 20606 |
| 443 | Ga0495681_0003731 | 3300047470 | Bacteria | 10553 |
| 444 | Ga0495681_0045704 | 3300047470 | Bacteria | 2093 |
| 445 | Ga0495684_0150810 | 3300047471 | Bacteria | 1738 |
| 446 | Ga0495686_0029248 | 3300047472 | Bacteria | 3585 |
| 447 | Ga0495686_0063265 | 3300047472 | Bacteria | 2293 |
| 448 | Ga0495593_0004425 | 3300047673 | Bacteria | 8353 |
| 449 | Ga0495593_0046554 | 3300047673 | Bacteria | 2310 |
| 450 | Ga0495602_0036614 | 3300048088 | Bacteria | 4565 |
| 451 | Ga0495614_0002730 | 3300048089 | Bacteria | 7851 |
| 452 | Ga0495614_0006580 | 3300048089 | Bacteria | 5204 |
| 453 | Ga0495614_0121132 | 3300048089 | Bacteria | 1153 |
| 454 | Ga0495626_0029348 | 3300048091 | Bacteria | 2662 |
| 455 | Ga0496102_0000331 | 3300048905 | Bacteria | 58351 |
| 456 | Ga0496102_0010679 | 3300048905 | Bacteria | 7911 |
| 457 | Ga0496103_0021436 | 3300048906 | Bacteria | 3887 |
| 458 | Ga0496105_0394712 | 3300048908 | Bacteria | 1099 |
| 459 | Ga0496109_0122879 | 3300048912 | Bacteria | 2419 |
| 460 | Ga0496114_0003561 | 3300048917 | Bacteria | 11962 |
| 461 | Ga0496122_0197236 | 3300048925 | Bacteria | 1181 |
| 462 | Ga0496126_0001104 | 3300048929 | Bacteria | 45291 |
| 463 | Ga0495682_0068266 | 3300049460 | Bacteria | 1280 |
| 464 | Ga0495682_0076005 | 3300049460 | Bacteria | 1208 |
| 465 | Ga0501031_0001472 | 3300049568 | Bacteria | 14623 |
| 466 | Ga0501031_0004159 | 3300049568 | Bacteria | 9345 |
| 467 | Ga0501031_0012912 | 3300049568 | Bacteria | 5455 |
| 468 | Ga0501031_0024171 | 3300049568 | Bacteria | 3961 |
| 469 | Ga0501031_0033244 | 3300049568 | Bacteria | 3363 |
| 470 | Ga0501032_0002016 | 3300049569 | Bacteria | 16008 |
| 471 | Ga0501032_0005106 | 3300049569 | Bacteria | 9795 |
| 472 | Ga0501032_0006464 | 3300049569 | Bacteria | 8618 |
| 473 | Ga0501032_0010731 | 3300049569 | Bacteria | 6594 |
| 474 | Ga0501032_0052072 | 3300049569 | Bacteria | 2759 |
| 475 | Ga0501032_0084048 | 3300049569 | Bacteria | 2116 |
| 476 | Ga0501033_0001270 | 3300049570 | Bacteria | 22536 |
| 477 | Ga0501033_0008095 | 3300049570 | Bacteria | 8145 |
| 478 | Ga0501033_0012763 | 3300049570 | Bacteria | 6406 |
| 479 | Ga0501033_0019893 | 3300049570 | Bacteria | 5074 |
| 480 | Ga0501033_0036156 | 3300049570 | Bacteria | 3702 |
| 481 | Ga0501033_0040252 | 3300049570 | Bacteria | 3489 |
| 482 | Ga0501033_0065827 | 3300049570 | Bacteria | 2665 |
| 483 | Ga0501033_0088316 | 3300049570 | Bacteria | 2268 |
| 484 | Ga0501033_0172205 | 3300049570 | Bacteria | 1554 |
| 485 | Ga0501033_0178378 | 3300049570 | Bacteria | 1523 |
| 486 | Ga0501033_0193746 | 3300049570 | Bacteria | 1453 |
| 487 | Ga0501033_0199044 | 3300049570 | Bacteria | 1431 |
| 488 | Ga0501033_0221425 | 3300049570 | Bacteria | 1347 |
| 489 | Ga0501033_0242006 | 3300049570 | Bacteria | 1280 |
| 490 | Ga0501033_0268821 | 3300049570 | Bacteria | 1205 |
| 491 | Ga0501033_0313197 | 3300049570 | Bacteria | 1103 |
| 492 | Ga0501034_0001007 | 3300049571 | Bacteria | 40401 |
| 493 | Ga0501034_0001944 | 3300049571 | Bacteria | 26175 |
| 494 | Ga0501034_0020633 | 3300049571 | Bacteria | 6730 |
| 495 | Ga0501034_0034478 | 3300049571 | Bacteria | 5131 |
| 496 | Ga0501034_0034779 | 3300049571 | Bacteria | 5109 |
| 497 | Ga0501034_0075832 | 3300049571 | Bacteria | 3370 |
| 498 | Ga0501034_0082912 | 3300049571 | Bacteria | 3208 |
| 499 | Ga0501034_0187203 | 3300049571 | Bacteria | 2033 |
| 500 | Ga0501034_0198629 | 3300049571 | Bacteria | 1964 |
| 501 | Ga0501034_0326153 | 3300049571 | Bacteria | 1467 |
| 502 | Ga0501034_0448555 | 3300049571 | Bacteria | 1208 |
| 503 | Ga0501034_0660194 | 3300049571 | Bacteria | 947 |
| 504 | Ga0501036_0002177 | 3300049572 | Bacteria | 15289 |
| 505 | Ga0501036_0005092 | 3300049572 | Bacteria | 10634 |
| 506 | Ga0501036_0007043 | 3300049572 | Bacteria | 9148 |
| 507 | Ga0501036_0007472 | 3300049572 | Bacteria | 8909 |
| 508 | Ga0501036_0090603 | 3300049572 | Bacteria | 2583 |
| 509 | Ga0501036_0174624 | 3300049572 | Bacteria | 1809 |
| 510 | Ga0501036_0177680 | 3300049572 | Bacteria | 1792 |
| 511 | Ga0501036_0405997 | 3300049572 | Bacteria | 1136 |
| 512 | Ga0501037_0002239 | 3300049573 | Bacteria | 13978 |
| 513 | Ga0501037_0018704 | 3300049573 | Bacteria | 5106 |
| 514 | Ga0501037_0028698 | 3300049573 | Bacteria | 4110 |
| 515 | Ga0501037_0042415 | 3300049573 | Bacteria | 3343 |
| 516 | Ga0501037_0076763 | 3300049573 | Bacteria | 2425 |
| 517 | Ga0501037_0269874 | 3300049573 | Bacteria | 1187 |
| 518 | Ga0501038_0008550 | 3300049574 | Bacteria | 9398 |
| 519 | Ga0501038_0010421 | 3300049574 | Bacteria | 8501 |
| 520 | Ga0501038_0018790 | 3300049574 | Bacteria | 6238 |
| 521 | Ga0501038_0020493 | 3300049574 | Bacteria | 5941 |
| 522 | Ga0501038_0114160 | 3300049574 | Bacteria | 2234 |
| 523 | Ga0501038_0121637 | 3300049574 | Bacteria | 2152 |
| 524 | Ga0501038_0221943 | 3300049574 | Bacteria | 1507 |
| 525 | Ga0501038_0232561 | 3300049574 | Bacteria | 1466 |
| 526 | Ga0501039_0000908 | 3300049575 | Bacteria | 21595 |
| 527 | Ga0501039_0024561 | 3300049575 | Bacteria | 4630 |
| 528 | Ga0501039_0174850 | 3300049575 | Bacteria | 1688 |
| 529 | Ga0501039_0340689 | 3300049575 | Bacteria | 1178 |
| 530 | Ga0501040_0372919 | 3300049576 | Bacteria | 1023 |
| 531 | Ga0501042_0039064 | 3300049578 | Bacteria | 3372 |
| 532 | Ga0501042_0047649 | 3300049578 | Bacteria | 3056 |
| 533 | Ga0501042_0056635 | 3300049578 | Bacteria | 2797 |
| 534 | Ga0501042_0218824 | 3300049578 | Bacteria | 1373 |
| 535 | Ga0501043_0002408 | 3300049579 | Bacteria | 15831 |
| 536 | Ga0501043_0006764 | 3300049579 | Bacteria | 9156 |
| 537 | Ga0501043_0038281 | 3300049579 | Bacteria | 3771 |
| 538 | Ga0501043_0081655 | 3300049579 | Bacteria | 2540 |
| 539 | Ga0501043_0099574 | 3300049579 | Bacteria | 2285 |
| 540 | Ga0501043_0147748 | 3300049579 | Bacteria | 1840 |
| 541 | Ga0501043_0172573 | 3300049579 | Bacteria | 1687 |
| 542 | Ga0501046_0000928 | 3300049580 | Bacteria | 28785 |
| 543 | Ga0501046_0019814 | 3300049580 | Bacteria | 5572 |
| 544 | Ga0501046_0102405 | 3300049580 | Bacteria | 2195 |
| 545 | Ga0501046_0143622 | 3300049580 | Bacteria | 1804 |
| 546 | Ga0501046_0375744 | 3300049580 | Bacteria | 1029 |
| 547 | Ga0501047_0000025 | 3300049581 | Bacteria | 225560 |
| 548 | Ga0501047_0000921 | 3300049581 | Bacteria | 30119 |
| 549 | Ga0501047_0002500 | 3300049581 | Bacteria | 17526 |
| 550 | Ga0501047_0007651 | 3300049581 | Bacteria | 10173 |
| 551 | Ga0501047_0011628 | 3300049581 | Bacteria | 8324 |
| 552 | Ga0501047_0012202 | 3300049581 | Bacteria | 8134 |
| 553 | Ga0501047_0019157 | 3300049581 | Bacteria | 6565 |
| 554 | Ga0501047_0027128 | 3300049581 | Bacteria | 5517 |
| 555 | Ga0501047_0032937 | 3300049581 | Bacteria | 5004 |
| 556 | Ga0501047_0054939 | 3300049581 | Bacteria | 3851 |
| 557 | Ga0501047_0089462 | 3300049581 | Bacteria | 2956 |
| 558 | Ga0501047_0109683 | 3300049581 | Bacteria | 2642 |
| 559 | Ga0501047_0119175 | 3300049581 | Bacteria | 2521 |
| 560 | Ga0501047_0119606 | 3300049581 | Bacteria | 2516 |
| 561 | Ga0501047_0157822 | 3300049581 | Bacteria | 2141 |
| 562 | Ga0501047_0211563 | 3300049581 | Bacteria | 1797 |
| 563 | Ga0501047_0340310 | 3300049581 | Bacteria | 1338 |
| 564 | Ga0501048_0000046 | 3300049582 | Bacteria | 60199 |
| 565 | Ga0501048_0001187 | 3300049582 | Bacteria | 19717 |
| 566 | Ga0501048_0004083 | 3300049582 | Bacteria | 11120 |
| 567 | Ga0501048_0120238 | 3300049582 | Bacteria | 1856 |
| 568 | Ga0501048_0122813 | 3300049582 | Bacteria | 1835 |
| 569 | Ga0501067_0000575 | 3300049583 | Bacteria | 19864 |
| 570 | Ga0501067_0002800 | 3300049583 | Bacteria | 9596 |
| 571 | Ga0501067_0011767 | 3300049583 | Bacteria | 4846 |
| 572 | Ga0501067_0114250 | 3300049583 | Bacteria | 1501 |
| 573 | Ga0501068_0001130 | 3300049584 | Bacteria | 14139 |
| 574 | Ga0501068_0022887 | 3300049584 | Bacteria | 3658 |
| 575 | Ga0501068_0068044 | 3300049584 | Bacteria | 2171 |
| 576 | Ga0501069_0000338 | 3300049585 | Bacteria | 21160 |
| 577 | Ga0501070_0001453 | 3300049586 | Bacteria | 21192 |
| 578 | Ga0501070_0002903 | 3300049586 | Bacteria | 14936 |
| 579 | Ga0501070_0018239 | 3300049586 | Bacteria | 5887 |
| 580 | Ga0501070_0027306 | 3300049586 | Bacteria | 4788 |
| 581 | Ga0501070_0033496 | 3300049586 | Bacteria | 4299 |
| 582 | Ga0501070_0099189 | 3300049586 | Bacteria | 2410 |
| 583 | Ga0501071_0001198 | 3300049587 | Bacteria | 14639 |
| 584 | Ga0501072_0000344 | 3300049588 | Bacteria | 33052 |
| 585 | Ga0501072_0021856 | 3300049588 | Bacteria | 4962 |
| 586 | Ga0501072_0124218 | 3300049588 | Bacteria | 2056 |
| 587 | Ga0501072_0435180 | 3300049588 | Bacteria | 1039 |
| 588 | Ga0501073_0003741 | 3300049589 | Bacteria | 11425 |
| 589 | Ga0501073_0007430 | 3300049589 | Bacteria | 8146 |
| 590 | Ga0501073_0032453 | 3300049589 | Bacteria | 3722 |
| 591 | Ga0501073_0065942 | 3300049589 | Bacteria | 2524 |
| 592 | Ga0501073_0327583 | 3300049589 | Bacteria | 1057 |
| 593 | Ga0501074_0000798 | 3300049590 | Bacteria | 19915 |
| 594 | Ga0501074_0008507 | 3300049590 | Bacteria | 7434 |
| 595 | Ga0501076_0010690 | 3300049592 | Bacteria | 6821 |
| 596 | Ga0501077_0033415 | 3300049593 | Bacteria | 3274 |
| 597 | Ga0501079_0016506 | 3300049741 | Bacteria | 5639 |
| 598 | Ga0501079_0021118 | 3300049741 | Bacteria | 4977 |
| 599 | Ga0501079_0026731 | 3300049741 | Bacteria | 4424 |
| 600 | Ga0501080_0004691 | 3300049742 | Bacteria | 12193 |
| 601 | Ga0501080_0088807 | 3300049742 | Bacteria | 2871 |
| 602 | Ga0501080_0092804 | 3300049742 | Bacteria | 2803 |
| 603 | Ga0501080_0180455 | 3300049742 | Bacteria | 1943 |
| 604 | Ga0501083_0004389 | 3300049744 | Bacteria | 9948 |
| 605 | Ga0501083_0019150 | 3300049744 | Bacteria | 4767 |
| 606 | Ga0501035_0003677 | 3300049822 | Bacteria | 14619 |
| 607 | Ga0501035_0005555 | 3300049822 | Bacteria | 11915 |
| 608 | Ga0501035_0014767 | 3300049822 | Bacteria | 7212 |
| 609 | Ga0501035_0017234 | 3300049822 | Bacteria | 6659 |
| 610 | Ga0501035_0017668 | 3300049822 | Bacteria | 6578 |
| 611 | Ga0501035_0019226 | 3300049822 | Bacteria | 6288 |
| 612 | Ga0501035_0021995 | 3300049822 | Bacteria | 5857 |
| 613 | Ga0501035_0027172 | 3300049822 | Bacteria | 5232 |
| 614 | Ga0501035_0062275 | 3300049822 | Bacteria | 3320 |
| 615 | Ga0501035_0083365 | 3300049822 | Bacteria | 2821 |
| 616 | Ga0501035_0101239 | 3300049822 | Bacteria | 2528 |
| 617 | Ga0501035_0131395 | 3300049822 | Bacteria | 2182 |
| 618 | Ga0501035_0137183 | 3300049822 | Bacteria | 2129 |
| 619 | Ga0501035_0154379 | 3300049822 | Bacteria | 1990 |
| 620 | Ga0501035_0203248 | 3300049822 | Bacteria | 1698 |
| 621 | Ga0501035_0237957 | 3300049822 | Bacteria | 1549 |
| 622 | Ga0501035_0317792 | 3300049822 | Bacteria | 1309 |
| 623 | Ga0501035_0533925 | 3300049822 | Bacteria | 962 |
| 624 | Ga0501044_0002060 | 3300049823 | Bacteria | 23168 |
| 625 | Ga0501044_0004946 | 3300049823 | Bacteria | 14904 |
| 626 | Ga0501044_0013132 | 3300049823 | Bacteria | 8966 |
| 627 | Ga0501044_0041906 | 3300049823 | Bacteria | 4765 |
| 628 | Ga0501044_0042540 | 3300049823 | Bacteria | 4724 |
| 629 | Ga0501044_0057150 | 3300049823 | Bacteria | 4004 |
| 630 | Ga0501044_0097712 | 3300049823 | Bacteria | 2957 |
| 631 | Ga0501044_0117543 | 3300049823 | Bacteria | 2663 |
| 632 | Ga0501044_0167103 | 3300049823 | Bacteria | 2173 |
| 633 | Ga0501044_0205458 | 3300049823 | Bacteria | 1926 |
| 634 | Ga0501044_0235589 | 3300049823 | Bacteria | 1776 |
| 635 | Ga0501044_0285991 | 3300049823 | Bacteria | 1581 |
| 636 | Ga0501044_0310807 | 3300049823 | Bacteria | 1503 |
| 637 | Ga0501044_0581366 | 3300049823 | Bacteria | 1014 |
| 638 | Ga0501044_0584006 | 3300049823 | Bacteria | 1011 |
| 639 | Ga0501044_0719762 | 3300049823 | Bacteria | 882 |
| 640 | Ga0501045_0008767 | 3300049824 | Bacteria | 7058 |
| 641 | nmdc:mga06z11_9505_c1 | 3300050494 | Bacteria | 4100 |
| 642 | Ga0495619_0039846 | 3300053085 | Bacteria | 3068 |
| 643 | Ga0500578_0031319 | 3300053086 | Bacteria | 3417 |
| 644 | Ga0500640_015413 | 3300053095 | Bacteria | 3199 |
| 645 | Ga0500654_034732 | 3300053099 | Bacteria | 2972 |
| 646 | Ga0500553_022913 | 3300053101 | Bacteria | 3154 |
| 647 | Ga0500560_023076 | 3300053107 | Bacteria | 1800 |
| 648 | Ga0500569_016937 | 3300053109 | Bacteria | 1854 |
| 649 | Ga0500614_025713 | 3300053123 | Bacteria | 1402 |
| 650 | Ga0500652_003553 | 3300053131 | Bacteria | 4731 |
| 651 | Ga0500658_0004751 | 3300053134 | Bacteria | 5061 |
| 652 | Ga0500561_0000736 | 3300053137 | Bacteria | 5189 |
| 653 | Ga0500600_0136894 | 3300053149 | Bacteria | 1238 |
| 654 | Ga0500619_023657 | 3300053154 | Bacteria | 1798 |
| 655 | Ga0500627_0150266 | 3300053158 | Bacteria | 1052 |
| 656 | Ga0500636_0165813 | 3300053177 | Bacteria | 1200 |
| 657 | Ga0500656_005217 | 3300053732 | Bacteria | 1277 |
| 658 | Ga0500587_000186 | 3300053739 | Bacteria | 6353 |
| 659 | Ga0501084_0000375 | 3300054114 | Bacteria | 34270 |
| 660 | Ga0501084_0001251 | 3300054114 | Bacteria | 19995 |
| 661 | Ga0501084_0009845 | 3300054114 | Bacteria | 7900 |
| 662 | Ga0501084_0043106 | 3300054114 | Bacteria | 3775 |
| 663 | Ga0501082_0034550 | 3300060353 | Bacteria | 4357 |
| 664 | Ga0501082_0310717 | 3300060353 | Bacteria | 1373 |
| 665 | Ga0466962_0006434 | 3300061719 | Bacteria | 5638 |
| 666 | Ga0530510_0013267 | 3300061734 | Bacteria | 5793 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053739 | Ga0500587_000186 | Ga0500587_000186_20_727 | 229 |
| 2 | 3300049580 | Ga0501046_0375744 | Ga0501046_0375744_24_803 | 235 |
| 3 | 3300038735 | Ga0400485_00947 | Ga0400485_00947_281_1057 | 246 |
| 4 | 3300042125 | Ga0450923_028966 | Ga0450923_028966_313_1092 | 248 |
| 5 | 3300046523 | Ga0495644_0050512 | Ga0495644_0050512_37_804 | 250 |
| 6 | 3300049568 | Ga0501031_0024171 | Ga0501031_0024171_55_963 | 250 |
| 7 | 3300049571 | Ga0501034_0034779 | Ga0501034_0034779_2760_3668 | 250 |
| 8 | 3300049574 | Ga0501038_0018790 | Ga0501038_0018790_4088_4996 | 250 |
| 9 | 3300049582 | Ga0501048_0000046 | Ga0501048_0000046_29037_29945 | 250 |
| 10 | 3300049586 | Ga0501070_0027306 | Ga0501070_0027306_670_1578 | 250 |
| 11 | 3300005843 | Ga0068860_100020336 | Ga0068860_1000203368 | 251 |
| 12 | 3300028381 | Ga0268264_10005559 | Ga0268264_100055594 | 251 |
| 13 | 3300049579 | Ga0501043_0006764 | Ga0501043_0006764_2170_3078 | 251 |
| 14 | 3300049581 | Ga0501047_0012202 | Ga0501047_0012202_6379_7287 | 251 |
| 15 | 3300049742 | Ga0501080_0088807 | Ga0501080_0088807_1695_2576 | 251 |
| 16 | 3300049822 | Ga0501035_0027172 | Ga0501035_0027172_1492_2400 | 251 |
| 17 | 3300049823 | Ga0501044_0042540 | Ga0501044_0042540_2521_3429 | 251 |
| 18 | 3300005327 | Ga0070658_10197740 | Ga0070658_101977402 | 252 |
| 19 | 3300005329 | Ga0070683_100143575 | Ga0070683_1001435752 | 252 |
| 20 | 3300005335 | Ga0070666_10108909 | Ga0070666_101089091 | 252 |
| 21 | 3300005535 | Ga0070684_100042466 | Ga0070684_1000424662 | 252 |
| 22 | 3300005548 | Ga0070665_100222134 | Ga0070665_1002221342 | 252 |
| 23 | 3300005578 | Ga0068854_100076320 | Ga0068854_1000763202 | 252 |
| 24 | 3300005616 | Ga0068852_100131459 | Ga0068852_1001314591 | 252 |
| 25 | 3300005618 | Ga0068864_100167090 | Ga0068864_1001670902 | 252 |
| 26 | 3300005719 | Ga0068861_100192734 | Ga0068861_1001927342 | 252 |
| 27 | 3300005842 | Ga0068858_100040358 | Ga0068858_1000403585 | 252 |
| 28 | 3300009174 | Ga0105241_10054043 | Ga0105241_100540432 | 252 |
| 29 | 3300009177 | Ga0105248_10481541 | Ga0105248_104815412 | 252 |
| 30 | 3300013297 | Ga0157378_10401142 | Ga0157378_104011422 | 252 |
| 31 | 3300013306 | Ga0163162_10352641 | Ga0163162_103526411 | 252 |
| 32 | 3300013307 | Ga0157372_10097036 | Ga0157372_100970362 | 252 |
| 33 | 3300014325 | Ga0163163_10080560 | Ga0163163_100805603 | 252 |
| 34 | 3300025903 | Ga0207680_10075123 | Ga0207680_100751232 | 252 |
| 35 | 3300025909 | Ga0207705_10147245 | Ga0207705_101472451 | 252 |
| 36 | 3300026023 | Ga0207677_10182372 | Ga0207677_101823722 | 252 |
| 37 | 3300026035 | Ga0207703_10158300 | Ga0207703_101583002 | 252 |
| 38 | 3300026095 | Ga0207676_10119532 | Ga0207676_101195322 | 252 |
| 39 | 3300028379 | Ga0268266_10152934 | Ga0268266_101529342 | 252 |
| 40 | 3300047471 | Ga0495684_0150810 | Ga0495684_0150810_49_807 | 252 |
| 41 | 3300046462 | Ga0495651_0393266 | Ga0495651_0393266_21_797 | 253 |
| 42 | 3300031456 | Ga0307513_10074353 | Ga0307513_100743534 | 254 |
| 43 | 3300049570 | Ga0501033_0221425 | Ga0501033_0221425_137_1039 | 254 |
| 44 | 3300009176 | Ga0105242_10020314 | Ga0105242_100203144 | 256 |
| 45 | 3300025934 | Ga0207686_10038384 | Ga0207686_100383842 | 256 |
| 46 | 3300046794 | Ga0495589_0075812 | Ga0495589_0075812_35_913 | 256 |
| 47 | 3300049575 | Ga0501039_0000908 | Ga0501039_0000908_20811_21584 | 257 |
| 48 | 3300005530 | Ga0070679_100146277 | Ga0070679_1001462772 | 258 |
| 49 | 3300009093 | Ga0105240_10118849 | Ga0105240_101188494 | 258 |
| 50 | 3300009098 | Ga0105245_10054003 | Ga0105245_100540032 | 258 |
| 51 | 3300009174 | Ga0105241_10022485 | Ga0105241_100224855 | 258 |
| 52 | 3300013105 | Ga0157369_10003278 | Ga0157369_1000327821 | 258 |
| 53 | 3300013297 | Ga0157378_10198260 | Ga0157378_101982602 | 258 |
| 54 | 3300025927 | Ga0207687_10031945 | Ga0207687_100319452 | 258 |
| 55 | 3300026041 | Ga0207639_10037822 | Ga0207639_100378223 | 258 |
| 56 | 3300039437 | Ga0436365_0198870 | Ga0436365_0198870_968_1801 | 258 |
| 57 | 3300049570 | Ga0501033_0040252 | Ga0501033_0040252_1871_2704 | 258 |
| 58 | 3300049571 | Ga0501034_0075832 | Ga0501034_0075832_810_1643 | 258 |
| 59 | 3300049572 | Ga0501036_0405997 | Ga0501036_0405997_243_1076 | 258 |
| 60 | 3300049579 | Ga0501043_0172573 | Ga0501043_0172573_294_1127 | 258 |
| 61 | 3300049580 | Ga0501046_0019814 | Ga0501046_0019814_3322_4155 | 258 |
| 62 | 3300049581 | Ga0501047_0007651 | Ga0501047_0007651_4307_5140 | 258 |
| 63 | 3300049589 | Ga0501073_0065942 | Ga0501073_0065942_1179_2012 | 258 |
| 64 | 3300049822 | Ga0501035_0017234 | Ga0501035_0017234_61_894 | 258 |
| 65 | 3300049823 | Ga0501044_0581366 | Ga0501044_0581366_76_909 | 258 |
| 66 | 3300049823 | Ga0501044_0719762 | Ga0501044_0719762_22_855 | 258 |
| 67 | 3300005344 | Ga0070661_100014282 | Ga0070661_1000142822 | 259 |
| 68 | 3300013297 | Ga0157378_10051537 | Ga0157378_100515374 | 259 |
| 69 | 3300025920 | Ga0207649_10030222 | Ga0207649_100302224 | 259 |
| 70 | 3300028577 | Ga0265318_10001785 | Ga0265318_100017852 | 259 |
| 71 | 3300031235 | Ga0265330_10040068 | Ga0265330_100400682 | 259 |
| 72 | 3300031241 | Ga0265325_10148880 | Ga0265325_101488801 | 259 |
| 73 | 3300031250 | Ga0265331_10040757 | Ga0265331_100407572 | 259 |
| 74 | 3300031595 | Ga0265313_10000757 | Ga0265313_1000075728 | 259 |
| 75 | 3300049570 | Ga0501033_0065827 | Ga0501033_0065827_846_1727 | 259 |
| 76 | 3300049573 | Ga0501037_0076763 | Ga0501037_0076763_606_1487 | 259 |
| 77 | 3300049574 | Ga0501038_0121637 | Ga0501038_0121637_181_1062 | 259 |
| 78 | 3300049581 | Ga0501047_0211563 | Ga0501047_0211563_535_1416 | 259 |
| 79 | 3300049822 | Ga0501035_0101239 | Ga0501035_0101239_353_1234 | 259 |
| 80 | 3300049823 | Ga0501044_0205458 | Ga0501044_0205458_461_1342 | 259 |
| 81 | 3300005335 | Ga0070666_10345016 | Ga0070666_103450161 | 260 |
| 82 | 3300038735 | Ga0400485_06984 | Ga0400485_06984_10218_11093 | 260 |
| 83 | 3300038742 | Ga0400486_00966 | Ga0400486_00966_1224_2099 | 260 |
| 84 | 3300038726 | Ga0400490_31308 | Ga0400490_31308_4588_5496 | 262 |
| 85 | 3300005471 | Ga0070698_100284442 | Ga0070698_1002844423 | 263 |
| 86 | 3300005518 | Ga0070699_100130736 | Ga0070699_1001307362 | 263 |
| 87 | 3300031548 | Ga0307408_100141032 | Ga0307408_1001410323 | 263 |
| 88 | 3300031665 | Ga0316575_10039379 | Ga0316575_100393792 | 263 |
| 89 | 3300031911 | Ga0307412_10154109 | Ga0307412_101541092 | 263 |
| 90 | 3300042436 | Ga0439435_0069861 | Ga0439435_0069861_117_968 | 263 |
| 91 | 3300048925 | Ga0496122_0197236 | Ga0496122_0197236_142_1029 | 263 |
| 92 | 3300049582 | Ga0501048_0120238 | Ga0501048_0120238_99_947 | 263 |
| 93 | 3300005347 | Ga0070668_100004875 | Ga0070668_1000048754 | 264 |
| 94 | 3300005455 | Ga0070663_100002126 | Ga0070663_1000021262 | 264 |
| 95 | 3300025972 | Ga0207668_10001856 | Ga0207668_100018569 | 264 |
| 96 | 3300026067 | Ga0207678_10000442 | Ga0207678_100004428 | 264 |
| 97 | 3300026121 | Ga0207683_10100074 | Ga0207683_101000741 | 264 |
| 98 | 3300030522 | Ga0307512_10231252 | Ga0307512_102312521 | 264 |
| 99 | 3300031838 | Ga0307518_10000376 | Ga0307518_1000037619 | 264 |
| 100 | 3300033179 | Ga0307507_10035329 | Ga0307507_100353295 | 264 |
| 101 | 3300033180 | Ga0307510_10034631 | Ga0307510_100346315 | 264 |
| 102 | 3300035398 | Ga0316574_0051175 | Ga0316574_0051175_33_899 | 264 |
| 103 | iso_pu_bacteria | 2585427649 | 2586062642 | 264 |
| 104 | iso_pu_bacteria | 2808606522 | 2809588177 | 264 |
| 105 | iso_pu_bacteria | 2915768154 | 2915773701 | 264 |
| 106 | iso_pu_bacteria | 2917736166 | 2917741733 | 264 |
| 107 | iso_pu_bacteria | 8003314358 | 8003316772 | 264 |
| 108 | 3300005339 | Ga0070660_100220279 | Ga0070660_1002202792 | 265 |
| 109 | 3300005341 | Ga0070691_10105788 | Ga0070691_101057881 | 265 |
| 110 | 3300005366 | Ga0070659_100160886 | Ga0070659_1001608861 | 265 |
| 111 | 3300005563 | Ga0068855_100088273 | Ga0068855_1000882732 | 265 |
| 112 | 3300006358 | Ga0068871_100140116 | Ga0068871_1001401163 | 265 |
| 113 | 3300013104 | Ga0157370_10186313 | Ga0157370_101863132 | 265 |
| 114 | 3300049568 | Ga0501031_0004159 | Ga0501031_0004159_2551_3405 | 265 |
| 115 | 3300049569 | Ga0501032_0006464 | Ga0501032_0006464_1285_2139 | 265 |
| 116 | 3300049570 | Ga0501033_0008095 | Ga0501033_0008095_1555_2409 | 265 |
| 117 | 3300049570 | Ga0501033_0019893 | Ga0501033_0019893_526_1380 | 265 |
| 118 | 3300049570 | Ga0501033_0088316 | Ga0501033_0088316_983_1837 | 265 |
| 119 | 3300049570 | Ga0501033_0172205 | Ga0501033_0172205_467_1321 | 265 |
| 120 | 3300049570 | Ga0501033_0242006 | Ga0501033_0242006_152_1006 | 265 |
| 121 | 3300049571 | Ga0501034_0001944 | Ga0501034_0001944_7715_8569 | 265 |
| 122 | 3300049571 | Ga0501034_0187203 | Ga0501034_0187203_968_1822 | 265 |
| 123 | 3300049571 | Ga0501034_0660194 | Ga0501034_0660194_58_912 | 265 |
| 124 | 3300049572 | Ga0501036_0005092 | Ga0501036_0005092_3043_3897 | 265 |
| 125 | 3300049574 | Ga0501038_0020493 | Ga0501038_0020493_745_1599 | 265 |
| 126 | 3300049578 | Ga0501042_0039064 | Ga0501042_0039064_21_875 | 265 |
| 127 | 3300049579 | Ga0501043_0038281 | Ga0501043_0038281_710_1564 | 265 |
| 128 | 3300049580 | Ga0501046_0000928 | Ga0501046_0000928_17560_18414 | 265 |
| 129 | 3300049581 | Ga0501047_0002500 | Ga0501047_0002500_2968_3822 | 265 |
| 130 | 3300049581 | Ga0501047_0019157 | Ga0501047_0019157_1845_2699 | 265 |
| 131 | 3300049581 | Ga0501047_0032937 | Ga0501047_0032937_183_1043 | 265 |
| 132 | 3300049581 | Ga0501047_0089462 | Ga0501047_0089462_1085_1939 | 265 |
| 133 | 3300049581 | Ga0501047_0340310 | Ga0501047_0340310_199_1053 | 265 |
| 134 | 3300049582 | Ga0501048_0001187 | Ga0501048_0001187_10902_11756 | 265 |
| 135 | 3300049583 | Ga0501067_0002800 | Ga0501067_0002800_8114_8968 | 265 |
| 136 | 3300049584 | Ga0501068_0022887 | Ga0501068_0022887_2740_3594 | 265 |
| 137 | 3300049585 | Ga0501069_0000338 | Ga0501069_0000338_8561_9415 | 265 |
| 138 | 3300049586 | Ga0501070_0002903 | Ga0501070_0002903_7342_8196 | 265 |
| 139 | 3300049588 | Ga0501072_0124218 | Ga0501072_0124218_258_1112 | 265 |
| 140 | 3300049589 | Ga0501073_0003741 | Ga0501073_0003741_4092_4946 | 265 |
| 141 | 3300049590 | Ga0501074_0008507 | Ga0501074_0008507_4888_5742 | 265 |
| 142 | 3300049741 | Ga0501079_0026731 | Ga0501079_0026731_2183_3037 | 265 |
| 143 | 3300049742 | Ga0501080_0004691 | Ga0501080_0004691_8841_9695 | 265 |
| 144 | 3300049742 | Ga0501080_0180455 | Ga0501080_0180455_796_1650 | 265 |
| 145 | 3300049744 | Ga0501083_0004389 | Ga0501083_0004389_6741_7595 | 265 |
| 146 | 3300049822 | Ga0501035_0017668 | Ga0501035_0017668_1246_2106 | 265 |
| 147 | 3300049822 | Ga0501035_0131395 | Ga0501035_0131395_20_874 | 265 |
| 148 | 3300049822 | Ga0501035_0317792 | Ga0501035_0317792_35_889 | 265 |
| 149 | 3300049822 | Ga0501035_0533925 | Ga0501035_0533925_15_869 | 265 |
| 150 | 3300049823 | Ga0501044_0002060 | Ga0501044_0002060_4431_5291 | 265 |
| 151 | 3300049823 | Ga0501044_0097712 | Ga0501044_0097712_2065_2919 | 265 |
| 152 | 3300049824 | Ga0501045_0008767 | Ga0501045_0008767_5479_6333 | 265 |
| 153 | 3300054114 | Ga0501084_0001251 | Ga0501084_0001251_16767_17621 | 265 |
| 154 | 3300060353 | Ga0501082_0034550 | Ga0501082_0034550_1581_2435 | 265 |
| 155 | 3300060353 | Ga0501082_0310717 | Ga0501082_0310717_18_872 | 265 |
| 156 | 3300005329 | Ga0070683_100107341 | Ga0070683_1001073413 | 266 |
| 157 | 3300005546 | Ga0070696_100066186 | Ga0070696_1000661862 | 266 |
| 158 | 3300028794 | Ga0307515_10000123 | Ga0307515_10000123146 | 266 |
| 159 | 3300028794 | Ga0307515_10018885 | Ga0307515_100188859 | 266 |
| 160 | 3300031456 | Ga0307513_10071416 | Ga0307513_100714162 | 266 |
| 161 | 3300031665 | Ga0316575_10007710 | Ga0316575_100077104 | 266 |
| 162 | 3300031691 | Ga0316579_10003704 | Ga0316579_100037045 | 266 |
| 163 | 3300031728 | Ga0316578_10128277 | Ga0316578_101282772 | 266 |
| 164 | 3300031733 | Ga0316577_10132188 | Ga0316577_101321881 | 266 |
| 165 | 3300032133 | Ga0316583_10014027 | Ga0316583_100140273 | 266 |
| 166 | 3300032137 | Ga0316585_10017204 | Ga0316585_100172043 | 266 |
| 167 | 3300032139 | Ga0316580_10008164 | Ga0316580_100081642 | 266 |
| 168 | 3300036647 | Ga0316582_0013088 | Ga0316582_0013088_3400_4323 | 266 |
| 169 | 3300036712 | Ga0316584_0071703 | Ga0316584_0071703_145_1068 | 266 |
| 170 | iso_pu_bacteria | 2582580736 | 2583153342 | 266 |
| 171 | iso_pu_bacteria | 2585428062 | 2587758083 | 266 |
| 172 | iso_pu_bacteria | 2863067949 | 2863071351 | 266 |
| 173 | iso_pu_bacteria | 2866612099 | 2866618511 | 266 |
| 174 | iso_pu_bacteria | 8056207758 | 8056207776 | 266 |
| 175 | 3300005518 | Ga0070699_100460891 | Ga0070699_1004608911 | 267 |
| 176 | 3300005616 | Ga0068852_100019746 | Ga0068852_1000197463 | 267 |
| 177 | 3300020082 | Ga0206353_10549273 | Ga0206353_105492733 | 267 |
| 178 | 3300026142 | Ga0207698_10006997 | Ga0207698_100069974 | 267 |
| 179 | 3300044693 | Ga0466961_0106706 | Ga0466961_0106706_259_1224 | 267 |
| 180 | 3300049570 | Ga0501033_0036156 | Ga0501033_0036156_1578_2486 | 267 |
| 181 | 3300049822 | Ga0501035_0083365 | Ga0501035_0083365_1654_2562 | 267 |
| 182 | 3300049823 | Ga0501044_0285991 | Ga0501044_0285991_570_1478 | 267 |
| 183 | 3300005329 | Ga0070683_100092324 | Ga0070683_1000923242 | 268 |
| 184 | 3300005458 | Ga0070681_10364717 | Ga0070681_103647172 | 268 |
| 185 | 3300013100 | Ga0157373_10318067 | Ga0157373_103180672 | 268 |
| 186 | 3300020082 | Ga0206353_11306600 | Ga0206353_113066002 | 268 |
| 187 | 3300025949 | Ga0207667_10314455 | Ga0207667_103144551 | 268 |
| 188 | 3300030522 | Ga0307512_10027900 | Ga0307512_100279004 | 268 |
| 189 | 3300031456 | Ga0307513_10177778 | Ga0307513_101777782 | 268 |
| 190 | 3300036712 | Ga0316584_0407841 | Ga0316584_0407841_60_935 | 268 |
| 191 | 3300038727 | Ga0400491_26268 | Ga0400491_26268_1308_2183 | 268 |
| 192 | 3300038735 | Ga0400485_07748 | Ga0400485_07748_3656_4531 | 268 |
| 193 | 3300038742 | Ga0400486_01623 | Ga0400486_01623_4248_5123 | 268 |
| 194 | 3300039093 | Ga0400489_08878 | Ga0400489_08878_4101_4976 | 268 |
| 195 | 3300039110 | Ga0400487_04533 | Ga0400487_04533_18580_19455 | 268 |
| 196 | 3300039110 | Ga0400487_35172 | Ga0400487_35172_4181_5056 | 268 |
| 197 | 3300049589 | Ga0501073_0327583 | Ga0501073_0327583_35_910 | 268 |
| 198 | 3300053085 | Ga0495619_0039846 | Ga0495619_0039846_335_1258 | 268 |
| 199 | 3300054114 | Ga0501084_0000375 | Ga0501084_0000375_31794_32666 | 268 |
| 200 | 3300005563 | Ga0068855_100000529 | Ga0068855_1000005295 | 269 |
| 201 | 3300005616 | Ga0068852_100003179 | Ga0068852_1000031799 | 269 |
| 202 | 3300009093 | Ga0105240_10000055 | Ga0105240_10000055198 | 269 |
| 203 | 3300009174 | Ga0105241_10037299 | Ga0105241_100372992 | 269 |
| 204 | 3300009177 | Ga0105248_10000001 | Ga0105248_100000011767 | 269 |
| 205 | 3300009551 | Ga0105238_10006649 | Ga0105238_100066499 | 269 |
| 206 | 3300010375 | Ga0105239_10001057 | Ga0105239_1000105720 | 269 |
| 207 | 3300010375 | Ga0105239_10005950 | Ga0105239_100059506 | 269 |
| 208 | 3300013306 | Ga0163162_10220711 | Ga0163162_102207112 | 269 |
| 209 | 3300014969 | Ga0157376_10202977 | Ga0157376_102029772 | 269 |
| 210 | 3300025913 | Ga0207695_10000012 | Ga0207695_10000012139 | 269 |
| 211 | 3300025924 | Ga0207694_10000006 | Ga0207694_10000006526 | 269 |
| 212 | 3300025941 | Ga0207711_10000001 | Ga0207711_10000001105 | 269 |
| 213 | 3300025949 | Ga0207667_10000026 | Ga0207667_10000026255 | 269 |
| 214 | 3300026142 | Ga0207698_10007799 | Ga0207698_100077994 | 269 |
| 215 | 3300028577 | Ga0265318_10000149 | Ga0265318_1000014938 | 269 |
| 216 | 3300031250 | Ga0265331_10039331 | Ga0265331_100393312 | 269 |
| 217 | 3300031344 | Ga0265316_10027475 | Ga0265316_100274752 | 269 |
| 218 | 3300031727 | Ga0316576_10003035 | Ga0316576_100030353 | 269 |
| 219 | 3300031727 | Ga0316576_10004532 | Ga0316576_100045324 | 269 |
| 220 | 3300031728 | Ga0316578_10000481 | Ga0316578_1000048114 | 269 |
| 221 | 3300031728 | Ga0316578_10010470 | Ga0316578_100104704 | 269 |
| 222 | 3300031733 | Ga0316577_10003164 | Ga0316577_100031645 | 269 |
| 223 | 3300032133 | Ga0316583_10040669 | Ga0316583_100406691 | 269 |
| 224 | 3300032137 | Ga0316585_10000539 | Ga0316585_100005397 | 269 |
| 225 | 3300032139 | Ga0316580_10005182 | Ga0316580_100051822 | 269 |
| 226 | 3300035398 | Ga0316574_0008845 | Ga0316574_0008845_1068_1946 | 269 |
| 227 | 3300035398 | Ga0316574_0045314 | Ga0316574_0045314_191_1195 | 269 |
| 228 | 3300036647 | Ga0316582_0002166 | Ga0316582_0002166_5064_5942 | 269 |
| 229 | 3300036712 | Ga0316584_0001840 | Ga0316584_0001840_8366_9244 | 269 |
| 230 | 3300039437 | Ga0436365_0704399 | Ga0436365_0704399_94_981 | 269 |
| 231 | 3300044693 | Ga0466961_0005851 | Ga0466961_0005851_6645_7559 | 269 |
| 232 | 3300046516 | Ga0495628_0280343 | Ga0495628_0280343_130_1014 | 269 |
| 233 | 3300046529 | Ga0495652_0231649 | Ga0495652_0231649_82_960 | 269 |
| 234 | 3300046689 | Ga0495613_0136081 | Ga0495613_0136081_541_1407 | 269 |
| 235 | 3300048929 | Ga0496126_0001104 | Ga0496126_0001104_3519_4400 | 269 |
| 236 | 3300049460 | Ga0495682_0068266 | Ga0495682_0068266_249_1124 | 269 |
| 237 | 3300049569 | Ga0501032_0084048 | Ga0501032_0084048_112_990 | 269 |
| 238 | 3300049571 | Ga0501034_0020633 | Ga0501034_0020633_5274_6152 | 269 |
| 239 | 3300049581 | Ga0501047_0119175 | Ga0501047_0119175_955_1821 | 269 |
| 240 | 3300049583 | Ga0501067_0000575 | Ga0501067_0000575_5547_6413 | 269 |
| 241 | 3300049583 | Ga0501067_0011767 | Ga0501067_0011767_646_1524 | 269 |
| 242 | 3300049586 | Ga0501070_0018239 | Ga0501070_0018239_1332_2210 | 269 |
| 243 | 3300049588 | Ga0501072_0021856 | Ga0501072_0021856_3377_4243 | 269 |
| 244 | 3300049588 | Ga0501072_0435180 | Ga0501072_0435180_12_890 | 269 |
| 245 | 3300049589 | Ga0501073_0007430 | Ga0501073_0007430_1349_2215 | 269 |
| 246 | 3300049589 | Ga0501073_0032453 | Ga0501073_0032453_908_1786 | 269 |
| 247 | 3300049741 | Ga0501079_0021118 | Ga0501079_0021118_810_1688 | 269 |
| 248 | 3300049742 | Ga0501080_0092804 | Ga0501080_0092804_501_1379 | 269 |
| 249 | 3300049822 | Ga0501035_0014767 | Ga0501035_0014767_3493_4371 | 269 |
| 250 | 3300049823 | Ga0501044_0013132 | Ga0501044_0013132_333_1211 | 269 |
| 251 | 3300053154 | Ga0500619_023657 | Ga0500619_023657_243_1118 | 269 |
| 252 | 3300054114 | Ga0501084_0009845 | Ga0501084_0009845_3703_4581 | 269 |
| 253 | 3300054114 | Ga0501084_0043106 | Ga0501084_0043106_158_1024 | 269 |
| 254 | 3300003775 | Ga0055524_1000125 | Ga0055524_10001258 | 270 |
| 255 | 3300003775 | Ga0055524_1001949 | Ga0055524_10019492 | 270 |
| 256 | 3300003791 | Ga0055530_10000470 | Ga0055530_1000047012 | 270 |
| 257 | 3300003791 | Ga0055530_10000982 | Ga0055530_1000098222 | 270 |
| 258 | 3300003792 | Ga0055540_1000011 | Ga0055540_100001175 | 270 |
| 259 | 3300003794 | Ga0055531_10006358 | Ga0055531_100063583 | 270 |
| 260 | 3300005435 | Ga0070714_100006279 | Ga0070714_1000062794 | 270 |
| 261 | 3300006946 | Ga0079104_1000465 | Ga0079104_100046516 | 270 |
| 262 | 3300021388 | Ga0213875_10003010 | Ga0213875_100030105 | 270 |
| 263 | 3300025263 | Ga0209565_1010883 | Ga0209565_10108831 | 270 |
| 264 | 3300025298 | Ga0209050_1000532 | Ga0209050_100053222 | 270 |
| 265 | 3300025298 | Ga0209050_1002916 | Ga0209050_100291611 | 270 |
| 266 | 3300025299 | Ga0209256_1000113 | Ga0209256_100011390 | 270 |
| 267 | 3300025303 | Ga0209051_1000020 | Ga0209051_100002074 | 270 |
| 268 | 3300025304 | Ga0209257_1000085 | Ga0209257_100008574 | 270 |
| 269 | 3300025929 | Ga0207664_10005792 | Ga0207664_100057929 | 270 |
| 270 | 3300027111 | Ga0209281_1000195 | Ga0209281_100019533 | 270 |
| 271 | 3300027876 | Ga0209974_10011278 | Ga0209974_100112782 | 270 |
| 272 | 3300028556 | Ga0265337_1001356 | Ga0265337_10013565 | 270 |
| 273 | 3300028573 | Ga0265334_10002334 | Ga0265334_100023342 | 270 |
| 274 | 3300028800 | Ga0265338_10029699 | Ga0265338_100296992 | 270 |
| 275 | 3300030522 | Ga0307512_10108440 | Ga0307512_101084402 | 270 |
| 276 | 3300031456 | Ga0307513_10017114 | Ga0307513_100171142 | 270 |
| 277 | 3300031456 | Ga0307513_10344365 | Ga0307513_103443651 | 270 |
| 278 | 3300031649 | Ga0307514_10015662 | Ga0307514_100156623 | 270 |
| 279 | 3300031711 | Ga0265314_10052245 | Ga0265314_100522452 | 270 |
| 280 | 3300031727 | Ga0316576_10000837 | Ga0316576_100008377 | 270 |
| 281 | 3300031728 | Ga0316578_10010371 | Ga0316578_100103714 | 270 |
| 282 | 3300031730 | Ga0307516_10020560 | Ga0307516_100205603 | 270 |
| 283 | 3300037588 | Ga0316581_0017017 | Ga0316581_0017017_645_1547 | 270 |
| 284 | 3300037853 | Ga0436364_0896138 | Ga0436364_0896138_22800_23735 | 270 |
| 285 | 3300038725 | Ga0400484_27811 | Ga0400484_27811_4021_4890 | 270 |
| 286 | 3300038726 | Ga0400490_51610 | Ga0400490_51610_385_1254 | 270 |
| 287 | 3300041404 | Ga0439436_0003702 | Ga0439436_0003702_198_1058 | 270 |
| 288 | 3300041406 | Ga0439439_0003783 | Ga0439439_0003783_2007_2867 | 270 |
| 289 | 3300042014 | Ga0439457_001353 | Ga0439457_001353_5543_6403 | 270 |
| 290 | 3300042121 | Ga0450919_001212 | Ga0450919_001212_671_1555 | 270 |
| 291 | 3300042131 | Ga0450894_000487 | Ga0450894_000487_4117_5022 | 270 |
| 292 | 3300042135 | Ga0450899_000635 | Ga0450899_000635_1415_2320 | 270 |
| 293 | 3300042435 | Ga0439434_0066787 | Ga0439434_0066787_141_1025 | 270 |
| 294 | 3300042531 | Ga0450918_000071 | Ga0450918_000071_14_898 | 270 |
| 295 | 3300045049 | Ga0466959_0271661 | Ga0466959_0271661_51_989 | 270 |
| 296 | 3300046512 | Ga0495610_0065508 | Ga0495610_0065508_653_1528 | 270 |
| 297 | 3300046522 | Ga0495643_0033285 | Ga0495643_0033285_209_1084 | 270 |
| 298 | 3300046660 | Ga0495625_0000990 | Ga0495625_0000990_2620_3495 | 270 |
| 299 | 3300046692 | Ga0495671_0138531 | Ga0495671_0138531_176_1051 | 270 |
| 300 | 3300047318 | Ga0495636_0006555 | Ga0495636_0006555_1997_2863 | 270 |
| 301 | 3300047443 | Ga0495687_006538 | Ga0495687_006538_3470_4336 | 270 |
| 302 | 3300048905 | Ga0496102_0000331 | Ga0496102_0000331_47698_48597 | 270 |
| 303 | 3300048905 | Ga0496102_0010679 | Ga0496102_0010679_1340_2278 | 270 |
| 304 | 3300048906 | Ga0496103_0021436 | Ga0496103_0021436_181_1080 | 270 |
| 305 | 3300048917 | Ga0496114_0003561 | Ga0496114_0003561_5940_6824 | 270 |
| 306 | 3300049571 | Ga0501034_0448555 | Ga0501034_0448555_20_901 | 270 |
| 307 | iso_pu_bacteria | 2643221644 | 2644248240 | 270 |
| 308 | iso_pu_bacteria | 2643221670 | 2644385536 | 270 |
| 309 | iso_pu_bacteria | 2784746763 | 2785344058 | 270 |
| 310 | iso_pu_bacteria | 2873151551 | 2873156426 | 270 |
| 311 | 3300028794 | Ga0307515_10174876 | Ga0307515_101748762 | 271 |
| 312 | 3300031456 | Ga0307513_10014726 | Ga0307513_100147262 | 271 |
| 313 | 3300031649 | Ga0307514_10015139 | Ga0307514_100151398 | 271 |
| 314 | 3300031665 | Ga0316575_10005400 | Ga0316575_100054003 | 271 |
| 315 | 3300031691 | Ga0316579_10088414 | Ga0316579_100884142 | 271 |
| 316 | 3300031727 | Ga0316576_10001885 | Ga0316576_100018858 | 271 |
| 317 | 3300031727 | Ga0316576_10194612 | Ga0316576_101946122 | 271 |
| 318 | 3300031728 | Ga0316578_10022534 | Ga0316578_100225342 | 271 |
| 319 | 3300031728 | Ga0316578_10137122 | Ga0316578_101371222 | 271 |
| 320 | 3300032133 | Ga0316583_10009058 | Ga0316583_100090585 | 271 |
| 321 | 3300032137 | Ga0316585_10095014 | Ga0316585_100950141 | 271 |
| 322 | 3300033179 | Ga0307507_10018099 | Ga0307507_100180995 | 271 |
| 323 | 3300035398 | Ga0316574_0011686 | Ga0316574_0011686_2818_3750 | 271 |
| 324 | 3300035398 | Ga0316574_0109984 | Ga0316574_0109984_373_1302 | 271 |
| 325 | 3300036647 | Ga0316582_0096226 | Ga0316582_0096226_271_1158 | 271 |
| 326 | 3300036712 | Ga0316584_0005975 | Ga0316584_0005975_4248_5135 | 271 |
| 327 | 3300036712 | Ga0316584_0056723 | Ga0316584_0056723_104_991 | 271 |
| 328 | 3300036712 | Ga0316584_0123743 | Ga0316584_0123743_382_1266 | 271 |
| 329 | 3300039062 | Ga0400483_077455 | Ga0400483_077455_827_1714 | 271 |
| 330 | 3300041404 | Ga0439436_0004032 | Ga0439436_0004032_1194_2069 | 271 |
| 331 | 3300041406 | Ga0439439_0004751 | Ga0439439_0004751_925_1800 | 271 |
| 332 | 3300041512 | Ga0451853_0034159 | Ga0451853_0034159_329_1210 | 271 |
| 333 | 3300041999 | Ga0439433_0009056 | Ga0439433_0009056_40_915 | 271 |
| 334 | 3300042014 | Ga0439457_003193 | Ga0439457_003193_2800_3675 | 271 |
| 335 | 3300042015 | Ga0439462_0005937 | Ga0439462_0005937_1968_2843 | 271 |
| 336 | 3300046454 | Ga0495592_0008020 | Ga0495592_0008020_384_1256 | 271 |
| 337 | 3300046459 | Ga0495629_0080985 | Ga0495629_0080985_229_1101 | 271 |
| 338 | 3300046462 | Ga0495651_0016521 | Ga0495651_0016521_2555_3427 | 271 |
| 339 | 3300046463 | Ga0495653_0069989 | Ga0495653_0069989_759_1631 | 271 |
| 340 | 3300046476 | Ga0495662_0033617 | Ga0495662_0033617_1449_2321 | 271 |
| 341 | 3300046516 | Ga0495628_0129113 | Ga0495628_0129113_897_1769 | 271 |
| 342 | 3300046529 | Ga0495652_0042608 | Ga0495652_0042608_1625_2497 | 271 |
| 343 | 3300046535 | Ga0495586_0090813 | Ga0495586_0090813_285_1157 | 271 |
| 344 | 3300046536 | Ga0495587_0006177 | Ga0495587_0006177_5433_6305 | 271 |
| 345 | 3300046559 | Ga0495667_0072253 | Ga0495667_0072253_767_1639 | 271 |
| 346 | 3300046663 | Ga0495635_0024955 | Ga0495635_0024955_2278_3150 | 271 |
| 347 | 3300046674 | Ga0495588_0170600 | Ga0495588_0170600_62_934 | 271 |
| 348 | 3300046680 | Ga0495646_0001039 | Ga0495646_0001039_13144_14016 | 271 |
| 349 | 3300046689 | Ga0495613_0054375 | Ga0495613_0054375_1290_2162 | 271 |
| 350 | 3300046809 | Ga0495600_0006928 | Ga0495600_0006928_702_1574 | 271 |
| 351 | 3300047319 | Ga0495674_0102132 | Ga0495674_0102132_505_1377 | 271 |
| 352 | 3300047321 | Ga0495676_0013737 | Ga0495676_0013737_4084_4956 | 271 |
| 353 | 3300047673 | Ga0495593_0004425 | Ga0495593_0004425_5309_6181 | 271 |
| 354 | 3300048088 | Ga0495602_0036614 | Ga0495602_0036614_1382_2254 | 271 |
| 355 | 3300048089 | Ga0495614_0006580 | Ga0495614_0006580_213_1085 | 271 |
| 356 | 3300053095 | Ga0500640_015413 | Ga0500640_015413_1627_2499 | 271 |
| 357 | 3300053101 | Ga0500553_022913 | Ga0500553_022913_1093_1965 | 271 |
| 358 | iso_pu_bacteria | 2643221587 | 2643944537 | 271 |
| 359 | iso_pu_bacteria | 2643221677 | 2644431435 | 271 |
| 360 | iso_pu_bacteria | 2852635781 | 2852641925 | 271 |
| 361 | iso_pu_bacteria | 2918501144 | 2918503972 | 271 |
| 362 | 3300005327 | Ga0070658_10019015 | Ga0070658_100190152 | 272 |
| 363 | 3300005334 | Ga0068869_100087313 | Ga0068869_1000873133 | 272 |
| 364 | 3300005335 | Ga0070666_10014615 | Ga0070666_100146153 | 272 |
| 365 | 3300005344 | Ga0070661_100070230 | Ga0070661_1000702302 | 272 |
| 366 | 3300005457 | Ga0070662_100098265 | Ga0070662_1000982653 | 272 |
| 367 | 3300005530 | Ga0070679_100181044 | Ga0070679_1001810442 | 272 |
| 368 | 3300005564 | Ga0070664_100117185 | Ga0070664_1001171852 | 272 |
| 369 | 3300005577 | Ga0068857_100147745 | Ga0068857_1001477451 | 272 |
| 370 | 3300005617 | Ga0068859_100094899 | Ga0068859_1000948992 | 272 |
| 371 | 3300005618 | Ga0068864_100029974 | Ga0068864_1000299743 | 272 |
| 372 | 3300005841 | Ga0068863_100000329 | Ga0068863_10000032934 | 272 |
| 373 | 3300005843 | Ga0068860_100001239 | Ga0068860_10000123913 | 272 |
| 374 | 3300005843 | Ga0068860_100167261 | Ga0068860_1001672613 | 272 |
| 375 | 3300006881 | Ga0068865_100112234 | Ga0068865_1001122342 | 272 |
| 376 | 3300006931 | Ga0097620_100094904 | Ga0097620_1000949042 | 272 |
| 377 | 3300010375 | Ga0105239_10009775 | Ga0105239_100097754 | 272 |
| 378 | 3300010375 | Ga0105239_10390480 | Ga0105239_103904802 | 272 |
| 379 | 3300013307 | Ga0157372_10002133 | Ga0157372_100021335 | 272 |
| 380 | 3300014325 | Ga0163163_10000589 | Ga0163163_1000058933 | 272 |
| 381 | 3300014325 | Ga0163163_10000949 | Ga0163163_100009494 | 272 |
| 382 | 3300014968 | Ga0157379_10004509 | Ga0157379_100045095 | 272 |
| 383 | 3300025903 | Ga0207680_10000055 | Ga0207680_1000005522 | 272 |
| 384 | 3300025903 | Ga0207680_10135284 | Ga0207680_101352842 | 272 |
| 385 | 3300025904 | Ga0207647_10001611 | Ga0207647_1000161110 | 272 |
| 386 | 3300025913 | Ga0207695_10000295 | Ga0207695_1000029552 | 272 |
| 387 | 3300025914 | Ga0207671_10007226 | Ga0207671_100072264 | 272 |
| 388 | 3300025914 | Ga0207671_10152670 | Ga0207671_101526702 | 272 |
| 389 | 3300025917 | Ga0207660_10296679 | Ga0207660_102966792 | 272 |
| 390 | 3300025920 | Ga0207649_10001154 | Ga0207649_100011543 | 272 |
| 391 | 3300025920 | Ga0207649_10151701 | Ga0207649_101517012 | 272 |
| 392 | 3300025921 | Ga0207652_10095039 | Ga0207652_100950393 | 272 |
| 393 | 3300025924 | Ga0207694_10116323 | Ga0207694_101163232 | 272 |
| 394 | 3300025933 | Ga0207706_10033851 | Ga0207706_100338515 | 272 |
| 395 | 3300025942 | Ga0207689_10077006 | Ga0207689_100770065 | 272 |
| 396 | 3300025949 | Ga0207667_10005003 | Ga0207667_1000500315 | 272 |
| 397 | 3300026088 | Ga0207641_10028963 | Ga0207641_100289634 | 272 |
| 398 | 3300026116 | Ga0207674_10001063 | Ga0207674_1000106332 | 272 |
| 399 | 3300047472 | Ga0495686_0029248 | Ga0495686_0029248_150_1016 | 272 |
| 400 | iso_pu_bacteria | 2554235005 | 2554258429 | 272 |
| 401 | iso_pu_bacteria | 2616644814 | 2616697655 | 272 |
| 402 | iso_pu_bacteria | 2802429296 | 2804845014 | 272 |
| 403 | iso_pu_bacteria | 2808606982 | 2811848410 | 272 |
| 404 | iso_pu_bacteria | 2862290372 | 2862295710 | 272 |
| 405 | iso_pu_bacteria | 2862382967 | 2862387578 | 272 |
| 406 | iso_pu_bacteria | 2912757875 | 2912760079 | 272 |
| 407 | iso_pu_bacteria | 8008558824 | 8008559752 | 272 |
| 408 | iso_pu_bacteria | 8025413630 | 8025418975 | 272 |
| 409 | 3300009092 | Ga0105250_10019755 | Ga0105250_100197552 | 273 |
| 410 | 3300009177 | Ga0105248_10628547 | Ga0105248_106285471 | 273 |
| 411 | 3300030521 | Ga0307511_10000477 | Ga0307511_1000047724 | 273 |
| 412 | 3300030522 | Ga0307512_10030676 | Ga0307512_100306763 | 273 |
| 413 | 3300031456 | Ga0307513_10057319 | Ga0307513_100573194 | 273 |
| 414 | 3300031507 | Ga0307509_10009963 | Ga0307509_100099635 | 273 |
| 415 | 3300031507 | Ga0307509_10096821 | Ga0307509_100968213 | 273 |
| 416 | 3300031730 | Ga0307516_10034989 | Ga0307516_100349894 | 273 |
| 417 | 3300037466 | Ga0395898_0035553 | Ga0395898_0035553_1825_2688 | 273 |
| 418 | 3300046452 | Ga0495617_011356 | Ga0495617_011356_847_1719 | 273 |
| 419 | 3300046455 | Ga0495603_0040823 | Ga0495603_0040823_314_1186 | 273 |
| 420 | 3300046459 | Ga0495629_0009617 | Ga0495629_0009617_1004_1879 | 273 |
| 421 | 3300046459 | Ga0495629_0042604 | Ga0495629_0042604_1552_2424 | 273 |
| 422 | 3300046459 | Ga0495629_0088166 | Ga0495629_0088166_1253_2125 | 273 |
| 423 | 3300046460 | Ga0495638_0056895 | Ga0495638_0056895_108_980 | 273 |
| 424 | 3300046462 | Ga0495651_0055301 | Ga0495651_0055301_1589_2461 | 273 |
| 425 | 3300046472 | Ga0495580_0226943 | Ga0495580_0226943_192_1064 | 273 |
| 426 | 3300046473 | Ga0495582_0060789 | Ga0495582_0060789_608_1480 | 273 |
| 427 | 3300046474 | Ga0495605_0010454 | Ga0495605_0010454_4275_5147 | 273 |
| 428 | 3300046492 | Ga0495585_0003711 | Ga0495585_0003711_6039_6923 | 273 |
| 429 | 3300046492 | Ga0495585_0101034 | Ga0495585_0101034_222_1094 | 273 |
| 430 | 3300046499 | Ga0495594_0020165 | Ga0495594_0020165_2174_3046 | 273 |
| 431 | 3300046500 | Ga0495596_0042641 | Ga0495596_0042641_872_1744 | 273 |
| 432 | 3300046501 | Ga0495607_0034738 | Ga0495607_0034738_1570_2442 | 273 |
| 433 | 3300046507 | Ga0495606_0065930 | Ga0495606_0065930_566_1438 | 273 |
| 434 | 3300046513 | Ga0495616_0049594 | Ga0495616_0049594_22_894 | 273 |
| 435 | 3300046514 | Ga0495618_0079366 | Ga0495618_0079366_219_1091 | 273 |
| 436 | 3300046514 | Ga0495618_0236669 | Ga0495618_0236669_74_946 | 273 |
| 437 | 3300046515 | Ga0495620_0023355 | Ga0495620_0023355_1919_2791 | 273 |
| 438 | 3300046515 | Ga0495620_0080750 | Ga0495620_0080750_318_1190 | 273 |
| 439 | 3300046515 | Ga0495620_0097889 | Ga0495620_0097889_132_1004 | 273 |
| 440 | 3300046518 | Ga0495631_0004707 | Ga0495631_0004707_4928_5800 | 273 |
| 441 | 3300046522 | Ga0495643_0006842 | Ga0495643_0006842_1387_2259 | 273 |
| 442 | 3300046528 | Ga0495642_0128126 | Ga0495642_0128126_26_898 | 273 |
| 443 | 3300046529 | Ga0495652_0062020 | Ga0495652_0062020_482_1354 | 273 |
| 444 | 3300046530 | Ga0495654_0044614 | Ga0495654_0044614_111_983 | 273 |
| 445 | 3300046533 | Ga0495640_0003870 | Ga0495640_0003870_10668_11540 | 273 |
| 446 | 3300046533 | Ga0495640_0030392 | Ga0495640_0030392_2168_3052 | 273 |
| 447 | 3300046538 | Ga0495609_0021000 | Ga0495609_0021000_1764_2636 | 273 |
| 448 | 3300046542 | Ga0495597_0026120 | Ga0495597_0026120_225_1097 | 273 |
| 449 | 3300046558 | Ga0495633_0020737 | Ga0495633_0020737_1219_2091 | 273 |
| 450 | 3300046559 | Ga0495667_0138279 | Ga0495667_0138279_273_1145 | 273 |
| 451 | 3300046616 | Ga0495668_0032366 | Ga0495668_0032366_861_1733 | 273 |
| 452 | 3300046663 | Ga0495635_0046803 | Ga0495635_0046803_1908_2780 | 273 |
| 453 | 3300046663 | Ga0495635_0102549 | Ga0495635_0102549_153_1025 | 273 |
| 454 | 3300046665 | Ga0495661_0032971 | Ga0495661_0032971_2264_3136 | 273 |
| 455 | 3300046674 | Ga0495588_0008854 | Ga0495588_0008854_890_1762 | 273 |
| 456 | 3300046675 | Ga0495657_0028974 | Ga0495657_0028974_1865_2737 | 273 |
| 457 | 3300046675 | Ga0495657_0035922 | Ga0495657_0035922_39_911 | 273 |
| 458 | 3300046679 | Ga0495623_0097418 | Ga0495623_0097418_888_1760 | 273 |
| 459 | 3300046689 | Ga0495613_0020348 | Ga0495613_0020348_1423_2295 | 273 |
| 460 | 3300046689 | Ga0495613_0042223 | Ga0495613_0042223_114_986 | 273 |
| 461 | 3300046689 | Ga0495613_0161908 | Ga0495613_0161908_383_1255 | 273 |
| 462 | 3300046691 | Ga0495670_0030384 | Ga0495670_0030384_914_1786 | 273 |
| 463 | 3300046794 | Ga0495589_0029656 | Ga0495589_0029656_1459_2331 | 273 |
| 464 | 3300046794 | Ga0495589_0041542 | Ga0495589_0041542_437_1309 | 273 |
| 465 | 3300046809 | Ga0495600_0194664 | Ga0495600_0194664_129_1001 | 273 |
| 466 | 3300047315 | Ga0495581_0028479 | Ga0495581_0028479_1986_2858 | 273 |
| 467 | 3300047318 | Ga0495636_0001203 | Ga0495636_0001203_853_1725 | 273 |
| 468 | 3300047321 | Ga0495676_0034152 | Ga0495676_0034152_147_1019 | 273 |
| 469 | 3300047321 | Ga0495676_0232604 | Ga0495676_0232604_226_1098 | 273 |
| 470 | 3300047322 | Ga0495680_0017759 | Ga0495680_0017759_2087_2959 | 273 |
| 471 | 3300047443 | Ga0495687_002438 | Ga0495687_002438_9203_10075 | 273 |
| 472 | 3300047444 | Ga0495675_0035650 | Ga0495675_0035650_1086_1958 | 273 |
| 473 | 3300047445 | Ga0495677_0017529 | Ga0495677_0017529_948_1820 | 273 |
| 474 | 3300047447 | Ga0495685_009879 | Ga0495685_009879_1581_2453 | 273 |
| 475 | 3300047447 | Ga0495685_022960 | Ga0495685_022960_346_1218 | 273 |
| 476 | 3300047470 | Ga0495681_0045704 | Ga0495681_0045704_43_915 | 273 |
| 477 | 3300047472 | Ga0495686_0063265 | Ga0495686_0063265_28_900 | 273 |
| 478 | 3300047673 | Ga0495593_0046554 | Ga0495593_0046554_1048_1920 | 273 |
| 479 | 3300048089 | Ga0495614_0121132 | Ga0495614_0121132_241_1113 | 273 |
| 480 | 3300048091 | Ga0495626_0029348 | Ga0495626_0029348_222_1094 | 273 |
| 481 | 3300048908 | Ga0496105_0394712 | Ga0496105_0394712_53_925 | 273 |
| 482 | 3300048912 | Ga0496109_0122879 | Ga0496109_0122879_1233_2105 | 273 |
| 483 | 3300049460 | Ga0495682_0076005 | Ga0495682_0076005_284_1156 | 273 |
| 484 | 3300049568 | Ga0501031_0001472 | Ga0501031_0001472_5443_6327 | 273 |
| 485 | 3300049568 | Ga0501031_0033244 | Ga0501031_0033244_23_907 | 273 |
| 486 | 3300049569 | Ga0501032_0002016 | Ga0501032_0002016_8062_8946 | 273 |
| 487 | 3300049570 | Ga0501033_0012763 | Ga0501033_0012763_1475_2359 | 273 |
| 488 | 3300049570 | Ga0501033_0178378 | Ga0501033_0178378_73_957 | 273 |
| 489 | 3300049571 | Ga0501034_0034478 | Ga0501034_0034478_3358_4344 | 273 |
| 490 | 3300049571 | Ga0501034_0082912 | Ga0501034_0082912_131_1015 | 273 |
| 491 | 3300049572 | Ga0501036_0007472 | Ga0501036_0007472_683_1567 | 273 |
| 492 | 3300049572 | Ga0501036_0090603 | Ga0501036_0090603_658_1644 | 273 |
| 493 | 3300049572 | Ga0501036_0174624 | Ga0501036_0174624_818_1702 | 273 |
| 494 | 3300049573 | Ga0501037_0002239 | Ga0501037_0002239_7810_8694 | 273 |
| 495 | 3300049573 | Ga0501037_0042415 | Ga0501037_0042415_606_1490 | 273 |
| 496 | 3300049574 | Ga0501038_0008550 | Ga0501038_0008550_2967_3851 | 273 |
| 497 | 3300049574 | Ga0501038_0114160 | Ga0501038_0114160_1024_1908 | 273 |
| 498 | 3300049574 | Ga0501038_0232561 | Ga0501038_0232561_206_1192 | 273 |
| 499 | 3300049575 | Ga0501039_0174850 | Ga0501039_0174850_122_1006 | 273 |
| 500 | 3300049576 | Ga0501040_0372919 | Ga0501040_0372919_96_980 | 273 |
| 501 | 3300049578 | Ga0501042_0056635 | Ga0501042_0056635_850_1734 | 273 |
| 502 | 3300049578 | Ga0501042_0218824 | Ga0501042_0218824_96_980 | 273 |
| 503 | 3300049579 | Ga0501043_0002408 | Ga0501043_0002408_8674_9558 | 273 |
| 504 | 3300049580 | Ga0501046_0143622 | Ga0501046_0143622_448_1323 | 273 |
| 505 | 3300049581 | Ga0501047_0000025 | Ga0501047_0000025_164302_165186 | 273 |
| 506 | 3300049581 | Ga0501047_0000921 | Ga0501047_0000921_6255_7139 | 273 |
| 507 | 3300049581 | Ga0501047_0027128 | Ga0501047_0027128_2370_3356 | 273 |
| 508 | 3300049582 | Ga0501048_0004083 | Ga0501048_0004083_5903_6787 | 273 |
| 509 | 3300049583 | Ga0501067_0114250 | Ga0501067_0114250_394_1278 | 273 |
| 510 | 3300049584 | Ga0501068_0001130 | Ga0501068_0001130_8001_8885 | 273 |
| 511 | 3300049586 | Ga0501070_0033496 | Ga0501070_0033496_2069_2953 | 273 |
| 512 | 3300049586 | Ga0501070_0099189 | Ga0501070_0099189_134_1018 | 273 |
| 513 | 3300049587 | Ga0501071_0001198 | Ga0501071_0001198_10217_11101 | 273 |
| 514 | 3300049588 | Ga0501072_0000344 | Ga0501072_0000344_13500_14384 | 273 |
| 515 | 3300049592 | Ga0501076_0010690 | Ga0501076_0010690_2199_3083 | 273 |
| 516 | 3300049741 | Ga0501079_0016506 | Ga0501079_0016506_422_1306 | 273 |
| 517 | 3300049744 | Ga0501083_0019150 | Ga0501083_0019150_683_1567 | 273 |
| 518 | 3300049822 | Ga0501035_0021995 | Ga0501035_0021995_4600_5586 | 273 |
| 519 | 3300049822 | Ga0501035_0137183 | Ga0501035_0137183_755_1639 | 273 |
| 520 | 3300049823 | Ga0501044_0004946 | Ga0501044_0004946_6256_7140 | 273 |
| 521 | 3300049823 | Ga0501044_0117543 | Ga0501044_0117543_346_1230 | 273 |
| 522 | 3300049823 | Ga0501044_0584006 | Ga0501044_0584006_88_972 | 273 |
| 523 | 3300061734 | Ga0530510_0013267 | Ga0530510_0013267_4784_5668 | 273 |
| 524 | iso_pu_bacteria | 2582581313 | 2585309251 | 273 |
| 525 | iso_pu_bacteria | 2582581314 | 2585319767 | 273 |
| 526 | iso_pu_bacteria | 2616644941 | 2616905957 | 273 |
| 527 | iso_pu_bacteria | 2643221548 | 2643765264 | 273 |
| 528 | iso_pu_bacteria | 2643221578 | 2643898060 | 273 |
| 529 | iso_pu_bacteria | 2643221647 | 2644263263 | 273 |
| 530 | iso_pu_bacteria | 2643221673 | 2644409205 | 273 |
| 531 | iso_pu_bacteria | 2643221682 | 2644462665 | 273 |
| 532 | iso_pu_bacteria | 2784746768 | 2785368796 | 273 |
| 533 | iso_pu_bacteria | 2808606375 | 2808920026 | 273 |
| 534 | iso_pu_bacteria | 2818991463 | 2819693515 | 273 |
| 535 | iso_pu_bacteria | 2862178590 | 2862184749 | 273 |
| 536 | iso_pu_bacteria | 2862574272 | 2862579828 | 273 |
| 537 | iso_pu_bacteria | 2862705112 | 2862710178 | 273 |
| 538 | iso_pu_bacteria | 2867346516 | 2867349303 | 273 |
| 539 | iso_pu_bacteria | 2875391855 | 2875393959 | 273 |
| 540 | iso_pu_bacteria | 2877676314 | 2877681716 | 273 |
| 541 | iso_pu_bacteria | 2912723979 | 2912724848 | 273 |
| 542 | iso_pu_bacteria | 2946045630 | 2946050673 | 273 |
| 543 | iso_pu_bacteria | 2954380949 | 2954386866 | 273 |
| 544 | iso_pu_bacteria | 2954691527 | 2954697684 | 273 |
| 545 | iso_pu_bacteria | 2954701450 | 2954704532 | 273 |
| 546 | iso_pu_bacteria | 2966598605 | 2966603127 | 273 |
| 547 | iso_pu_bacteria | 3006321560 | 3006321738 | 273 |
| 548 | iso_pu_bacteria | 3006393351 | 3006397802 | 273 |
| 549 | iso_pu_bacteria | 3006493962 | 3006496323 | 273 |
| 550 | iso_pu_bacteria | 8008485437 | 8008487894 | 273 |
| 551 | iso_pu_bacteria | 8025524527 | 8025526587 | 273 |
| 552 | iso_pu_bacteria | 8025530807 | 8025533266 | 273 |
| 553 | iso_pu_bacteria | 8056447290 | 8056451458 | 273 |
| 554 | iso_pu_bacteria | 8056667051 | 8056672405 | 273 |
| 555 | 3300005539 | Ga0068853_100134802 | Ga0068853_1001348022 | 274 |
| 556 | 3300006178 | Ga0075367_10013040 | Ga0075367_100130403 | 274 |
| 557 | 3300025297 | Ga0209758_1006832 | Ga0209758_10068324 | 274 |
| 558 | 3300026041 | Ga0207639_10057543 | Ga0207639_100575433 | 274 |
| 559 | 3300030522 | Ga0307512_10004449 | Ga0307512_100044494 | 274 |
| 560 | 3300031616 | Ga0307508_10004731 | Ga0307508_100047314 | 274 |
| 561 | 3300031616 | Ga0307508_10140605 | Ga0307508_101406052 | 274 |
| 562 | 3300031649 | Ga0307514_10024583 | Ga0307514_100245832 | 274 |
| 563 | 3300031730 | Ga0307516_10024509 | Ga0307516_100245095 | 274 |
| 564 | 3300033179 | Ga0307507_10099678 | Ga0307507_100996782 | 274 |
| 565 | 3300033179 | Ga0307507_10179740 | Ga0307507_101797402 | 274 |
| 566 | 3300042007 | Ga0439449_0079815 | Ga0439449_0079815_155_1030 | 274 |
| 567 | 3300044658 | Ga0466972_0009968 | Ga0466972_0009968_63_938 | 274 |
| 568 | 3300044693 | Ga0466961_0065796 | Ga0466961_0065796_1002_1877 | 274 |
| 569 | 3300045049 | Ga0466959_0178054 | Ga0466959_0178054_423_1298 | 274 |
| 570 | 3300045976 | Ga0466967_0098312 | Ga0466967_0098312_1672_2538 | 274 |
| 571 | 3300045976 | Ga0466967_0329022 | Ga0466967_0329022_16_882 | 274 |
| 572 | 3300046455 | Ga0495603_0008979 | Ga0495603_0008979_2713_3594 | 274 |
| 573 | 3300046459 | Ga0495629_0005181 | Ga0495629_0005181_406_1281 | 274 |
| 574 | 3300046474 | Ga0495605_0080485 | Ga0495605_0080485_197_1078 | 274 |
| 575 | 3300046501 | Ga0495607_0157468 | Ga0495607_0157468_31_915 | 274 |
| 576 | 3300046518 | Ga0495631_0076484 | Ga0495631_0076484_86_967 | 274 |
| 577 | 3300046526 | Ga0495666_0057086 | Ga0495666_0057086_163_1044 | 274 |
| 578 | 3300046557 | Ga0495622_0010612 | Ga0495622_0010612_1001_1876 | 274 |
| 579 | 3300046674 | Ga0495588_0227710 | Ga0495588_0227710_73_954 | 274 |
| 580 | 3300046689 | Ga0495613_0001088 | Ga0495613_0001088_15461_16375 | 274 |
| 581 | 3300046690 | Ga0495624_0154461 | Ga0495624_0154461_307_1191 | 274 |
| 582 | 3300046691 | Ga0495670_0004047 | Ga0495670_0004047_3200_4084 | 274 |
| 583 | 3300046691 | Ga0495670_0142498 | Ga0495670_0142498_163_1044 | 274 |
| 584 | 3300046692 | Ga0495671_0081712 | Ga0495671_0081712_172_1056 | 274 |
| 585 | 3300046794 | Ga0495589_0015789 | Ga0495589_0015789_2746_3627 | 274 |
| 586 | 3300046794 | Ga0495589_0055002 | Ga0495589_0055002_255_1136 | 274 |
| 587 | 3300046794 | Ga0495589_0061613 | Ga0495589_0061613_75_959 | 274 |
| 588 | 3300047443 | Ga0495687_111154 | Ga0495687_111154_81_965 | 274 |
| 589 | 3300047446 | Ga0495679_026603 | Ga0495679_026603_926_1810 | 274 |
| 590 | 3300047447 | Ga0495685_007903 | Ga0495685_007903_66_950 | 274 |
| 591 | 3300047447 | Ga0495685_038735 | Ga0495685_038735_295_1176 | 274 |
| 592 | 3300047470 | Ga0495681_0001091 | Ga0495681_0001091_19701_20585 | 274 |
| 593 | 3300048089 | Ga0495614_0002730 | Ga0495614_0002730_188_1102 | 274 |
| 594 | 3300049569 | Ga0501032_0005106 | Ga0501032_0005106_2687_3598 | 274 |
| 595 | 3300049569 | Ga0501032_0010731 | Ga0501032_0010731_455_1366 | 274 |
| 596 | 3300049570 | Ga0501033_0268821 | Ga0501033_0268821_13_924 | 274 |
| 597 | 3300049572 | Ga0501036_0177680 | Ga0501036_0177680_43_954 | 274 |
| 598 | 3300049573 | Ga0501037_0018704 | Ga0501037_0018704_3049_3960 | 274 |
| 599 | 3300049574 | Ga0501038_0221943 | Ga0501038_0221943_287_1198 | 274 |
| 600 | 3300049575 | Ga0501039_0024561 | Ga0501039_0024561_690_1601 | 274 |
| 601 | 3300049579 | Ga0501043_0081655 | Ga0501043_0081655_1348_2259 | 274 |
| 602 | 3300049581 | Ga0501047_0054939 | Ga0501047_0054939_1451_2362 | 274 |
| 603 | 3300049593 | Ga0501077_0033415 | Ga0501077_0033415_179_1054 | 274 |
| 604 | 3300049822 | Ga0501035_0005555 | Ga0501035_0005555_3064_3975 | 274 |
| 605 | 3300049822 | Ga0501035_0019226 | Ga0501035_0019226_5068_5979 | 274 |
| 606 | 3300049823 | Ga0501044_0041906 | Ga0501044_0041906_310_1221 | 274 |
| 607 | 3300049823 | Ga0501044_0235589 | Ga0501044_0235589_876_1742 | 274 |
| 608 | 3300049823 | Ga0501044_0310807 | Ga0501044_0310807_262_1128 | 274 |
| 609 | 3300050494 | nmdc:mga06z11_9505_c1 | nmdc:mga06z11_9505_c1_1378_2253 | 274 |
| 610 | 3300053086 | Ga0500578_0031319 | Ga0500578_0031319_2380_3264 | 274 |
| 611 | 3300053099 | Ga0500654_034732 | Ga0500654_034732_72_956 | 274 |
| 612 | 3300053107 | Ga0500560_023076 | Ga0500560_023076_20_904 | 274 |
| 613 | 3300053109 | Ga0500569_016937 | Ga0500569_016937_455_1339 | 274 |
| 614 | 3300053123 | Ga0500614_025713 | Ga0500614_025713_68_952 | 274 |
| 615 | 3300053131 | Ga0500652_003553 | Ga0500652_003553_1056_2099 | 274 |
| 616 | 3300053134 | Ga0500658_0004751 | Ga0500658_0004751_1341_2225 | 274 |
| 617 | 3300053137 | Ga0500561_0000736 | Ga0500561_0000736_4281_5165 | 274 |
| 618 | 3300053149 | Ga0500600_0136894 | Ga0500600_0136894_153_1037 | 274 |
| 619 | 3300053158 | Ga0500627_0150266 | Ga0500627_0150266_34_918 | 274 |
| 620 | 3300053177 | Ga0500636_0165813 | Ga0500636_0165813_40_924 | 274 |
| 621 | 3300053732 | Ga0500656_005217 | Ga0500656_005217_44_928 | 274 |
| 622 | iso_pu_bacteria | 2862281513 | 2862287920 | 274 |
| 623 | iso_pu_bacteria | 2862507626 | 2862511542 | 274 |
| 624 | iso_pu_bacteria | 2863404153 | 2863405321 | 274 |
| 625 | iso_pu_bacteria | 2867475112 | 2867475337 | 274 |
| 626 | iso_pu_bacteria | 2935390628 | 2935394617 | 274 |
| 627 | iso_pu_bacteria | 2990044586 | 2990048558 | 274 |
| 628 | iso_pu_bacteria | 2997451912 | 2997456688 | 274 |
| 629 | iso_pu_bacteria | 2997600082 | 2997608020 | 274 |
| 630 | iso_pu_bacteria | 3006425503 | 3006426790 | 274 |
| 631 | iso_pu_bacteria | 3006486233 | 3006489932 | 274 |
| 632 | iso_pu_bacteria | 8033684223 | 8033690422 | 274 |
| 633 | iso_pu_bacteria | 8048406513 | 8048413329 | 274 |
| 634 | iso_pu_bacteria | 8056829672 | 8056830229 | 274 |
| 635 | 3300003322 | rootL2_10041909 | rootL2_100419092 | 275 |
| 636 | 3300003578 | Ga0006562J51391_1012167 | Ga0006562J51391_10121672 | 275 |
| 637 | 3300003578 | Ga0006562J51391_1012168 | Ga0006562J51391_10121682 | 275 |
| 638 | 3300014497 | Ga0182008_10021356 | Ga0182008_100213565 | 275 |
| 639 | 3300015262 | Ga0182007_10000885 | Ga0182007_1000088511 | 275 |
| 640 | 3300015688 | Ga0183367_1006 | Ga0183367_1006274 | 275 |
| 641 | 3300025302 | Ga0207426_1000981 | Ga0207426_100098120 | 275 |
| 642 | 3300031616 | Ga0307508_10002336 | Ga0307508_100023362 | 275 |
| 643 | 3300031649 | Ga0307514_10010004 | Ga0307514_100100047 | 275 |
| 644 | 3300031730 | Ga0307516_10016228 | Ga0307516_100162282 | 275 |
| 645 | 3300033180 | Ga0307510_10020300 | Ga0307510_100203002 | 275 |
| 646 | 3300037466 | Ga0395898_0004973 | Ga0395898_0004973_448_1326 | 275 |
| 647 | 3300038443 | Ga0395901_0578250 | Ga0395901_0578250_75_953 | 275 |
| 648 | 3300041512 | Ga0451853_1117734 | Ga0451853_1117734_223_1122 | 275 |
| 649 | 3300041512 | Ga0451853_1420060 | Ga0451853_1420060_598_1470 | 275 |
| 650 | 3300042005 | Ga0439448_0026804 | Ga0439448_0026804_832_1704 | 275 |
| 651 | 3300042012 | Ga0439455_0013856 | Ga0439455_0013856_208_1080 | 275 |
| 652 | 3300042138 | Ga0450903_000044 | Ga0450903_000044_8823_9695 | 275 |
| 653 | 3300046454 | Ga0495592_0034890 | Ga0495592_0034890_1302_2255 | 275 |
| 654 | 3300046455 | Ga0495603_0027757 | Ga0495603_0027757_165_1049 | 275 |
| 655 | 3300046459 | Ga0495629_0008226 | Ga0495629_0008226_4056_5009 | 275 |
| 656 | 3300046459 | Ga0495629_0093414 | Ga0495629_0093414_232_1116 | 275 |
| 657 | 3300046462 | Ga0495651_0051428 | Ga0495651_0051428_24_977 | 275 |
| 658 | 3300046499 | Ga0495594_0083629 | Ga0495594_0083629_302_1255 | 275 |
| 659 | 3300046514 | Ga0495618_0247349 | Ga0495618_0247349_106_1059 | 275 |
| 660 | 3300046516 | Ga0495628_0087105 | Ga0495628_0087105_890_1843 | 275 |
| 661 | 3300046529 | Ga0495652_0005221 | Ga0495652_0005221_10356_11309 | 275 |
| 662 | 3300046533 | Ga0495640_0001063 | Ga0495640_0001063_3770_4723 | 275 |
| 663 | 3300046642 | Ga0495634_0036275 | Ga0495634_0036275_1117_2070 | 275 |
| 664 | 3300046674 | Ga0495588_0040166 | Ga0495588_0040166_1264_2148 | 275 |
| 665 | 3300046675 | Ga0495657_0002793 | Ga0495657_0002793_5507_6460 | 275 |
| 666 | 3300046689 | Ga0495613_0012265 | Ga0495613_0012265_3596_4549 | 275 |
| 667 | 3300046690 | Ga0495624_0030537 | Ga0495624_0030537_491_1444 | 275 |
| 668 | 3300046809 | Ga0495600_0001432 | Ga0495600_0001432_6844_7797 | 275 |
| 669 | 3300047317 | Ga0495604_0003476 | Ga0495604_0003476_5479_6432 | 275 |
| 670 | 3300047321 | Ga0495676_0016662 | Ga0495676_0016662_2551_3504 | 275 |
| 671 | 3300049570 | Ga0501033_0001270 | Ga0501033_0001270_13905_14774 | 275 |
| 672 | 3300049823 | Ga0501044_0057150 | Ga0501044_0057150_2128_3030 | 275 |
| 673 | iso_pu_bacteria | 2547132111 | 2547406991 | 275 |
| 674 | iso_pu_bacteria | 2643221678 | 2644436568 | 275 |
| 675 | iso_pu_bacteria | 2643221714 | 2644625596 | 275 |
| 676 | iso_pu_bacteria | 2767802112 | 2768646947 | 275 |
| 677 | iso_pu_bacteria | 2784132148 | 2784588025 | 275 |
| 678 | iso_pu_bacteria | 2786546132 | 2786669894 | 275 |
| 679 | iso_pu_bacteria | 2791355406 | 2793981854 | 275 |
| 680 | iso_pu_bacteria | 2808606359 | 2808841461 | 275 |
| 681 | iso_pu_bacteria | 2808606448 | 2809231625 | 275 |
| 682 | iso_pu_bacteria | 2811994917 | 2812481084 | 275 |
| 683 | iso_pu_bacteria | 2867428634 | 2867431712 | 275 |
| 684 | iso_pu_bacteria | 2912715099 | 2912720682 | 275 |
| 685 | iso_pu_bacteria | 2919468124 | 2919473534 | 275 |
| 686 | iso_pu_bacteria | 2946064051 | 2946067086 | 275 |
| 687 | iso_pu_bacteria | 2946072368 | 2946075382 | 275 |
| 688 | iso_pu_bacteria | 2947224130 | 2947230158 | 275 |
| 689 | iso_pu_bacteria | 2954002825 | 2954003356 | 275 |
| 690 | iso_pu_bacteria | 2954673503 | 2954676323 | 275 |
| 691 | iso_pu_bacteria | 2954682443 | 2954687845 | 275 |
| 692 | iso_pu_bacteria | 2954711539 | 2954716819 | 275 |
| 693 | iso_pu_bacteria | 2954721474 | 2954726767 | 275 |
| 694 | iso_pu_bacteria | 2954731030 | 2954735029 | 275 |
| 695 | iso_pu_bacteria | 2954749733 | 2954753900 | 275 |
| 696 | iso_pu_bacteria | 2954759201 | 2954764663 | 275 |
| 697 | iso_pu_bacteria | 2990088156 | 2990093567 | 275 |
| 698 | iso_pu_bacteria | 8008574985 | 8008579392 | 275 |
| 699 | iso_pu_bacteria | 8023623736 | 8023631031 | 275 |
| 700 | iso_pu_bacteria | 8025478263 | 8025482627 | 275 |
| 701 | iso_pu_bacteria | 8047893842 | 8047898714 | 275 |
| 702 | iso_pu_bacteria | 8048127548 | 8048131512 | 275 |
| 703 | iso_pu_bacteria | 8048356638 | 8048360205 | 275 |
| 704 | iso_pu_bacteria | 8048369669 | 8048375676 | 275 |
| 705 | iso_pu_bacteria | 8048379754 | 8048382529 | 275 |
| 706 | iso_pu_bacteria | 8054160619 | 8054162871 | 275 |
| 707 | 3300003316 | rootH1_10045223 | rootH1_100452232 | 276 |
| 708 | 3300003323 | rootH1_10025603 | rootH1_100256032 | 276 |
| 709 | 3300025302 | Ga0207426_1003579 | Ga0207426_10035793 | 276 |
| 710 | 3300028794 | Ga0307515_10000541 | Ga0307515_1000054168 | 276 |
| 711 | 3300030521 | Ga0307511_10155622 | Ga0307511_101556222 | 276 |
| 712 | 3300031616 | Ga0307508_10365789 | Ga0307508_103657891 | 276 |
| 713 | 3300031649 | Ga0307514_10234409 | Ga0307514_102344092 | 276 |
| 714 | 3300033179 | Ga0307507_10007895 | Ga0307507_100078952 | 276 |
| 715 | 3300033180 | Ga0307510_10142764 | Ga0307510_101427642 | 276 |
| 716 | 3300041509 | Ga0451843_0686416 | Ga0451843_0686416_279_1160 | 276 |
| 717 | 3300044656 | Ga0466969_0012487 | Ga0466969_0012487_3304_4188 | 276 |
| 718 | 3300044658 | Ga0466972_0009323 | Ga0466972_0009323_1650_2549 | 276 |
| 719 | 3300044658 | Ga0466972_0029298 | Ga0466972_0029298_822_1706 | 276 |
| 720 | 3300044683 | Ga0466965_0028690 | Ga0466965_0028690_1667_2551 | 276 |
| 721 | 3300044684 | Ga0466966_0026339 | Ga0466966_0026339_1374_2258 | 276 |
| 722 | 3300044693 | Ga0466961_0009568 | Ga0466961_0009568_1444_2328 | 276 |
| 723 | 3300044693 | Ga0466961_0050467 | Ga0466961_0050467_1526_2425 | 276 |
| 724 | 3300044694 | Ga0466963_0010858 | Ga0466963_0010858_585_1469 | 276 |
| 725 | 3300044694 | Ga0466963_0016533 | Ga0466963_0016533_200_1081 | 276 |
| 726 | 3300044706 | Ga0466964_0004728 | Ga0466964_0004728_3986_4870 | 276 |
| 727 | 3300044719 | Ga0466971_0004505 | Ga0466971_0004505_4332_5216 | 276 |
| 728 | 3300044765 | Ga0466970_0007537 | Ga0466970_0007537_136_1020 | 276 |
| 729 | 3300044765 | Ga0466970_0026797 | Ga0466970_0026797_1601_2482 | 276 |
| 730 | 3300044765 | Ga0466970_0045023 | Ga0466970_0045023_666_1565 | 276 |
| 731 | 3300044842 | Ga0466957_0004601 | Ga0466957_0004601_3447_4331 | 276 |
| 732 | 3300044842 | Ga0466957_0240331 | Ga0466957_0240331_102_983 | 276 |
| 733 | 3300044901 | Ga0466960_0003551 | Ga0466960_0003551_3517_4416 | 276 |
| 734 | 3300045049 | Ga0466959_0016300 | Ga0466959_0016300_807_1691 | 276 |
| 735 | 3300045836 | Ga0466958_0000949 | Ga0466958_0000949_8708_9592 | 276 |
| 736 | 3300046660 | Ga0495625_0010878 | Ga0495625_0010878_2935_3816 | 276 |
| 737 | 3300046674 | Ga0495588_0076053 | Ga0495588_0076053_206_1087 | 276 |
| 738 | 3300047470 | Ga0495681_0003731 | Ga0495681_0003731_9356_10237 | 276 |
| 739 | 3300049568 | Ga0501031_0012912 | Ga0501031_0012912_3938_4819 | 276 |
| 740 | 3300049569 | Ga0501032_0052072 | Ga0501032_0052072_324_1205 | 276 |
| 741 | 3300049570 | Ga0501033_0193746 | Ga0501033_0193746_130_1011 | 276 |
| 742 | 3300049570 | Ga0501033_0199044 | Ga0501033_0199044_298_1179 | 276 |
| 743 | 3300049570 | Ga0501033_0313197 | Ga0501033_0313197_155_1036 | 276 |
| 744 | 3300049571 | Ga0501034_0001007 | Ga0501034_0001007_19904_20776 | 276 |
| 745 | 3300049571 | Ga0501034_0198629 | Ga0501034_0198629_185_1066 | 276 |
| 746 | 3300049571 | Ga0501034_0326153 | Ga0501034_0326153_277_1158 | 276 |
| 747 | 3300049572 | Ga0501036_0002177 | Ga0501036_0002177_12053_12925 | 276 |
| 748 | 3300049572 | Ga0501036_0007043 | Ga0501036_0007043_4981_5862 | 276 |
| 749 | 3300049573 | Ga0501037_0028698 | Ga0501037_0028698_1927_2808 | 276 |
| 750 | 3300049573 | Ga0501037_0269874 | Ga0501037_0269874_38_919 | 276 |
| 751 | 3300049574 | Ga0501038_0010421 | Ga0501038_0010421_247_1119 | 276 |
| 752 | 3300049575 | Ga0501039_0340689 | Ga0501039_0340689_108_989 | 276 |
| 753 | 3300049578 | Ga0501042_0047649 | Ga0501042_0047649_1571_2452 | 276 |
| 754 | 3300049579 | Ga0501043_0099574 | Ga0501043_0099574_161_1042 | 276 |
| 755 | 3300049579 | Ga0501043_0147748 | Ga0501043_0147748_747_1628 | 276 |
| 756 | 3300049580 | Ga0501046_0102405 | Ga0501046_0102405_40_921 | 276 |
| 757 | 3300049581 | Ga0501047_0011628 | Ga0501047_0011628_2580_3452 | 276 |
| 758 | 3300049581 | Ga0501047_0109683 | Ga0501047_0109683_1418_2299 | 276 |
| 759 | 3300049581 | Ga0501047_0119606 | Ga0501047_0119606_37_918 | 276 |
| 760 | 3300049581 | Ga0501047_0157822 | Ga0501047_0157822_601_1482 | 276 |
| 761 | 3300049582 | Ga0501048_0122813 | Ga0501048_0122813_271_1152 | 276 |
| 762 | 3300049584 | Ga0501068_0068044 | Ga0501068_0068044_1052_1924 | 276 |
| 763 | 3300049586 | Ga0501070_0001453 | Ga0501070_0001453_19228_20100 | 276 |
| 764 | 3300049590 | Ga0501074_0000798 | Ga0501074_0000798_16570_17442 | 276 |
| 765 | 3300049822 | Ga0501035_0003677 | Ga0501035_0003677_11189_12061 | 276 |
| 766 | 3300049822 | Ga0501035_0062275 | Ga0501035_0062275_1086_1964 | 276 |
| 767 | 3300049822 | Ga0501035_0154379 | Ga0501035_0154379_833_1714 | 276 |
| 768 | 3300049822 | Ga0501035_0203248 | Ga0501035_0203248_367_1239 | 276 |
| 769 | 3300049822 | Ga0501035_0237957 | Ga0501035_0237957_344_1225 | 276 |
| 770 | 3300049823 | Ga0501044_0167103 | Ga0501044_0167103_344_1225 | 276 |
| 771 | 3300061719 | Ga0466962_0006434 | Ga0466962_0006434_3216_4100 | 276 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4qfw-assembly1.cif.gz_A | crystal structure of acyl-coa thioesterase tesb from yersinia pestis | 0.9658 | 5 | 273 |
| 4r4u-assembly1.cif.gz_A | crystal structure of acyl-coa thioesterase tesb from yersinia pestis in complex with coenzyme a | 0.9607 | 5 | 273 |
| 4r4u-assembly2.cif.gz_C | crystal structure of acyl-coa thioesterase tesb from yersinia pestis in complex with coenzyme a | 0.9582 | 5 | 273 |
| 1tbu-assembly1.cif.gz_D | crystal structure of n-terminal domain of yeast peroxisomal thioesterase-1 | 0.9551 | 21 | 98 |
| 4r9z-assembly1.cif.gz_A | mycobacterium avium subs paratuberculosis tesb protein map1729c | 0.9512 | 7 | 270 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1c8uB02 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9731 | 5 | 102 | 3.10.129.10 |
| 4gwhA00 | Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain | 0.9585 | 5 | 273 | 2.40.160.210 |
| 4r9zA00 | Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain | 0.9512 | 7 | 270 | 2.40.160.210 |
| 1c8uB01 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9498 | 143 | 272 | 3.10.129.10 |
| 1tbuC00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9487 | 7 | 97 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2S1K8-F1-model_v4 | Acyl-CoA thioesterase II | 0.9845 | 211 | 274 |
GO:0005829
GO:0006637 GO:0009062 GO:0047617 |
| AF-A0A1C4QRL6-F1-model_v4 | Acyl-CoA thioesterase-2 | 0.9833 | 81 | 275 |
GO:0006637
GO:0009062 GO:0047617 |
| AF-A0A6G2TZU7-F1-model_v4 | Acyl-CoA thioesterase II | 0.9821 | 6 | 274 |
GO:0006637
GO:0009062 GO:0047617 |
| AF-D8SM83-F1-model_v4 | palmitoyl-CoA hydrolase (EC 3.1.2.2) | 0.9731 | 5 | 114 |
GO:0006637
GO:0009062 GO:0047617 |
| AF-A0A376ZMF1-F1-model_v4 | Acyl-CoA thioesterase (EC 3.1.2.-) | 0.9713 | 168 | 272 |
GO:0005829
GO:0006637 GO:0009062 GO:0047617 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar