F480097

General Info

Members Datasets Scaffolds Average Seq Length
771 416 666 289

Family's Representative Sequence

Representative Sequence 3300053131|Ga0500652_003553|Ga0500652_003553_1056_2099
Length 336
Sequence VTNDALQSLLDLLDLERIEQDIFRGTSLPAIVPRVFGGQVAAQALVAAGRTVPQDRAAHSLHAYFLRTGDPGAPIVYEVDRIRDGRSFTTRRVVAVQHGQPIFHLSASFQAYEDGLDHQEPMPPAPDPETLPSAEELLPAHADKFPDPGVLDRLLESRAAVDLRYVDDPPYLTAGRGPREPRSQVWFRTRGKLADDPLLHVCLATYVSDMTLLDSVLLAHGRGGWAVGDVVGASLDHAMWFHRPFRADEWLLYDQQSPSASGGRGLGTARIYTSDGRLAVSVIQEGVVRVPRSHESLCGAAPGPLLRAAAPVPPRPGDTPSAGRGWSPRPCLRPRR

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2582580736 Prauserella sp. Am3 Isolate Unclassified
4 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
5 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
6 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
7 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
8 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
9 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
10 2643221548 Streptomyces sp. Root55 Isolate Unclassified
11 2643221578 Streptomyces sp. Root63 Isolate Unclassified
12 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
13 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
14 2643221647 Streptomyces sp. Root369 Isolate Unclassified
15 2643221670 Streptomyces sp. Root431 Isolate Unclassified
16 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
17 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
18 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
19 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
20 2643221714 Streptomyces sp. Root264 Isolate Unclassified
21 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
22 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
23 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
24 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
25 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
26 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
27 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
28 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
29 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
30 2808606448 Streptomyces sp. 193411 Isolate Unclassified
31 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
32 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
33 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
34 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
35 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
36 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
37 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
38 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
39 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
40 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
41 2862574272 Streptomyces sp. AcE210 Isolate Nodule
42 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
43 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
44 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
45 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
46 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
47 2867428634 Streptomyces sp. RP5T Isolate Unclassified
48 2867475112 Streptomyces sp. TM32 Isolate Unclassified
49 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
50 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
51 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
52 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
53 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
54 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
55 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
56 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
57 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
58 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
59 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
60 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
61 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
62 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
63 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
64 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
65 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
66 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
67 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
68 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
69 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
70 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
71 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
72 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
73 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
74 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
75 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
76 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
77 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
78 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
79 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
80 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
81 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
82 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
83 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
84 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
85 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
86 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
87 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
88 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
89 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
90 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
91 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
92 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
93 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
94 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
95 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
96 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
97 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
98 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
99 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
100 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
101 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
102 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
103 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
104 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
105 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
106 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
107 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
108 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
109 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
110 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
111 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
112 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
113 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
114 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
115 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
116 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
117 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
118 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
119 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
120 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
121 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
122 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
123 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
124 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
125 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
126 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
127 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
128 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
129 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
130 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
131 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
132 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
133 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
134 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
137 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
138 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
139 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
140 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
143 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
144 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
145 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
146 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
147 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
148 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
149 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
151 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
153 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
156 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
185 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
189 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
190 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
191 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
192 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
193 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
194 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
195 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
196 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
197 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
198 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
199 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
200 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
203 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
204 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
205 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
206 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
207 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
208 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
209 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
210 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
211 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
212 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
213 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
214 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
215 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
216 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
217 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
218 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
219 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
220 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
221 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
224 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
227 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
228 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
229 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
230 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
231 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
232 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
233 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
234 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
235 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
236 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
237 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
238 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
239 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
240 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
241 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
242 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
243 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
244 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
245 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
246 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
247 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
248 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
249 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
250 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
251 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
252 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
253 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
254 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
255 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
256 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
257 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
258 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
259 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
260 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
261 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
262 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
263 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
264 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
265 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
266 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
267 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
268 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
269 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
270 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
271 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
272 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
273 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
274 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
275 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
276 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
277 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
278 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
279 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
280 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
281 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
282 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
283 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
284 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
285 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
286 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
287 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
288 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
289 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
290 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
291 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
292 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
293 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
294 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
295 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
296 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
297 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
298 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
299 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
300 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
301 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
302 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
303 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
304 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
305 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
306 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
307 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
308 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
309 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
310 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
311 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
312 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
313 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
314 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
315 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
316 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
317 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
318 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
319 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
320 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
321 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
322 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
323 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
324 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
325 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
326 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
327 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
328 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
329 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
330 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
331 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
332 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
333 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
334 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
335 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
336 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
337 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
338 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
339 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
340 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
341 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
342 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
343 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
344 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
359 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
360 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
361 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
362 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
363 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
364 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
365 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
366 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
367 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
368 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
369 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
370 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
371 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
374 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
375 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
376 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
377 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
378 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
379 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
380 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
381 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
382 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
383 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
384 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
385 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
386 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
387 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
388 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
389 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
390 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
391 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
392 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
393 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
394 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
395 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
396 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
397 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
398 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
399 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
400 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
401 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
402 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
403 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
404 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
405 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
406 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
407 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
408 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
409 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
410 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
411 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
412 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
413 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
414 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
415 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
416 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.86
Metatranscriptomes 0.52
Isolates 13.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.28
Nodule 0.65
Rhizoplane 0.91
Rhizosphere 79.12
Stem 0
Stem Tuber 0
Unclassified 15.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10045223 3300003316 Bacteria 2736
2 rootL2_10041909 3300003322 Bacteria 1575
3 rootH1_10025603 3300003323 Bacteria 3007
4 Ga0006562J51391_1012167 3300003578 Bacteria 2276
5 Ga0006562J51391_1012168 3300003578 Bacteria 2366
6 Ga0055524_1000125 3300003775 Bacteria 90042
7 Ga0055524_1001949 3300003775 Bacteria 11103
8 Ga0055530_10000470 3300003791 Bacteria 35231
9 Ga0055530_10000982 3300003791 Bacteria 22949
10 Ga0055540_1000011 3300003792 Bacteria 282927
11 Ga0055531_10006358 3300003794 Bacteria 6722
12 Ga0070658_10019015 3300005327 Bacteria 5503
13 Ga0070658_10197740 3300005327 Bacteria 1695
14 Ga0070683_100092324 3300005329 Bacteria 2843
15 Ga0070683_100107341 3300005329 Bacteria 2632
16 Ga0070683_100143575 3300005329 Bacteria 2261
17 Ga0068869_100087313 3300005334 Bacteria 2339
18 Ga0070666_10014615 3300005335 Bacteria 4999
19 Ga0070666_10108909 3300005335 Bacteria 1914
20 Ga0070666_10345016 3300005335 Bacteria 1065
21 Ga0070660_100220279 3300005339 Bacteria 1542
22 Ga0070691_10105788 3300005341 Bacteria 1402
23 Ga0070661_100014282 3300005344 Bacteria 5595
24 Ga0070661_100070230 3300005344 Bacteria 2575
25 Ga0070668_100004875 3300005347 Bacteria 9944
26 Ga0070659_100160886 3300005366 Bacteria 1836
27 Ga0070714_100006279 3300005435 Bacteria 9160
28 Ga0070663_100002126 3300005455 Bacteria 11093
29 Ga0070662_100098265 3300005457 Bacteria 2211
30 Ga0070681_10364717 3300005458 Bacteria 1355
31 Ga0070698_100284442 3300005471 Bacteria 1585
32 Ga0070699_100130736 3300005518 Bacteria 2213
33 Ga0070699_100460891 3300005518 Bacteria 1153
34 Ga0070679_100146277 3300005530 Bacteria 2341
35 Ga0070679_100181044 3300005530 Bacteria 2080
36 Ga0070684_100042466 3300005535 Bacteria 3925
37 Ga0068853_100134802 3300005539 Bacteria 2213
38 Ga0070696_100066186 3300005546 Bacteria 2534
39 Ga0070665_100222134 3300005548 Bacteria 1889
40 Ga0068855_100000529 3300005563 Bacteria 46748
41 Ga0068855_100088273 3300005563 Bacteria 3582
42 Ga0070664_100117185 3300005564 Bacteria 2329
43 Ga0068857_100147745 3300005577 Bacteria 2127
44 Ga0068854_100076320 3300005578 Bacteria 2463
45 Ga0068852_100003179 3300005616 Bacteria 11467
46 Ga0068852_100019746 3300005616 Bacteria 5342
47 Ga0068852_100131459 3300005616 Bacteria 2306
48 Ga0068859_100094899 3300005617 Bacteria 3035
49 Ga0068864_100029974 3300005618 Bacteria 4611
50 Ga0068864_100167090 3300005618 Bacteria 2004
51 Ga0068861_100192734 3300005719 Bacteria 1705
52 Ga0068863_100000329 3300005841 Bacteria 48080
53 Ga0068858_100040358 3300005842 Bacteria 4328
54 Ga0068860_100001239 3300005843 Bacteria 27857
55 Ga0068860_100020336 3300005843 Bacteria 6429
56 Ga0068860_100167261 3300005843 Bacteria 2123
57 Ga0075367_10013040 3300006178 Bacteria 4454
58 Ga0068871_100140116 3300006358 Bacteria 2056
59 Ga0068865_100112234 3300006881 Bacteria 2013
60 Ga0097620_100094904 3300006931 Bacteria 3035
61 Ga0079104_1000465 3300006946 Bacteria 45434
62 Ga0105250_10019755 3300009092 Bacteria 2724
63 Ga0105240_10000055 3300009093 Bacteria 225380
64 Ga0105240_10118849 3300009093 Bacteria 3185
65 Ga0105245_10054003 3300009098 Bacteria 3608
66 Ga0105241_10022485 3300009174 Bacteria 4671
67 Ga0105241_10037299 3300009174 Bacteria 3661
68 Ga0105241_10054043 3300009174 Bacteria 3073
69 Ga0105242_10020314 3300009176 Bacteria 5208
70 Ga0105248_10000001 3300009177 Bacteria 1881304
71 Ga0105248_10481541 3300009177 Bacteria 1399
72 Ga0105248_10628547 3300009177 Bacteria 1211
73 Ga0105238_10006649 3300009551 Bacteria 11526
74 Ga0105239_10001057 3300010375 Bacteria 38270
75 Ga0105239_10005950 3300010375 Bacteria 14194
76 Ga0105239_10009775 3300010375 Bacteria 10781
77 Ga0105239_10390480 3300010375 Bacteria 1574
78 Ga0157373_10318067 3300013100 Bacteria 1107
79 Ga0157370_10186313 3300013104 Bacteria 1927
80 Ga0157369_10003278 3300013105 Bacteria 19270
81 Ga0157378_10051537 3300013297 Bacteria 3662
82 Ga0157378_10198260 3300013297 Bacteria 1897
83 Ga0157378_10401142 3300013297 Bacteria 1351
84 Ga0163162_10220711 3300013306 Bacteria 2025
85 Ga0163162_10352641 3300013306 Bacteria 1604
86 Ga0157372_10002133 3300013307 Bacteria 21498
87 Ga0157372_10097036 3300013307 Bacteria 3360
88 Ga0163163_10000589 3300014325 Bacteria 32012
89 Ga0163163_10000949 3300014325 Bacteria 24604
90 Ga0163163_10080560 3300014325 Bacteria 3256
91 Ga0182008_10021356 3300014497 Bacteria 3324
92 Ga0157379_10004509 3300014968 Bacteria 11944
93 Ga0157376_10202977 3300014969 Bacteria 1825
94 Ga0182007_10000885 3300015262 Bacteria 16618
95 Ga0183367_1006 3300015688 Bacteria 648044
96 Ga0206353_10549273 3300020082 Bacteria 3749
97 Ga0206353_11306600 3300020082 Bacteria 3289
98 Ga0213875_10003010 3300021388 Bacteria 9792
99 Ga0209565_1010883 3300025263 Bacteria 2241
100 Ga0209758_1006832 3300025297 Bacteria 7992
101 Ga0209050_1000532 3300025298 Bacteria 63063
102 Ga0209050_1002916 3300025298 Bacteria 13427
103 Ga0209256_1000113 3300025299 Bacteria 175296
104 Ga0207426_1000981 3300025302 Bacteria 28122
105 Ga0207426_1003579 3300025302 Bacteria 8265
106 Ga0209051_1000020 3300025303 Bacteria 508628
107 Ga0209257_1000085 3300025304 Bacteria 291117
108 Ga0207680_10000055 3300025903 Bacteria 54114
109 Ga0207680_10075123 3300025903 Bacteria 2107
110 Ga0207680_10135284 3300025903 Bacteria 1628
111 Ga0207647_10001611 3300025904 Bacteria 17347
112 Ga0207705_10147245 3300025909 Bacteria 1762
113 Ga0207695_10000012 3300025913 Bacteria 840961
114 Ga0207695_10000295 3300025913 Bacteria 123533
115 Ga0207671_10007226 3300025914 Bacteria 9671
116 Ga0207671_10152670 3300025914 Bacteria 1785
117 Ga0207660_10296679 3300025917 Bacteria 1286
118 Ga0207649_10001154 3300025920 Bacteria 15927
119 Ga0207649_10030222 3300025920 Bacteria 3206
120 Ga0207649_10151701 3300025920 Bacteria 1597
121 Ga0207652_10095039 3300025921 Bacteria 2625
122 Ga0207694_10000006 3300025924 Bacteria 631109
123 Ga0207694_10116323 3300025924 Bacteria 2131
124 Ga0207687_10031945 3300025927 Unclassified 3562
125 Ga0207664_10005792 3300025929 Bacteria 8449
126 Ga0207706_10033851 3300025933 Bacteria 4548
127 Ga0207686_10038384 3300025934 Bacteria 2898
128 Ga0207711_10000001 3300025941 Bacteria 1325674
129 Ga0207689_10077006 3300025942 Bacteria 2742
130 Ga0207667_10000026 3300025949 Bacteria 343713
131 Ga0207667_10005003 3300025949 Bacteria 16195
132 Ga0207667_10314455 3300025949 Bacteria 1600
133 Ga0207668_10001856 3300025972 Bacteria 12337
134 Ga0207677_10182372 3300026023 Bacteria 1652
135 Ga0207703_10158300 3300026035 Bacteria 1981
136 Ga0207639_10037822 3300026041 Bacteria 3587
137 Ga0207639_10057543 3300026041 Bacteria 2985
138 Ga0207678_10000442 3300026067 Bacteria 37718
139 Ga0207641_10028963 3300026088 Bacteria 4578
140 Ga0207676_10119532 3300026095 Bacteria 2219
141 Ga0207674_10001063 3300026116 Bacteria 35707
142 Ga0207683_10100074 3300026121 Bacteria 2588
143 Ga0207698_10006997 3300026142 Bacteria 7061
144 Ga0207698_10007799 3300026142 Bacteria 6727
145 Ga0209281_1000195 3300027111 Bacteria 139144
146 Ga0209974_10011278 3300027876 Bacteria 3006
147 Ga0268266_10152934 3300028379 Unclassified 2081
148 Ga0268264_10005559 3300028381 Bacteria 10676
149 Ga0265337_1001356 3300028556 Bacteria 12072
150 Ga0265334_10002334 3300028573 Bacteria 8932
151 Ga0265318_10000149 3300028577 Bacteria 63245
152 Ga0265318_10001785 3300028577 Bacteria 12233
153 Ga0307515_10000123 3300028794 Bacteria 186601
154 Ga0307515_10000541 3300028794 Bacteria 88944
155 Ga0307515_10018885 3300028794 Bacteria 12446
156 Ga0307515_10174876 3300028794 Bacteria 2122
157 Ga0265338_10029699 3300028800 Bacteria 5412
158 Ga0307511_10000477 3300030521 Bacteria 43424
159 Ga0307511_10155622 3300030521 Bacteria 1298
160 Ga0307512_10004449 3300030522 Bacteria 15346
161 Ga0307512_10027900 3300030522 Bacteria 4959
162 Ga0307512_10030676 3300030522 Bacteria 4672
163 Ga0307512_10108440 3300030522 Bacteria 1842
164 Ga0307512_10231252 3300030522 Bacteria 950
165 Ga0265330_10040068 3300031235 Bacteria 2081
166 Ga0265325_10148880 3300031241 Bacteria 1108
167 Ga0265331_10039331 3300031250 Bacteria 2307
168 Ga0265331_10040757 3300031250 Bacteria 2258
169 Ga0265316_10027475 3300031344 Bacteria 4711
170 Ga0307513_10014726 3300031456 Bacteria 9512
171 Ga0307513_10017114 3300031456 Bacteria 8708
172 Ga0307513_10057319 3300031456 Bacteria 4151
173 Ga0307513_10071416 3300031456 Bacteria 3623
174 Ga0307513_10074353 3300031456 Bacteria 3534
175 Ga0307513_10177778 3300031456 Bacteria 1996
176 Ga0307513_10344365 3300031456 Bacteria 1240
177 Ga0307509_10009963 3300031507 Bacteria 11741
178 Ga0307509_10096821 3300031507 Bacteria 3001
179 Ga0307408_100141032 3300031548 Bacteria 1892
180 Ga0265313_10000757 3300031595 Bacteria 32971
181 Ga0307508_10002336 3300031616 Bacteria 20114
182 Ga0307508_10004731 3300031616 Bacteria 13174
183 Ga0307508_10140605 3300031616 Bacteria 2017
184 Ga0307508_10365789 3300031616 Bacteria 1033
185 Ga0307514_10010004 3300031649 Bacteria 7942
186 Ga0307514_10015139 3300031649 Bacteria 6373
187 Ga0307514_10015662 3300031649 Bacteria 6249
188 Ga0307514_10024583 3300031649 Bacteria 4874
189 Ga0307514_10234409 3300031649 Bacteria 1108
190 Ga0316575_10005400 3300031665 Bacteria 4558
191 Ga0316575_10007710 3300031665 Bacteria 3905
192 Ga0316575_10039379 3300031665 Bacteria 1865
193 Ga0316579_10003704 3300031691 Bacteria 6011
194 Ga0316579_10088414 3300031691 Bacteria 1478
195 Ga0265314_10052245 3300031711 Bacteria 2842
196 Ga0316576_10000837 3300031727 Bacteria 15551
197 Ga0316576_10001885 3300031727 Bacteria 11657
198 Ga0316576_10003035 3300031727 Bacteria 9763
199 Ga0316576_10004532 3300031727 Bacteria 8351
200 Ga0316576_10194612 3300031727 Bacteria 1528
201 Ga0316578_10000481 3300031728 Bacteria 13412
202 Ga0316578_10010371 3300031728 Bacteria 4835
203 Ga0316578_10010470 3300031728 Bacteria 4814
204 Ga0316578_10022534 3300031728 Bacteria 3513
205 Ga0316578_10128277 3300031728 Bacteria 1525
206 Ga0316578_10137122 3300031728 Bacteria 1473
207 Ga0307516_10016228 3300031730 Bacteria 7796
208 Ga0307516_10020560 3300031730 Bacteria 6817
209 Ga0307516_10024509 3300031730 Bacteria 6161
210 Ga0307516_10034989 3300031730 Bacteria 5043
211 Ga0316577_10003164 3300031733 Bacteria 8277
212 Ga0316577_10132188 3300031733 Bacteria 1404
213 Ga0307518_10000376 3300031838 Bacteria 34192
214 Ga0307412_10154109 3300031911 Unclassified 1699
215 Ga0316583_10009058 3300032133 Bacteria 3589
216 Ga0316583_10014027 3300032133 Bacteria 2890
217 Ga0316583_10040669 3300032133 Bacteria 1646
218 Ga0316585_10000539 3300032137 Bacteria 9148
219 Ga0316585_10017204 3300032137 Bacteria 2184
220 Ga0316585_10095014 3300032137 Bacteria 976
221 Ga0316580_10005182 3300032139 Bacteria 3795
222 Ga0316580_10008164 3300032139 Bacteria 3133
223 Ga0307507_10007895 3300033179 Bacteria 15065
224 Ga0307507_10018099 3300033179 Bacteria 8039
225 Ga0307507_10035329 3300033179 Bacteria 5136
226 Ga0307507_10099678 3300033179 Bacteria 2438
227 Ga0307507_10179740 3300033179 Bacteria 1515
228 Ga0307510_10020300 3300033180 Bacteria 7768
229 Ga0307510_10034631 3300033180 Bacteria 5651
230 Ga0307510_10142764 3300033180 Bacteria 2033
231 Ga0316574_0008845 3300035398 Bacteria 5614
232 Ga0316574_0011686 3300035398 Bacteria 4999
233 Ga0316574_0045314 3300035398 Bacteria 2723
234 Ga0316574_0051175 3300035398 Bacteria 2574
235 Ga0316574_0109984 3300035398 Bacteria 1766
236 Ga0316582_0002166 3300036647 Bacteria 9103
237 Ga0316582_0013088 3300036647 Bacteria 4657
238 Ga0316582_0096226 3300036647 Bacteria 1955
239 Ga0316584_0001840 3300036712 Bacteria 13122
240 Ga0316584_0005975 3300036712 Bacteria 8221
241 Ga0316584_0056723 3300036712 Bacteria 2932
242 Ga0316584_0071703 3300036712 Bacteria 2595
243 Ga0316584_0123743 3300036712 Bacteria 1932
244 Ga0316584_0407841 3300036712 Bacteria 967
245 Ga0395898_0004973 3300037466 Bacteria 14423
246 Ga0395898_0035553 3300037466 Bacteria 4951
247 Ga0316581_0017017 3300037588 Bacteria 2095
248 Ga0436364_0896138 3300037853 Bacteria 37377
249 Ga0395901_0578250 3300038443 Bacteria 1135
250 Ga0400484_27811 3300038725 Bacteria 7745
251 Ga0400490_31308 3300038726 Bacteria 8615
252 Ga0400490_51610 3300038726 Bacteria 2474
253 Ga0400491_26268 3300038727 Bacteria 3208
254 Ga0400485_00947 3300038735 Bacteria 1158
255 Ga0400485_06984 3300038735 Bacteria 14026
256 Ga0400485_07748 3300038735 Bacteria 63267
257 Ga0400486_00966 3300038742 Bacteria 11287
258 Ga0400486_01623 3300038742 Bacteria 34748
259 Ga0400483_077455 3300039062 Bacteria 1921
260 Ga0400489_08878 3300039093 Bacteria 10167
261 Ga0400487_04533 3300039110 Bacteria 51421
262 Ga0400487_35172 3300039110 Bacteria 5181
263 Ga0436365_0198870 3300039437 Bacteria 9397
264 Ga0436365_0704399 3300039437 Bacteria 1668
265 Ga0439436_0003702 3300041404 Bacteria 4660
266 Ga0439436_0004032 3300041404 Bacteria 4500
267 Ga0439439_0003783 3300041406 Bacteria 3363
268 Ga0439439_0004751 3300041406 Bacteria 3075
269 Ga0451843_0686416 3300041509 Bacteria 1232
270 Ga0451853_0034159 3300041512 Bacteria 2320
271 Ga0451853_1117734 3300041512 Bacteria 4880
272 Ga0451853_1420060 3300041512 Bacteria 1845
273 Ga0439433_0009056 3300041999 Bacteria 2166
274 Ga0439448_0026804 3300042005 Bacteria 1813
275 Ga0439449_0079815 3300042007 Bacteria 1206
276 Ga0439455_0013856 3300042012 Bacteria 1833
277 Ga0439457_001353 3300042014 Bacteria 7368
278 Ga0439457_003193 3300042014 Bacteria 4513
279 Ga0439462_0005937 3300042015 Bacteria 3023
280 Ga0450919_001212 3300042121 Bacteria 3365
281 Ga0450923_028966 3300042125 Bacteria 1120
282 Ga0450894_000487 3300042131 Bacteria 6771
283 Ga0450899_000635 3300042135 Bacteria 3973
284 Ga0450903_000044 3300042138 Bacteria 24233
285 Ga0439434_0066787 3300042435 Bacteria 1129
286 Ga0439435_0069861 3300042436 Bacteria 1038
287 Ga0450918_000071 3300042531 Bacteria 20844
288 Ga0466969_0012487 3300044656 Bacteria 4478
289 Ga0466972_0009323 3300044658 Bacteria 4934
290 Ga0466972_0009968 3300044658 Bacteria 4770
291 Ga0466972_0029298 3300044658 Bacteria 2710
292 Ga0466965_0028690 3300044683 Bacteria 2704
293 Ga0466966_0026339 3300044684 Bacteria 3796
294 Ga0466961_0005851 3300044693 Bacteria 7791
295 Ga0466961_0009568 3300044693 Bacteria 6169
296 Ga0466961_0050467 3300044693 Bacteria 2657
297 Ga0466961_0065796 3300044693 Bacteria 2303
298 Ga0466961_0106706 3300044693 Bacteria 1763
299 Ga0466963_0010858 3300044694 Bacteria 5530
300 Ga0466963_0016533 3300044694 Bacteria 4589
301 Ga0466964_0004728 3300044706 Bacteria 5032
302 Ga0466971_0004505 3300044719 Bacteria 6022
303 Ga0466970_0007537 3300044765 Bacteria 5458
304 Ga0466970_0026797 3300044765 Bacteria 3021
305 Ga0466970_0045023 3300044765 Bacteria 2349
306 Ga0466957_0004601 3300044842 Bacteria 7709
307 Ga0466957_0240331 3300044842 Bacteria 1201
308 Ga0466960_0003551 3300044901 Bacteria 6007
309 Ga0466959_0016300 3300045049 Bacteria 5426
310 Ga0466959_0178054 3300045049 Bacteria 1489
311 Ga0466959_0271661 3300045049 Bacteria 1165
312 Ga0466958_0000949 3300045836 Bacteria 13098
313 Ga0466967_0098312 3300045976 Bacteria 2672
314 Ga0466967_0329022 3300045976 Bacteria 1475
315 Ga0495617_011356 3300046452 Bacteria 3038
316 Ga0495592_0008020 3300046454 Bacteria 7928
317 Ga0495592_0034890 3300046454 Bacteria 3790
318 Ga0495603_0008979 3300046455 Bacteria 6043
319 Ga0495603_0027757 3300046455 Bacteria 3414
320 Ga0495603_0040823 3300046455 Bacteria 2776
321 Ga0495629_0005181 3300046459 Bacteria 9754
322 Ga0495629_0008226 3300046459 Bacteria 7669
323 Ga0495629_0009617 3300046459 Bacteria 7061
324 Ga0495629_0042604 3300046459 Bacteria 3189
325 Ga0495629_0080985 3300046459 Bacteria 2266
326 Ga0495629_0088166 3300046459 Bacteria 2164
327 Ga0495629_0093414 3300046459 Bacteria 2099
328 Ga0495638_0056895 3300046460 Bacteria 2426
329 Ga0495651_0016521 3300046462 Bacteria 5717
330 Ga0495651_0051428 3300046462 Bacteria 3176
331 Ga0495651_0055301 3300046462 Bacteria 3050
332 Ga0495651_0393266 3300046462 Bacteria 907
333 Ga0495653_0069989 3300046463 Bacteria 2627
334 Ga0495580_0226943 3300046472 Bacteria 1282
335 Ga0495582_0060789 3300046473 Bacteria 2085
336 Ga0495605_0010454 3300046474 Bacteria 5190
337 Ga0495605_0080485 3300046474 Bacteria 1525
338 Ga0495662_0033617 3300046476 Bacteria 2477
339 Ga0495585_0003711 3300046492 Bacteria 10210
340 Ga0495585_0101034 3300046492 Bacteria 1542
341 Ga0495594_0020165 3300046499 Bacteria 3550
342 Ga0495594_0083629 3300046499 Bacteria 1784
343 Ga0495596_0042641 3300046500 Bacteria 1788
344 Ga0495607_0034738 3300046501 Bacteria 3056
345 Ga0495607_0157468 3300046501 Bacteria 1157
346 Ga0495606_0065930 3300046507 Bacteria 2298
347 Ga0495610_0065508 3300046512 Bacteria 1714
348 Ga0495616_0049594 3300046513 Bacteria 2103
349 Ga0495618_0079366 3300046514 Bacteria 2093
350 Ga0495618_0236669 3300046514 Bacteria 1149
351 Ga0495618_0247349 3300046514 Bacteria 1119
352 Ga0495620_0023355 3300046515 Bacteria 2958
353 Ga0495620_0080750 3300046515 Bacteria 1316
354 Ga0495620_0097889 3300046515 Bacteria 1171
355 Ga0495628_0087105 3300046516 Bacteria 2421
356 Ga0495628_0129113 3300046516 Bacteria 1935
357 Ga0495628_0280343 3300046516 Bacteria 1238
358 Ga0495631_0004707 3300046518 Bacteria 7210
359 Ga0495631_0076484 3300046518 Bacteria 1445
360 Ga0495643_0006842 3300046522 Bacteria 7437
361 Ga0495643_0033285 3300046522 Bacteria 2853
362 Ga0495644_0050512 3300046523 Bacteria 1561
363 Ga0495666_0057086 3300046526 Bacteria 1869
364 Ga0495642_0128126 3300046528 Bacteria 1092
365 Ga0495652_0005221 3300046529 Bacteria 12276
366 Ga0495652_0042608 3300046529 Bacteria 3913
367 Ga0495652_0062020 3300046529 Bacteria 3154
368 Ga0495652_0231649 3300046529 Bacteria 1381
369 Ga0495654_0044614 3300046530 Bacteria 2192
370 Ga0495640_0001063 3300046533 Bacteria 21350
371 Ga0495640_0003870 3300046533 Bacteria 11976
372 Ga0495640_0030392 3300046533 Bacteria 3868
373 Ga0495586_0090813 3300046535 Bacteria 1687
374 Ga0495587_0006177 3300046536 Bacteria 7820
375 Ga0495609_0021000 3300046538 Bacteria 3013
376 Ga0495597_0026120 3300046542 Bacteria 2683
377 Ga0495622_0010612 3300046557 Bacteria 4249
378 Ga0495633_0020737 3300046558 Bacteria 3300
379 Ga0495667_0072253 3300046559 Bacteria 2249
380 Ga0495667_0138279 3300046559 Bacteria 1570
381 Ga0495668_0032366 3300046616 Bacteria 2942
382 Ga0495634_0036275 3300046642 Bacteria 3372
383 Ga0495625_0000990 3300046660 Bacteria 37644
384 Ga0495625_0010878 3300046660 Bacteria 7477
385 Ga0495635_0024955 3300046663 Bacteria 4165
386 Ga0495635_0046803 3300046663 Bacteria 2984
387 Ga0495635_0102549 3300046663 Bacteria 1955
388 Ga0495661_0032971 3300046665 Bacteria 3269
389 Ga0495588_0008854 3300046674 Bacteria 4629
390 Ga0495588_0040166 3300046674 Bacteria 2385
391 Ga0495588_0076053 3300046674 Bacteria 1749
392 Ga0495588_0170600 3300046674 Bacteria 1150
393 Ga0495588_0227710 3300046674 Bacteria 984
394 Ga0495657_0002793 3300046675 Bacteria 14515
395 Ga0495657_0028974 3300046675 Bacteria 3886
396 Ga0495657_0035922 3300046675 Bacteria 3430
397 Ga0495623_0097418 3300046679 Bacteria 1796
398 Ga0495646_0001039 3300046680 Bacteria 16059
399 Ga0495613_0001088 3300046689 Bacteria 20750
400 Ga0495613_0012265 3300046689 Bacteria 6368
401 Ga0495613_0020348 3300046689 Bacteria 4947
402 Ga0495613_0042223 3300046689 Bacteria 3375
403 Ga0495613_0054375 3300046689 Bacteria 2943
404 Ga0495613_0136081 3300046689 Bacteria 1757
405 Ga0495613_0161908 3300046689 Bacteria 1591
406 Ga0495624_0030537 3300046690 Bacteria 3509
407 Ga0495624_0154461 3300046690 Bacteria 1403
408 Ga0495670_0004047 3300046691 Bacteria 7186
409 Ga0495670_0030384 3300046691 Bacteria 2684
410 Ga0495670_0142498 3300046691 Bacteria 1254
411 Ga0495671_0081712 3300046692 Bacteria 1583
412 Ga0495671_0138531 3300046692 Bacteria 1186
413 Ga0495589_0015789 3300046794 Bacteria 3881
414 Ga0495589_0029656 3300046794 Bacteria 2758
415 Ga0495589_0041542 3300046794 Bacteria 2294
416 Ga0495589_0055002 3300046794 Bacteria 1961
417 Ga0495589_0061613 3300046794 Bacteria 1841
418 Ga0495589_0075812 3300046794 Bacteria 1640
419 Ga0495600_0001432 3300046809 Bacteria 13189
420 Ga0495600_0006928 3300046809 Bacteria 6914
421 Ga0495600_0194664 3300046809 Bacteria 1303
422 Ga0495581_0028479 3300047315 Bacteria 3238
423 Ga0495604_0003476 3300047317 Bacteria 12558
424 Ga0495636_0001203 3300047318 Bacteria 9793
425 Ga0495636_0006555 3300047318 Bacteria 4575
426 Ga0495674_0102132 3300047319 Bacteria 2439
427 Ga0495676_0013737 3300047321 Bacteria 7265
428 Ga0495676_0016662 3300047321 Bacteria 6511
429 Ga0495676_0034152 3300047321 Bacteria 4270
430 Ga0495676_0232604 3300047321 Bacteria 1265
431 Ga0495680_0017759 3300047322 Bacteria 6057
432 Ga0495687_002438 3300047443 Bacteria 14954
433 Ga0495687_006538 3300047443 Bacteria 7118
434 Ga0495687_111154 3300047443 Bacteria 1007
435 Ga0495675_0035650 3300047444 Bacteria 3177
436 Ga0495677_0017529 3300047445 Bacteria 2596
437 Ga0495679_026603 3300047446 Bacteria 1919
438 Ga0495685_007903 3300047447 Bacteria 3522
439 Ga0495685_009879 3300047447 Bacteria 3194
440 Ga0495685_022960 3300047447 Bacteria 2146
441 Ga0495685_038735 3300047447 Bacteria 1632
442 Ga0495681_0001091 3300047470 Bacteria 20606
443 Ga0495681_0003731 3300047470 Bacteria 10553
444 Ga0495681_0045704 3300047470 Bacteria 2093
445 Ga0495684_0150810 3300047471 Bacteria 1738
446 Ga0495686_0029248 3300047472 Bacteria 3585
447 Ga0495686_0063265 3300047472 Bacteria 2293
448 Ga0495593_0004425 3300047673 Bacteria 8353
449 Ga0495593_0046554 3300047673 Bacteria 2310
450 Ga0495602_0036614 3300048088 Bacteria 4565
451 Ga0495614_0002730 3300048089 Bacteria 7851
452 Ga0495614_0006580 3300048089 Bacteria 5204
453 Ga0495614_0121132 3300048089 Bacteria 1153
454 Ga0495626_0029348 3300048091 Bacteria 2662
455 Ga0496102_0000331 3300048905 Bacteria 58351
456 Ga0496102_0010679 3300048905 Bacteria 7911
457 Ga0496103_0021436 3300048906 Bacteria 3887
458 Ga0496105_0394712 3300048908 Bacteria 1099
459 Ga0496109_0122879 3300048912 Bacteria 2419
460 Ga0496114_0003561 3300048917 Bacteria 11962
461 Ga0496122_0197236 3300048925 Bacteria 1181
462 Ga0496126_0001104 3300048929 Bacteria 45291
463 Ga0495682_0068266 3300049460 Bacteria 1280
464 Ga0495682_0076005 3300049460 Bacteria 1208
465 Ga0501031_0001472 3300049568 Bacteria 14623
466 Ga0501031_0004159 3300049568 Bacteria 9345
467 Ga0501031_0012912 3300049568 Bacteria 5455
468 Ga0501031_0024171 3300049568 Bacteria 3961
469 Ga0501031_0033244 3300049568 Bacteria 3363
470 Ga0501032_0002016 3300049569 Bacteria 16008
471 Ga0501032_0005106 3300049569 Bacteria 9795
472 Ga0501032_0006464 3300049569 Bacteria 8618
473 Ga0501032_0010731 3300049569 Bacteria 6594
474 Ga0501032_0052072 3300049569 Bacteria 2759
475 Ga0501032_0084048 3300049569 Bacteria 2116
476 Ga0501033_0001270 3300049570 Bacteria 22536
477 Ga0501033_0008095 3300049570 Bacteria 8145
478 Ga0501033_0012763 3300049570 Bacteria 6406
479 Ga0501033_0019893 3300049570 Bacteria 5074
480 Ga0501033_0036156 3300049570 Bacteria 3702
481 Ga0501033_0040252 3300049570 Bacteria 3489
482 Ga0501033_0065827 3300049570 Bacteria 2665
483 Ga0501033_0088316 3300049570 Bacteria 2268
484 Ga0501033_0172205 3300049570 Bacteria 1554
485 Ga0501033_0178378 3300049570 Bacteria 1523
486 Ga0501033_0193746 3300049570 Bacteria 1453
487 Ga0501033_0199044 3300049570 Bacteria 1431
488 Ga0501033_0221425 3300049570 Bacteria 1347
489 Ga0501033_0242006 3300049570 Bacteria 1280
490 Ga0501033_0268821 3300049570 Bacteria 1205
491 Ga0501033_0313197 3300049570 Bacteria 1103
492 Ga0501034_0001007 3300049571 Bacteria 40401
493 Ga0501034_0001944 3300049571 Bacteria 26175
494 Ga0501034_0020633 3300049571 Bacteria 6730
495 Ga0501034_0034478 3300049571 Bacteria 5131
496 Ga0501034_0034779 3300049571 Bacteria 5109
497 Ga0501034_0075832 3300049571 Bacteria 3370
498 Ga0501034_0082912 3300049571 Bacteria 3208
499 Ga0501034_0187203 3300049571 Bacteria 2033
500 Ga0501034_0198629 3300049571 Bacteria 1964
501 Ga0501034_0326153 3300049571 Bacteria 1467
502 Ga0501034_0448555 3300049571 Bacteria 1208
503 Ga0501034_0660194 3300049571 Bacteria 947
504 Ga0501036_0002177 3300049572 Bacteria 15289
505 Ga0501036_0005092 3300049572 Bacteria 10634
506 Ga0501036_0007043 3300049572 Bacteria 9148
507 Ga0501036_0007472 3300049572 Bacteria 8909
508 Ga0501036_0090603 3300049572 Bacteria 2583
509 Ga0501036_0174624 3300049572 Bacteria 1809
510 Ga0501036_0177680 3300049572 Bacteria 1792
511 Ga0501036_0405997 3300049572 Bacteria 1136
512 Ga0501037_0002239 3300049573 Bacteria 13978
513 Ga0501037_0018704 3300049573 Bacteria 5106
514 Ga0501037_0028698 3300049573 Bacteria 4110
515 Ga0501037_0042415 3300049573 Bacteria 3343
516 Ga0501037_0076763 3300049573 Bacteria 2425
517 Ga0501037_0269874 3300049573 Bacteria 1187
518 Ga0501038_0008550 3300049574 Bacteria 9398
519 Ga0501038_0010421 3300049574 Bacteria 8501
520 Ga0501038_0018790 3300049574 Bacteria 6238
521 Ga0501038_0020493 3300049574 Bacteria 5941
522 Ga0501038_0114160 3300049574 Bacteria 2234
523 Ga0501038_0121637 3300049574 Bacteria 2152
524 Ga0501038_0221943 3300049574 Bacteria 1507
525 Ga0501038_0232561 3300049574 Bacteria 1466
526 Ga0501039_0000908 3300049575 Bacteria 21595
527 Ga0501039_0024561 3300049575 Bacteria 4630
528 Ga0501039_0174850 3300049575 Bacteria 1688
529 Ga0501039_0340689 3300049575 Bacteria 1178
530 Ga0501040_0372919 3300049576 Bacteria 1023
531 Ga0501042_0039064 3300049578 Bacteria 3372
532 Ga0501042_0047649 3300049578 Bacteria 3056
533 Ga0501042_0056635 3300049578 Bacteria 2797
534 Ga0501042_0218824 3300049578 Bacteria 1373
535 Ga0501043_0002408 3300049579 Bacteria 15831
536 Ga0501043_0006764 3300049579 Bacteria 9156
537 Ga0501043_0038281 3300049579 Bacteria 3771
538 Ga0501043_0081655 3300049579 Bacteria 2540
539 Ga0501043_0099574 3300049579 Bacteria 2285
540 Ga0501043_0147748 3300049579 Bacteria 1840
541 Ga0501043_0172573 3300049579 Bacteria 1687
542 Ga0501046_0000928 3300049580 Bacteria 28785
543 Ga0501046_0019814 3300049580 Bacteria 5572
544 Ga0501046_0102405 3300049580 Bacteria 2195
545 Ga0501046_0143622 3300049580 Bacteria 1804
546 Ga0501046_0375744 3300049580 Bacteria 1029
547 Ga0501047_0000025 3300049581 Bacteria 225560
548 Ga0501047_0000921 3300049581 Bacteria 30119
549 Ga0501047_0002500 3300049581 Bacteria 17526
550 Ga0501047_0007651 3300049581 Bacteria 10173
551 Ga0501047_0011628 3300049581 Bacteria 8324
552 Ga0501047_0012202 3300049581 Bacteria 8134
553 Ga0501047_0019157 3300049581 Bacteria 6565
554 Ga0501047_0027128 3300049581 Bacteria 5517
555 Ga0501047_0032937 3300049581 Bacteria 5004
556 Ga0501047_0054939 3300049581 Bacteria 3851
557 Ga0501047_0089462 3300049581 Bacteria 2956
558 Ga0501047_0109683 3300049581 Bacteria 2642
559 Ga0501047_0119175 3300049581 Bacteria 2521
560 Ga0501047_0119606 3300049581 Bacteria 2516
561 Ga0501047_0157822 3300049581 Bacteria 2141
562 Ga0501047_0211563 3300049581 Bacteria 1797
563 Ga0501047_0340310 3300049581 Bacteria 1338
564 Ga0501048_0000046 3300049582 Bacteria 60199
565 Ga0501048_0001187 3300049582 Bacteria 19717
566 Ga0501048_0004083 3300049582 Bacteria 11120
567 Ga0501048_0120238 3300049582 Bacteria 1856
568 Ga0501048_0122813 3300049582 Bacteria 1835
569 Ga0501067_0000575 3300049583 Bacteria 19864
570 Ga0501067_0002800 3300049583 Bacteria 9596
571 Ga0501067_0011767 3300049583 Bacteria 4846
572 Ga0501067_0114250 3300049583 Bacteria 1501
573 Ga0501068_0001130 3300049584 Bacteria 14139
574 Ga0501068_0022887 3300049584 Bacteria 3658
575 Ga0501068_0068044 3300049584 Bacteria 2171
576 Ga0501069_0000338 3300049585 Bacteria 21160
577 Ga0501070_0001453 3300049586 Bacteria 21192
578 Ga0501070_0002903 3300049586 Bacteria 14936
579 Ga0501070_0018239 3300049586 Bacteria 5887
580 Ga0501070_0027306 3300049586 Bacteria 4788
581 Ga0501070_0033496 3300049586 Bacteria 4299
582 Ga0501070_0099189 3300049586 Bacteria 2410
583 Ga0501071_0001198 3300049587 Bacteria 14639
584 Ga0501072_0000344 3300049588 Bacteria 33052
585 Ga0501072_0021856 3300049588 Bacteria 4962
586 Ga0501072_0124218 3300049588 Bacteria 2056
587 Ga0501072_0435180 3300049588 Bacteria 1039
588 Ga0501073_0003741 3300049589 Bacteria 11425
589 Ga0501073_0007430 3300049589 Bacteria 8146
590 Ga0501073_0032453 3300049589 Bacteria 3722
591 Ga0501073_0065942 3300049589 Bacteria 2524
592 Ga0501073_0327583 3300049589 Bacteria 1057
593 Ga0501074_0000798 3300049590 Bacteria 19915
594 Ga0501074_0008507 3300049590 Bacteria 7434
595 Ga0501076_0010690 3300049592 Bacteria 6821
596 Ga0501077_0033415 3300049593 Bacteria 3274
597 Ga0501079_0016506 3300049741 Bacteria 5639
598 Ga0501079_0021118 3300049741 Bacteria 4977
599 Ga0501079_0026731 3300049741 Bacteria 4424
600 Ga0501080_0004691 3300049742 Bacteria 12193
601 Ga0501080_0088807 3300049742 Bacteria 2871
602 Ga0501080_0092804 3300049742 Bacteria 2803
603 Ga0501080_0180455 3300049742 Bacteria 1943
604 Ga0501083_0004389 3300049744 Bacteria 9948
605 Ga0501083_0019150 3300049744 Bacteria 4767
606 Ga0501035_0003677 3300049822 Bacteria 14619
607 Ga0501035_0005555 3300049822 Bacteria 11915
608 Ga0501035_0014767 3300049822 Bacteria 7212
609 Ga0501035_0017234 3300049822 Bacteria 6659
610 Ga0501035_0017668 3300049822 Bacteria 6578
611 Ga0501035_0019226 3300049822 Bacteria 6288
612 Ga0501035_0021995 3300049822 Bacteria 5857
613 Ga0501035_0027172 3300049822 Bacteria 5232
614 Ga0501035_0062275 3300049822 Bacteria 3320
615 Ga0501035_0083365 3300049822 Bacteria 2821
616 Ga0501035_0101239 3300049822 Bacteria 2528
617 Ga0501035_0131395 3300049822 Bacteria 2182
618 Ga0501035_0137183 3300049822 Bacteria 2129
619 Ga0501035_0154379 3300049822 Bacteria 1990
620 Ga0501035_0203248 3300049822 Bacteria 1698
621 Ga0501035_0237957 3300049822 Bacteria 1549
622 Ga0501035_0317792 3300049822 Bacteria 1309
623 Ga0501035_0533925 3300049822 Bacteria 962
624 Ga0501044_0002060 3300049823 Bacteria 23168
625 Ga0501044_0004946 3300049823 Bacteria 14904
626 Ga0501044_0013132 3300049823 Bacteria 8966
627 Ga0501044_0041906 3300049823 Bacteria 4765
628 Ga0501044_0042540 3300049823 Bacteria 4724
629 Ga0501044_0057150 3300049823 Bacteria 4004
630 Ga0501044_0097712 3300049823 Bacteria 2957
631 Ga0501044_0117543 3300049823 Bacteria 2663
632 Ga0501044_0167103 3300049823 Bacteria 2173
633 Ga0501044_0205458 3300049823 Bacteria 1926
634 Ga0501044_0235589 3300049823 Bacteria 1776
635 Ga0501044_0285991 3300049823 Bacteria 1581
636 Ga0501044_0310807 3300049823 Bacteria 1503
637 Ga0501044_0581366 3300049823 Bacteria 1014
638 Ga0501044_0584006 3300049823 Bacteria 1011
639 Ga0501044_0719762 3300049823 Bacteria 882
640 Ga0501045_0008767 3300049824 Bacteria 7058
641 nmdc:mga06z11_9505_c1 3300050494 Bacteria 4100
642 Ga0495619_0039846 3300053085 Bacteria 3068
643 Ga0500578_0031319 3300053086 Bacteria 3417
644 Ga0500640_015413 3300053095 Bacteria 3199
645 Ga0500654_034732 3300053099 Bacteria 2972
646 Ga0500553_022913 3300053101 Bacteria 3154
647 Ga0500560_023076 3300053107 Bacteria 1800
648 Ga0500569_016937 3300053109 Bacteria 1854
649 Ga0500614_025713 3300053123 Bacteria 1402
650 Ga0500652_003553 3300053131 Bacteria 4731
651 Ga0500658_0004751 3300053134 Bacteria 5061
652 Ga0500561_0000736 3300053137 Bacteria 5189
653 Ga0500600_0136894 3300053149 Bacteria 1238
654 Ga0500619_023657 3300053154 Bacteria 1798
655 Ga0500627_0150266 3300053158 Bacteria 1052
656 Ga0500636_0165813 3300053177 Bacteria 1200
657 Ga0500656_005217 3300053732 Bacteria 1277
658 Ga0500587_000186 3300053739 Bacteria 6353
659 Ga0501084_0000375 3300054114 Bacteria 34270
660 Ga0501084_0001251 3300054114 Bacteria 19995
661 Ga0501084_0009845 3300054114 Bacteria 7900
662 Ga0501084_0043106 3300054114 Bacteria 3775
663 Ga0501082_0034550 3300060353 Bacteria 4357
664 Ga0501082_0310717 3300060353 Bacteria 1373
665 Ga0466962_0006434 3300061719 Bacteria 5638
666 Ga0530510_0013267 3300061734 Bacteria 5793

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053739 Ga0500587_000186 Ga0500587_000186_20_727 229
2 3300049580 Ga0501046_0375744 Ga0501046_0375744_24_803 235
3 3300038735 Ga0400485_00947 Ga0400485_00947_281_1057 246
4 3300042125 Ga0450923_028966 Ga0450923_028966_313_1092 248
5 3300046523 Ga0495644_0050512 Ga0495644_0050512_37_804 250
6 3300049568 Ga0501031_0024171 Ga0501031_0024171_55_963 250
7 3300049571 Ga0501034_0034779 Ga0501034_0034779_2760_3668 250
8 3300049574 Ga0501038_0018790 Ga0501038_0018790_4088_4996 250
9 3300049582 Ga0501048_0000046 Ga0501048_0000046_29037_29945 250
10 3300049586 Ga0501070_0027306 Ga0501070_0027306_670_1578 250
11 3300005843 Ga0068860_100020336 Ga0068860_1000203368 251
12 3300028381 Ga0268264_10005559 Ga0268264_100055594 251
13 3300049579 Ga0501043_0006764 Ga0501043_0006764_2170_3078 251
14 3300049581 Ga0501047_0012202 Ga0501047_0012202_6379_7287 251
15 3300049742 Ga0501080_0088807 Ga0501080_0088807_1695_2576 251
16 3300049822 Ga0501035_0027172 Ga0501035_0027172_1492_2400 251
17 3300049823 Ga0501044_0042540 Ga0501044_0042540_2521_3429 251
18 3300005327 Ga0070658_10197740 Ga0070658_101977402 252
19 3300005329 Ga0070683_100143575 Ga0070683_1001435752 252
20 3300005335 Ga0070666_10108909 Ga0070666_101089091 252
21 3300005535 Ga0070684_100042466 Ga0070684_1000424662 252
22 3300005548 Ga0070665_100222134 Ga0070665_1002221342 252
23 3300005578 Ga0068854_100076320 Ga0068854_1000763202 252
24 3300005616 Ga0068852_100131459 Ga0068852_1001314591 252
25 3300005618 Ga0068864_100167090 Ga0068864_1001670902 252
26 3300005719 Ga0068861_100192734 Ga0068861_1001927342 252
27 3300005842 Ga0068858_100040358 Ga0068858_1000403585 252
28 3300009174 Ga0105241_10054043 Ga0105241_100540432 252
29 3300009177 Ga0105248_10481541 Ga0105248_104815412 252
30 3300013297 Ga0157378_10401142 Ga0157378_104011422 252
31 3300013306 Ga0163162_10352641 Ga0163162_103526411 252
32 3300013307 Ga0157372_10097036 Ga0157372_100970362 252
33 3300014325 Ga0163163_10080560 Ga0163163_100805603 252
34 3300025903 Ga0207680_10075123 Ga0207680_100751232 252
35 3300025909 Ga0207705_10147245 Ga0207705_101472451 252
36 3300026023 Ga0207677_10182372 Ga0207677_101823722 252
37 3300026035 Ga0207703_10158300 Ga0207703_101583002 252
38 3300026095 Ga0207676_10119532 Ga0207676_101195322 252
39 3300028379 Ga0268266_10152934 Ga0268266_101529342 252
40 3300047471 Ga0495684_0150810 Ga0495684_0150810_49_807 252
41 3300046462 Ga0495651_0393266 Ga0495651_0393266_21_797 253
42 3300031456 Ga0307513_10074353 Ga0307513_100743534 254
43 3300049570 Ga0501033_0221425 Ga0501033_0221425_137_1039 254
44 3300009176 Ga0105242_10020314 Ga0105242_100203144 256
45 3300025934 Ga0207686_10038384 Ga0207686_100383842 256
46 3300046794 Ga0495589_0075812 Ga0495589_0075812_35_913 256
47 3300049575 Ga0501039_0000908 Ga0501039_0000908_20811_21584 257
48 3300005530 Ga0070679_100146277 Ga0070679_1001462772 258
49 3300009093 Ga0105240_10118849 Ga0105240_101188494 258
50 3300009098 Ga0105245_10054003 Ga0105245_100540032 258
51 3300009174 Ga0105241_10022485 Ga0105241_100224855 258
52 3300013105 Ga0157369_10003278 Ga0157369_1000327821 258
53 3300013297 Ga0157378_10198260 Ga0157378_101982602 258
54 3300025927 Ga0207687_10031945 Ga0207687_100319452 258
55 3300026041 Ga0207639_10037822 Ga0207639_100378223 258
56 3300039437 Ga0436365_0198870 Ga0436365_0198870_968_1801 258
57 3300049570 Ga0501033_0040252 Ga0501033_0040252_1871_2704 258
58 3300049571 Ga0501034_0075832 Ga0501034_0075832_810_1643 258
59 3300049572 Ga0501036_0405997 Ga0501036_0405997_243_1076 258
60 3300049579 Ga0501043_0172573 Ga0501043_0172573_294_1127 258
61 3300049580 Ga0501046_0019814 Ga0501046_0019814_3322_4155 258
62 3300049581 Ga0501047_0007651 Ga0501047_0007651_4307_5140 258
63 3300049589 Ga0501073_0065942 Ga0501073_0065942_1179_2012 258
64 3300049822 Ga0501035_0017234 Ga0501035_0017234_61_894 258
65 3300049823 Ga0501044_0581366 Ga0501044_0581366_76_909 258
66 3300049823 Ga0501044_0719762 Ga0501044_0719762_22_855 258
67 3300005344 Ga0070661_100014282 Ga0070661_1000142822 259
68 3300013297 Ga0157378_10051537 Ga0157378_100515374 259
69 3300025920 Ga0207649_10030222 Ga0207649_100302224 259
70 3300028577 Ga0265318_10001785 Ga0265318_100017852 259
71 3300031235 Ga0265330_10040068 Ga0265330_100400682 259
72 3300031241 Ga0265325_10148880 Ga0265325_101488801 259
73 3300031250 Ga0265331_10040757 Ga0265331_100407572 259
74 3300031595 Ga0265313_10000757 Ga0265313_1000075728 259
75 3300049570 Ga0501033_0065827 Ga0501033_0065827_846_1727 259
76 3300049573 Ga0501037_0076763 Ga0501037_0076763_606_1487 259
77 3300049574 Ga0501038_0121637 Ga0501038_0121637_181_1062 259
78 3300049581 Ga0501047_0211563 Ga0501047_0211563_535_1416 259
79 3300049822 Ga0501035_0101239 Ga0501035_0101239_353_1234 259
80 3300049823 Ga0501044_0205458 Ga0501044_0205458_461_1342 259
81 3300005335 Ga0070666_10345016 Ga0070666_103450161 260
82 3300038735 Ga0400485_06984 Ga0400485_06984_10218_11093 260
83 3300038742 Ga0400486_00966 Ga0400486_00966_1224_2099 260
84 3300038726 Ga0400490_31308 Ga0400490_31308_4588_5496 262
85 3300005471 Ga0070698_100284442 Ga0070698_1002844423 263
86 3300005518 Ga0070699_100130736 Ga0070699_1001307362 263
87 3300031548 Ga0307408_100141032 Ga0307408_1001410323 263
88 3300031665 Ga0316575_10039379 Ga0316575_100393792 263
89 3300031911 Ga0307412_10154109 Ga0307412_101541092 263
90 3300042436 Ga0439435_0069861 Ga0439435_0069861_117_968 263
91 3300048925 Ga0496122_0197236 Ga0496122_0197236_142_1029 263
92 3300049582 Ga0501048_0120238 Ga0501048_0120238_99_947 263
93 3300005347 Ga0070668_100004875 Ga0070668_1000048754 264
94 3300005455 Ga0070663_100002126 Ga0070663_1000021262 264
95 3300025972 Ga0207668_10001856 Ga0207668_100018569 264
96 3300026067 Ga0207678_10000442 Ga0207678_100004428 264
97 3300026121 Ga0207683_10100074 Ga0207683_101000741 264
98 3300030522 Ga0307512_10231252 Ga0307512_102312521 264
99 3300031838 Ga0307518_10000376 Ga0307518_1000037619 264
100 3300033179 Ga0307507_10035329 Ga0307507_100353295 264
101 3300033180 Ga0307510_10034631 Ga0307510_100346315 264
102 3300035398 Ga0316574_0051175 Ga0316574_0051175_33_899 264
103 iso_pu_bacteria 2585427649 2586062642 264
104 iso_pu_bacteria 2808606522 2809588177 264
105 iso_pu_bacteria 2915768154 2915773701 264
106 iso_pu_bacteria 2917736166 2917741733 264
107 iso_pu_bacteria 8003314358 8003316772 264
108 3300005339 Ga0070660_100220279 Ga0070660_1002202792 265
109 3300005341 Ga0070691_10105788 Ga0070691_101057881 265
110 3300005366 Ga0070659_100160886 Ga0070659_1001608861 265
111 3300005563 Ga0068855_100088273 Ga0068855_1000882732 265
112 3300006358 Ga0068871_100140116 Ga0068871_1001401163 265
113 3300013104 Ga0157370_10186313 Ga0157370_101863132 265
114 3300049568 Ga0501031_0004159 Ga0501031_0004159_2551_3405 265
115 3300049569 Ga0501032_0006464 Ga0501032_0006464_1285_2139 265
116 3300049570 Ga0501033_0008095 Ga0501033_0008095_1555_2409 265
117 3300049570 Ga0501033_0019893 Ga0501033_0019893_526_1380 265
118 3300049570 Ga0501033_0088316 Ga0501033_0088316_983_1837 265
119 3300049570 Ga0501033_0172205 Ga0501033_0172205_467_1321 265
120 3300049570 Ga0501033_0242006 Ga0501033_0242006_152_1006 265
121 3300049571 Ga0501034_0001944 Ga0501034_0001944_7715_8569 265
122 3300049571 Ga0501034_0187203 Ga0501034_0187203_968_1822 265
123 3300049571 Ga0501034_0660194 Ga0501034_0660194_58_912 265
124 3300049572 Ga0501036_0005092 Ga0501036_0005092_3043_3897 265
125 3300049574 Ga0501038_0020493 Ga0501038_0020493_745_1599 265
126 3300049578 Ga0501042_0039064 Ga0501042_0039064_21_875 265
127 3300049579 Ga0501043_0038281 Ga0501043_0038281_710_1564 265
128 3300049580 Ga0501046_0000928 Ga0501046_0000928_17560_18414 265
129 3300049581 Ga0501047_0002500 Ga0501047_0002500_2968_3822 265
130 3300049581 Ga0501047_0019157 Ga0501047_0019157_1845_2699 265
131 3300049581 Ga0501047_0032937 Ga0501047_0032937_183_1043 265
132 3300049581 Ga0501047_0089462 Ga0501047_0089462_1085_1939 265
133 3300049581 Ga0501047_0340310 Ga0501047_0340310_199_1053 265
134 3300049582 Ga0501048_0001187 Ga0501048_0001187_10902_11756 265
135 3300049583 Ga0501067_0002800 Ga0501067_0002800_8114_8968 265
136 3300049584 Ga0501068_0022887 Ga0501068_0022887_2740_3594 265
137 3300049585 Ga0501069_0000338 Ga0501069_0000338_8561_9415 265
138 3300049586 Ga0501070_0002903 Ga0501070_0002903_7342_8196 265
139 3300049588 Ga0501072_0124218 Ga0501072_0124218_258_1112 265
140 3300049589 Ga0501073_0003741 Ga0501073_0003741_4092_4946 265
141 3300049590 Ga0501074_0008507 Ga0501074_0008507_4888_5742 265
142 3300049741 Ga0501079_0026731 Ga0501079_0026731_2183_3037 265
143 3300049742 Ga0501080_0004691 Ga0501080_0004691_8841_9695 265
144 3300049742 Ga0501080_0180455 Ga0501080_0180455_796_1650 265
145 3300049744 Ga0501083_0004389 Ga0501083_0004389_6741_7595 265
146 3300049822 Ga0501035_0017668 Ga0501035_0017668_1246_2106 265
147 3300049822 Ga0501035_0131395 Ga0501035_0131395_20_874 265
148 3300049822 Ga0501035_0317792 Ga0501035_0317792_35_889 265
149 3300049822 Ga0501035_0533925 Ga0501035_0533925_15_869 265
150 3300049823 Ga0501044_0002060 Ga0501044_0002060_4431_5291 265
151 3300049823 Ga0501044_0097712 Ga0501044_0097712_2065_2919 265
152 3300049824 Ga0501045_0008767 Ga0501045_0008767_5479_6333 265
153 3300054114 Ga0501084_0001251 Ga0501084_0001251_16767_17621 265
154 3300060353 Ga0501082_0034550 Ga0501082_0034550_1581_2435 265
155 3300060353 Ga0501082_0310717 Ga0501082_0310717_18_872 265
156 3300005329 Ga0070683_100107341 Ga0070683_1001073413 266
157 3300005546 Ga0070696_100066186 Ga0070696_1000661862 266
158 3300028794 Ga0307515_10000123 Ga0307515_10000123146 266
159 3300028794 Ga0307515_10018885 Ga0307515_100188859 266
160 3300031456 Ga0307513_10071416 Ga0307513_100714162 266
161 3300031665 Ga0316575_10007710 Ga0316575_100077104 266
162 3300031691 Ga0316579_10003704 Ga0316579_100037045 266
163 3300031728 Ga0316578_10128277 Ga0316578_101282772 266
164 3300031733 Ga0316577_10132188 Ga0316577_101321881 266
165 3300032133 Ga0316583_10014027 Ga0316583_100140273 266
166 3300032137 Ga0316585_10017204 Ga0316585_100172043 266
167 3300032139 Ga0316580_10008164 Ga0316580_100081642 266
168 3300036647 Ga0316582_0013088 Ga0316582_0013088_3400_4323 266
169 3300036712 Ga0316584_0071703 Ga0316584_0071703_145_1068 266
170 iso_pu_bacteria 2582580736 2583153342 266
171 iso_pu_bacteria 2585428062 2587758083 266
172 iso_pu_bacteria 2863067949 2863071351 266
173 iso_pu_bacteria 2866612099 2866618511 266
174 iso_pu_bacteria 8056207758 8056207776 266
175 3300005518 Ga0070699_100460891 Ga0070699_1004608911 267
176 3300005616 Ga0068852_100019746 Ga0068852_1000197463 267
177 3300020082 Ga0206353_10549273 Ga0206353_105492733 267
178 3300026142 Ga0207698_10006997 Ga0207698_100069974 267
179 3300044693 Ga0466961_0106706 Ga0466961_0106706_259_1224 267
180 3300049570 Ga0501033_0036156 Ga0501033_0036156_1578_2486 267
181 3300049822 Ga0501035_0083365 Ga0501035_0083365_1654_2562 267
182 3300049823 Ga0501044_0285991 Ga0501044_0285991_570_1478 267
183 3300005329 Ga0070683_100092324 Ga0070683_1000923242 268
184 3300005458 Ga0070681_10364717 Ga0070681_103647172 268
185 3300013100 Ga0157373_10318067 Ga0157373_103180672 268
186 3300020082 Ga0206353_11306600 Ga0206353_113066002 268
187 3300025949 Ga0207667_10314455 Ga0207667_103144551 268
188 3300030522 Ga0307512_10027900 Ga0307512_100279004 268
189 3300031456 Ga0307513_10177778 Ga0307513_101777782 268
190 3300036712 Ga0316584_0407841 Ga0316584_0407841_60_935 268
191 3300038727 Ga0400491_26268 Ga0400491_26268_1308_2183 268
192 3300038735 Ga0400485_07748 Ga0400485_07748_3656_4531 268
193 3300038742 Ga0400486_01623 Ga0400486_01623_4248_5123 268
194 3300039093 Ga0400489_08878 Ga0400489_08878_4101_4976 268
195 3300039110 Ga0400487_04533 Ga0400487_04533_18580_19455 268
196 3300039110 Ga0400487_35172 Ga0400487_35172_4181_5056 268
197 3300049589 Ga0501073_0327583 Ga0501073_0327583_35_910 268
198 3300053085 Ga0495619_0039846 Ga0495619_0039846_335_1258 268
199 3300054114 Ga0501084_0000375 Ga0501084_0000375_31794_32666 268
200 3300005563 Ga0068855_100000529 Ga0068855_1000005295 269
201 3300005616 Ga0068852_100003179 Ga0068852_1000031799 269
202 3300009093 Ga0105240_10000055 Ga0105240_10000055198 269
203 3300009174 Ga0105241_10037299 Ga0105241_100372992 269
204 3300009177 Ga0105248_10000001 Ga0105248_100000011767 269
205 3300009551 Ga0105238_10006649 Ga0105238_100066499 269
206 3300010375 Ga0105239_10001057 Ga0105239_1000105720 269
207 3300010375 Ga0105239_10005950 Ga0105239_100059506 269
208 3300013306 Ga0163162_10220711 Ga0163162_102207112 269
209 3300014969 Ga0157376_10202977 Ga0157376_102029772 269
210 3300025913 Ga0207695_10000012 Ga0207695_10000012139 269
211 3300025924 Ga0207694_10000006 Ga0207694_10000006526 269
212 3300025941 Ga0207711_10000001 Ga0207711_10000001105 269
213 3300025949 Ga0207667_10000026 Ga0207667_10000026255 269
214 3300026142 Ga0207698_10007799 Ga0207698_100077994 269
215 3300028577 Ga0265318_10000149 Ga0265318_1000014938 269
216 3300031250 Ga0265331_10039331 Ga0265331_100393312 269
217 3300031344 Ga0265316_10027475 Ga0265316_100274752 269
218 3300031727 Ga0316576_10003035 Ga0316576_100030353 269
219 3300031727 Ga0316576_10004532 Ga0316576_100045324 269
220 3300031728 Ga0316578_10000481 Ga0316578_1000048114 269
221 3300031728 Ga0316578_10010470 Ga0316578_100104704 269
222 3300031733 Ga0316577_10003164 Ga0316577_100031645 269
223 3300032133 Ga0316583_10040669 Ga0316583_100406691 269
224 3300032137 Ga0316585_10000539 Ga0316585_100005397 269
225 3300032139 Ga0316580_10005182 Ga0316580_100051822 269
226 3300035398 Ga0316574_0008845 Ga0316574_0008845_1068_1946 269
227 3300035398 Ga0316574_0045314 Ga0316574_0045314_191_1195 269
228 3300036647 Ga0316582_0002166 Ga0316582_0002166_5064_5942 269
229 3300036712 Ga0316584_0001840 Ga0316584_0001840_8366_9244 269
230 3300039437 Ga0436365_0704399 Ga0436365_0704399_94_981 269
231 3300044693 Ga0466961_0005851 Ga0466961_0005851_6645_7559 269
232 3300046516 Ga0495628_0280343 Ga0495628_0280343_130_1014 269
233 3300046529 Ga0495652_0231649 Ga0495652_0231649_82_960 269
234 3300046689 Ga0495613_0136081 Ga0495613_0136081_541_1407 269
235 3300048929 Ga0496126_0001104 Ga0496126_0001104_3519_4400 269
236 3300049460 Ga0495682_0068266 Ga0495682_0068266_249_1124 269
237 3300049569 Ga0501032_0084048 Ga0501032_0084048_112_990 269
238 3300049571 Ga0501034_0020633 Ga0501034_0020633_5274_6152 269
239 3300049581 Ga0501047_0119175 Ga0501047_0119175_955_1821 269
240 3300049583 Ga0501067_0000575 Ga0501067_0000575_5547_6413 269
241 3300049583 Ga0501067_0011767 Ga0501067_0011767_646_1524 269
242 3300049586 Ga0501070_0018239 Ga0501070_0018239_1332_2210 269
243 3300049588 Ga0501072_0021856 Ga0501072_0021856_3377_4243 269
244 3300049588 Ga0501072_0435180 Ga0501072_0435180_12_890 269
245 3300049589 Ga0501073_0007430 Ga0501073_0007430_1349_2215 269
246 3300049589 Ga0501073_0032453 Ga0501073_0032453_908_1786 269
247 3300049741 Ga0501079_0021118 Ga0501079_0021118_810_1688 269
248 3300049742 Ga0501080_0092804 Ga0501080_0092804_501_1379 269
249 3300049822 Ga0501035_0014767 Ga0501035_0014767_3493_4371 269
250 3300049823 Ga0501044_0013132 Ga0501044_0013132_333_1211 269
251 3300053154 Ga0500619_023657 Ga0500619_023657_243_1118 269
252 3300054114 Ga0501084_0009845 Ga0501084_0009845_3703_4581 269
253 3300054114 Ga0501084_0043106 Ga0501084_0043106_158_1024 269
254 3300003775 Ga0055524_1000125 Ga0055524_10001258 270
255 3300003775 Ga0055524_1001949 Ga0055524_10019492 270
256 3300003791 Ga0055530_10000470 Ga0055530_1000047012 270
257 3300003791 Ga0055530_10000982 Ga0055530_1000098222 270
258 3300003792 Ga0055540_1000011 Ga0055540_100001175 270
259 3300003794 Ga0055531_10006358 Ga0055531_100063583 270
260 3300005435 Ga0070714_100006279 Ga0070714_1000062794 270
261 3300006946 Ga0079104_1000465 Ga0079104_100046516 270
262 3300021388 Ga0213875_10003010 Ga0213875_100030105 270
263 3300025263 Ga0209565_1010883 Ga0209565_10108831 270
264 3300025298 Ga0209050_1000532 Ga0209050_100053222 270
265 3300025298 Ga0209050_1002916 Ga0209050_100291611 270
266 3300025299 Ga0209256_1000113 Ga0209256_100011390 270
267 3300025303 Ga0209051_1000020 Ga0209051_100002074 270
268 3300025304 Ga0209257_1000085 Ga0209257_100008574 270
269 3300025929 Ga0207664_10005792 Ga0207664_100057929 270
270 3300027111 Ga0209281_1000195 Ga0209281_100019533 270
271 3300027876 Ga0209974_10011278 Ga0209974_100112782 270
272 3300028556 Ga0265337_1001356 Ga0265337_10013565 270
273 3300028573 Ga0265334_10002334 Ga0265334_100023342 270
274 3300028800 Ga0265338_10029699 Ga0265338_100296992 270
275 3300030522 Ga0307512_10108440 Ga0307512_101084402 270
276 3300031456 Ga0307513_10017114 Ga0307513_100171142 270
277 3300031456 Ga0307513_10344365 Ga0307513_103443651 270
278 3300031649 Ga0307514_10015662 Ga0307514_100156623 270
279 3300031711 Ga0265314_10052245 Ga0265314_100522452 270
280 3300031727 Ga0316576_10000837 Ga0316576_100008377 270
281 3300031728 Ga0316578_10010371 Ga0316578_100103714 270
282 3300031730 Ga0307516_10020560 Ga0307516_100205603 270
283 3300037588 Ga0316581_0017017 Ga0316581_0017017_645_1547 270
284 3300037853 Ga0436364_0896138 Ga0436364_0896138_22800_23735 270
285 3300038725 Ga0400484_27811 Ga0400484_27811_4021_4890 270
286 3300038726 Ga0400490_51610 Ga0400490_51610_385_1254 270
287 3300041404 Ga0439436_0003702 Ga0439436_0003702_198_1058 270
288 3300041406 Ga0439439_0003783 Ga0439439_0003783_2007_2867 270
289 3300042014 Ga0439457_001353 Ga0439457_001353_5543_6403 270
290 3300042121 Ga0450919_001212 Ga0450919_001212_671_1555 270
291 3300042131 Ga0450894_000487 Ga0450894_000487_4117_5022 270
292 3300042135 Ga0450899_000635 Ga0450899_000635_1415_2320 270
293 3300042435 Ga0439434_0066787 Ga0439434_0066787_141_1025 270
294 3300042531 Ga0450918_000071 Ga0450918_000071_14_898 270
295 3300045049 Ga0466959_0271661 Ga0466959_0271661_51_989 270
296 3300046512 Ga0495610_0065508 Ga0495610_0065508_653_1528 270
297 3300046522 Ga0495643_0033285 Ga0495643_0033285_209_1084 270
298 3300046660 Ga0495625_0000990 Ga0495625_0000990_2620_3495 270
299 3300046692 Ga0495671_0138531 Ga0495671_0138531_176_1051 270
300 3300047318 Ga0495636_0006555 Ga0495636_0006555_1997_2863 270
301 3300047443 Ga0495687_006538 Ga0495687_006538_3470_4336 270
302 3300048905 Ga0496102_0000331 Ga0496102_0000331_47698_48597 270
303 3300048905 Ga0496102_0010679 Ga0496102_0010679_1340_2278 270
304 3300048906 Ga0496103_0021436 Ga0496103_0021436_181_1080 270
305 3300048917 Ga0496114_0003561 Ga0496114_0003561_5940_6824 270
306 3300049571 Ga0501034_0448555 Ga0501034_0448555_20_901 270
307 iso_pu_bacteria 2643221644 2644248240 270
308 iso_pu_bacteria 2643221670 2644385536 270
309 iso_pu_bacteria 2784746763 2785344058 270
310 iso_pu_bacteria 2873151551 2873156426 270
311 3300028794 Ga0307515_10174876 Ga0307515_101748762 271
312 3300031456 Ga0307513_10014726 Ga0307513_100147262 271
313 3300031649 Ga0307514_10015139 Ga0307514_100151398 271
314 3300031665 Ga0316575_10005400 Ga0316575_100054003 271
315 3300031691 Ga0316579_10088414 Ga0316579_100884142 271
316 3300031727 Ga0316576_10001885 Ga0316576_100018858 271
317 3300031727 Ga0316576_10194612 Ga0316576_101946122 271
318 3300031728 Ga0316578_10022534 Ga0316578_100225342 271
319 3300031728 Ga0316578_10137122 Ga0316578_101371222 271
320 3300032133 Ga0316583_10009058 Ga0316583_100090585 271
321 3300032137 Ga0316585_10095014 Ga0316585_100950141 271
322 3300033179 Ga0307507_10018099 Ga0307507_100180995 271
323 3300035398 Ga0316574_0011686 Ga0316574_0011686_2818_3750 271
324 3300035398 Ga0316574_0109984 Ga0316574_0109984_373_1302 271
325 3300036647 Ga0316582_0096226 Ga0316582_0096226_271_1158 271
326 3300036712 Ga0316584_0005975 Ga0316584_0005975_4248_5135 271
327 3300036712 Ga0316584_0056723 Ga0316584_0056723_104_991 271
328 3300036712 Ga0316584_0123743 Ga0316584_0123743_382_1266 271
329 3300039062 Ga0400483_077455 Ga0400483_077455_827_1714 271
330 3300041404 Ga0439436_0004032 Ga0439436_0004032_1194_2069 271
331 3300041406 Ga0439439_0004751 Ga0439439_0004751_925_1800 271
332 3300041512 Ga0451853_0034159 Ga0451853_0034159_329_1210 271
333 3300041999 Ga0439433_0009056 Ga0439433_0009056_40_915 271
334 3300042014 Ga0439457_003193 Ga0439457_003193_2800_3675 271
335 3300042015 Ga0439462_0005937 Ga0439462_0005937_1968_2843 271
336 3300046454 Ga0495592_0008020 Ga0495592_0008020_384_1256 271
337 3300046459 Ga0495629_0080985 Ga0495629_0080985_229_1101 271
338 3300046462 Ga0495651_0016521 Ga0495651_0016521_2555_3427 271
339 3300046463 Ga0495653_0069989 Ga0495653_0069989_759_1631 271
340 3300046476 Ga0495662_0033617 Ga0495662_0033617_1449_2321 271
341 3300046516 Ga0495628_0129113 Ga0495628_0129113_897_1769 271
342 3300046529 Ga0495652_0042608 Ga0495652_0042608_1625_2497 271
343 3300046535 Ga0495586_0090813 Ga0495586_0090813_285_1157 271
344 3300046536 Ga0495587_0006177 Ga0495587_0006177_5433_6305 271
345 3300046559 Ga0495667_0072253 Ga0495667_0072253_767_1639 271
346 3300046663 Ga0495635_0024955 Ga0495635_0024955_2278_3150 271
347 3300046674 Ga0495588_0170600 Ga0495588_0170600_62_934 271
348 3300046680 Ga0495646_0001039 Ga0495646_0001039_13144_14016 271
349 3300046689 Ga0495613_0054375 Ga0495613_0054375_1290_2162 271
350 3300046809 Ga0495600_0006928 Ga0495600_0006928_702_1574 271
351 3300047319 Ga0495674_0102132 Ga0495674_0102132_505_1377 271
352 3300047321 Ga0495676_0013737 Ga0495676_0013737_4084_4956 271
353 3300047673 Ga0495593_0004425 Ga0495593_0004425_5309_6181 271
354 3300048088 Ga0495602_0036614 Ga0495602_0036614_1382_2254 271
355 3300048089 Ga0495614_0006580 Ga0495614_0006580_213_1085 271
356 3300053095 Ga0500640_015413 Ga0500640_015413_1627_2499 271
357 3300053101 Ga0500553_022913 Ga0500553_022913_1093_1965 271
358 iso_pu_bacteria 2643221587 2643944537 271
359 iso_pu_bacteria 2643221677 2644431435 271
360 iso_pu_bacteria 2852635781 2852641925 271
361 iso_pu_bacteria 2918501144 2918503972 271
362 3300005327 Ga0070658_10019015 Ga0070658_100190152 272
363 3300005334 Ga0068869_100087313 Ga0068869_1000873133 272
364 3300005335 Ga0070666_10014615 Ga0070666_100146153 272
365 3300005344 Ga0070661_100070230 Ga0070661_1000702302 272
366 3300005457 Ga0070662_100098265 Ga0070662_1000982653 272
367 3300005530 Ga0070679_100181044 Ga0070679_1001810442 272
368 3300005564 Ga0070664_100117185 Ga0070664_1001171852 272
369 3300005577 Ga0068857_100147745 Ga0068857_1001477451 272
370 3300005617 Ga0068859_100094899 Ga0068859_1000948992 272
371 3300005618 Ga0068864_100029974 Ga0068864_1000299743 272
372 3300005841 Ga0068863_100000329 Ga0068863_10000032934 272
373 3300005843 Ga0068860_100001239 Ga0068860_10000123913 272
374 3300005843 Ga0068860_100167261 Ga0068860_1001672613 272
375 3300006881 Ga0068865_100112234 Ga0068865_1001122342 272
376 3300006931 Ga0097620_100094904 Ga0097620_1000949042 272
377 3300010375 Ga0105239_10009775 Ga0105239_100097754 272
378 3300010375 Ga0105239_10390480 Ga0105239_103904802 272
379 3300013307 Ga0157372_10002133 Ga0157372_100021335 272
380 3300014325 Ga0163163_10000589 Ga0163163_1000058933 272
381 3300014325 Ga0163163_10000949 Ga0163163_100009494 272
382 3300014968 Ga0157379_10004509 Ga0157379_100045095 272
383 3300025903 Ga0207680_10000055 Ga0207680_1000005522 272
384 3300025903 Ga0207680_10135284 Ga0207680_101352842 272
385 3300025904 Ga0207647_10001611 Ga0207647_1000161110 272
386 3300025913 Ga0207695_10000295 Ga0207695_1000029552 272
387 3300025914 Ga0207671_10007226 Ga0207671_100072264 272
388 3300025914 Ga0207671_10152670 Ga0207671_101526702 272
389 3300025917 Ga0207660_10296679 Ga0207660_102966792 272
390 3300025920 Ga0207649_10001154 Ga0207649_100011543 272
391 3300025920 Ga0207649_10151701 Ga0207649_101517012 272
392 3300025921 Ga0207652_10095039 Ga0207652_100950393 272
393 3300025924 Ga0207694_10116323 Ga0207694_101163232 272
394 3300025933 Ga0207706_10033851 Ga0207706_100338515 272
395 3300025942 Ga0207689_10077006 Ga0207689_100770065 272
396 3300025949 Ga0207667_10005003 Ga0207667_1000500315 272
397 3300026088 Ga0207641_10028963 Ga0207641_100289634 272
398 3300026116 Ga0207674_10001063 Ga0207674_1000106332 272
399 3300047472 Ga0495686_0029248 Ga0495686_0029248_150_1016 272
400 iso_pu_bacteria 2554235005 2554258429 272
401 iso_pu_bacteria 2616644814 2616697655 272
402 iso_pu_bacteria 2802429296 2804845014 272
403 iso_pu_bacteria 2808606982 2811848410 272
404 iso_pu_bacteria 2862290372 2862295710 272
405 iso_pu_bacteria 2862382967 2862387578 272
406 iso_pu_bacteria 2912757875 2912760079 272
407 iso_pu_bacteria 8008558824 8008559752 272
408 iso_pu_bacteria 8025413630 8025418975 272
409 3300009092 Ga0105250_10019755 Ga0105250_100197552 273
410 3300009177 Ga0105248_10628547 Ga0105248_106285471 273
411 3300030521 Ga0307511_10000477 Ga0307511_1000047724 273
412 3300030522 Ga0307512_10030676 Ga0307512_100306763 273
413 3300031456 Ga0307513_10057319 Ga0307513_100573194 273
414 3300031507 Ga0307509_10009963 Ga0307509_100099635 273
415 3300031507 Ga0307509_10096821 Ga0307509_100968213 273
416 3300031730 Ga0307516_10034989 Ga0307516_100349894 273
417 3300037466 Ga0395898_0035553 Ga0395898_0035553_1825_2688 273
418 3300046452 Ga0495617_011356 Ga0495617_011356_847_1719 273
419 3300046455 Ga0495603_0040823 Ga0495603_0040823_314_1186 273
420 3300046459 Ga0495629_0009617 Ga0495629_0009617_1004_1879 273
421 3300046459 Ga0495629_0042604 Ga0495629_0042604_1552_2424 273
422 3300046459 Ga0495629_0088166 Ga0495629_0088166_1253_2125 273
423 3300046460 Ga0495638_0056895 Ga0495638_0056895_108_980 273
424 3300046462 Ga0495651_0055301 Ga0495651_0055301_1589_2461 273
425 3300046472 Ga0495580_0226943 Ga0495580_0226943_192_1064 273
426 3300046473 Ga0495582_0060789 Ga0495582_0060789_608_1480 273
427 3300046474 Ga0495605_0010454 Ga0495605_0010454_4275_5147 273
428 3300046492 Ga0495585_0003711 Ga0495585_0003711_6039_6923 273
429 3300046492 Ga0495585_0101034 Ga0495585_0101034_222_1094 273
430 3300046499 Ga0495594_0020165 Ga0495594_0020165_2174_3046 273
431 3300046500 Ga0495596_0042641 Ga0495596_0042641_872_1744 273
432 3300046501 Ga0495607_0034738 Ga0495607_0034738_1570_2442 273
433 3300046507 Ga0495606_0065930 Ga0495606_0065930_566_1438 273
434 3300046513 Ga0495616_0049594 Ga0495616_0049594_22_894 273
435 3300046514 Ga0495618_0079366 Ga0495618_0079366_219_1091 273
436 3300046514 Ga0495618_0236669 Ga0495618_0236669_74_946 273
437 3300046515 Ga0495620_0023355 Ga0495620_0023355_1919_2791 273
438 3300046515 Ga0495620_0080750 Ga0495620_0080750_318_1190 273
439 3300046515 Ga0495620_0097889 Ga0495620_0097889_132_1004 273
440 3300046518 Ga0495631_0004707 Ga0495631_0004707_4928_5800 273
441 3300046522 Ga0495643_0006842 Ga0495643_0006842_1387_2259 273
442 3300046528 Ga0495642_0128126 Ga0495642_0128126_26_898 273
443 3300046529 Ga0495652_0062020 Ga0495652_0062020_482_1354 273
444 3300046530 Ga0495654_0044614 Ga0495654_0044614_111_983 273
445 3300046533 Ga0495640_0003870 Ga0495640_0003870_10668_11540 273
446 3300046533 Ga0495640_0030392 Ga0495640_0030392_2168_3052 273
447 3300046538 Ga0495609_0021000 Ga0495609_0021000_1764_2636 273
448 3300046542 Ga0495597_0026120 Ga0495597_0026120_225_1097 273
449 3300046558 Ga0495633_0020737 Ga0495633_0020737_1219_2091 273
450 3300046559 Ga0495667_0138279 Ga0495667_0138279_273_1145 273
451 3300046616 Ga0495668_0032366 Ga0495668_0032366_861_1733 273
452 3300046663 Ga0495635_0046803 Ga0495635_0046803_1908_2780 273
453 3300046663 Ga0495635_0102549 Ga0495635_0102549_153_1025 273
454 3300046665 Ga0495661_0032971 Ga0495661_0032971_2264_3136 273
455 3300046674 Ga0495588_0008854 Ga0495588_0008854_890_1762 273
456 3300046675 Ga0495657_0028974 Ga0495657_0028974_1865_2737 273
457 3300046675 Ga0495657_0035922 Ga0495657_0035922_39_911 273
458 3300046679 Ga0495623_0097418 Ga0495623_0097418_888_1760 273
459 3300046689 Ga0495613_0020348 Ga0495613_0020348_1423_2295 273
460 3300046689 Ga0495613_0042223 Ga0495613_0042223_114_986 273
461 3300046689 Ga0495613_0161908 Ga0495613_0161908_383_1255 273
462 3300046691 Ga0495670_0030384 Ga0495670_0030384_914_1786 273
463 3300046794 Ga0495589_0029656 Ga0495589_0029656_1459_2331 273
464 3300046794 Ga0495589_0041542 Ga0495589_0041542_437_1309 273
465 3300046809 Ga0495600_0194664 Ga0495600_0194664_129_1001 273
466 3300047315 Ga0495581_0028479 Ga0495581_0028479_1986_2858 273
467 3300047318 Ga0495636_0001203 Ga0495636_0001203_853_1725 273
468 3300047321 Ga0495676_0034152 Ga0495676_0034152_147_1019 273
469 3300047321 Ga0495676_0232604 Ga0495676_0232604_226_1098 273
470 3300047322 Ga0495680_0017759 Ga0495680_0017759_2087_2959 273
471 3300047443 Ga0495687_002438 Ga0495687_002438_9203_10075 273
472 3300047444 Ga0495675_0035650 Ga0495675_0035650_1086_1958 273
473 3300047445 Ga0495677_0017529 Ga0495677_0017529_948_1820 273
474 3300047447 Ga0495685_009879 Ga0495685_009879_1581_2453 273
475 3300047447 Ga0495685_022960 Ga0495685_022960_346_1218 273
476 3300047470 Ga0495681_0045704 Ga0495681_0045704_43_915 273
477 3300047472 Ga0495686_0063265 Ga0495686_0063265_28_900 273
478 3300047673 Ga0495593_0046554 Ga0495593_0046554_1048_1920 273
479 3300048089 Ga0495614_0121132 Ga0495614_0121132_241_1113 273
480 3300048091 Ga0495626_0029348 Ga0495626_0029348_222_1094 273
481 3300048908 Ga0496105_0394712 Ga0496105_0394712_53_925 273
482 3300048912 Ga0496109_0122879 Ga0496109_0122879_1233_2105 273
483 3300049460 Ga0495682_0076005 Ga0495682_0076005_284_1156 273
484 3300049568 Ga0501031_0001472 Ga0501031_0001472_5443_6327 273
485 3300049568 Ga0501031_0033244 Ga0501031_0033244_23_907 273
486 3300049569 Ga0501032_0002016 Ga0501032_0002016_8062_8946 273
487 3300049570 Ga0501033_0012763 Ga0501033_0012763_1475_2359 273
488 3300049570 Ga0501033_0178378 Ga0501033_0178378_73_957 273
489 3300049571 Ga0501034_0034478 Ga0501034_0034478_3358_4344 273
490 3300049571 Ga0501034_0082912 Ga0501034_0082912_131_1015 273
491 3300049572 Ga0501036_0007472 Ga0501036_0007472_683_1567 273
492 3300049572 Ga0501036_0090603 Ga0501036_0090603_658_1644 273
493 3300049572 Ga0501036_0174624 Ga0501036_0174624_818_1702 273
494 3300049573 Ga0501037_0002239 Ga0501037_0002239_7810_8694 273
495 3300049573 Ga0501037_0042415 Ga0501037_0042415_606_1490 273
496 3300049574 Ga0501038_0008550 Ga0501038_0008550_2967_3851 273
497 3300049574 Ga0501038_0114160 Ga0501038_0114160_1024_1908 273
498 3300049574 Ga0501038_0232561 Ga0501038_0232561_206_1192 273
499 3300049575 Ga0501039_0174850 Ga0501039_0174850_122_1006 273
500 3300049576 Ga0501040_0372919 Ga0501040_0372919_96_980 273
501 3300049578 Ga0501042_0056635 Ga0501042_0056635_850_1734 273
502 3300049578 Ga0501042_0218824 Ga0501042_0218824_96_980 273
503 3300049579 Ga0501043_0002408 Ga0501043_0002408_8674_9558 273
504 3300049580 Ga0501046_0143622 Ga0501046_0143622_448_1323 273
505 3300049581 Ga0501047_0000025 Ga0501047_0000025_164302_165186 273
506 3300049581 Ga0501047_0000921 Ga0501047_0000921_6255_7139 273
507 3300049581 Ga0501047_0027128 Ga0501047_0027128_2370_3356 273
508 3300049582 Ga0501048_0004083 Ga0501048_0004083_5903_6787 273
509 3300049583 Ga0501067_0114250 Ga0501067_0114250_394_1278 273
510 3300049584 Ga0501068_0001130 Ga0501068_0001130_8001_8885 273
511 3300049586 Ga0501070_0033496 Ga0501070_0033496_2069_2953 273
512 3300049586 Ga0501070_0099189 Ga0501070_0099189_134_1018 273
513 3300049587 Ga0501071_0001198 Ga0501071_0001198_10217_11101 273
514 3300049588 Ga0501072_0000344 Ga0501072_0000344_13500_14384 273
515 3300049592 Ga0501076_0010690 Ga0501076_0010690_2199_3083 273
516 3300049741 Ga0501079_0016506 Ga0501079_0016506_422_1306 273
517 3300049744 Ga0501083_0019150 Ga0501083_0019150_683_1567 273
518 3300049822 Ga0501035_0021995 Ga0501035_0021995_4600_5586 273
519 3300049822 Ga0501035_0137183 Ga0501035_0137183_755_1639 273
520 3300049823 Ga0501044_0004946 Ga0501044_0004946_6256_7140 273
521 3300049823 Ga0501044_0117543 Ga0501044_0117543_346_1230 273
522 3300049823 Ga0501044_0584006 Ga0501044_0584006_88_972 273
523 3300061734 Ga0530510_0013267 Ga0530510_0013267_4784_5668 273
524 iso_pu_bacteria 2582581313 2585309251 273
525 iso_pu_bacteria 2582581314 2585319767 273
526 iso_pu_bacteria 2616644941 2616905957 273
527 iso_pu_bacteria 2643221548 2643765264 273
528 iso_pu_bacteria 2643221578 2643898060 273
529 iso_pu_bacteria 2643221647 2644263263 273
530 iso_pu_bacteria 2643221673 2644409205 273
531 iso_pu_bacteria 2643221682 2644462665 273
532 iso_pu_bacteria 2784746768 2785368796 273
533 iso_pu_bacteria 2808606375 2808920026 273
534 iso_pu_bacteria 2818991463 2819693515 273
535 iso_pu_bacteria 2862178590 2862184749 273
536 iso_pu_bacteria 2862574272 2862579828 273
537 iso_pu_bacteria 2862705112 2862710178 273
538 iso_pu_bacteria 2867346516 2867349303 273
539 iso_pu_bacteria 2875391855 2875393959 273
540 iso_pu_bacteria 2877676314 2877681716 273
541 iso_pu_bacteria 2912723979 2912724848 273
542 iso_pu_bacteria 2946045630 2946050673 273
543 iso_pu_bacteria 2954380949 2954386866 273
544 iso_pu_bacteria 2954691527 2954697684 273
545 iso_pu_bacteria 2954701450 2954704532 273
546 iso_pu_bacteria 2966598605 2966603127 273
547 iso_pu_bacteria 3006321560 3006321738 273
548 iso_pu_bacteria 3006393351 3006397802 273
549 iso_pu_bacteria 3006493962 3006496323 273
550 iso_pu_bacteria 8008485437 8008487894 273
551 iso_pu_bacteria 8025524527 8025526587 273
552 iso_pu_bacteria 8025530807 8025533266 273
553 iso_pu_bacteria 8056447290 8056451458 273
554 iso_pu_bacteria 8056667051 8056672405 273
555 3300005539 Ga0068853_100134802 Ga0068853_1001348022 274
556 3300006178 Ga0075367_10013040 Ga0075367_100130403 274
557 3300025297 Ga0209758_1006832 Ga0209758_10068324 274
558 3300026041 Ga0207639_10057543 Ga0207639_100575433 274
559 3300030522 Ga0307512_10004449 Ga0307512_100044494 274
560 3300031616 Ga0307508_10004731 Ga0307508_100047314 274
561 3300031616 Ga0307508_10140605 Ga0307508_101406052 274
562 3300031649 Ga0307514_10024583 Ga0307514_100245832 274
563 3300031730 Ga0307516_10024509 Ga0307516_100245095 274
564 3300033179 Ga0307507_10099678 Ga0307507_100996782 274
565 3300033179 Ga0307507_10179740 Ga0307507_101797402 274
566 3300042007 Ga0439449_0079815 Ga0439449_0079815_155_1030 274
567 3300044658 Ga0466972_0009968 Ga0466972_0009968_63_938 274
568 3300044693 Ga0466961_0065796 Ga0466961_0065796_1002_1877 274
569 3300045049 Ga0466959_0178054 Ga0466959_0178054_423_1298 274
570 3300045976 Ga0466967_0098312 Ga0466967_0098312_1672_2538 274
571 3300045976 Ga0466967_0329022 Ga0466967_0329022_16_882 274
572 3300046455 Ga0495603_0008979 Ga0495603_0008979_2713_3594 274
573 3300046459 Ga0495629_0005181 Ga0495629_0005181_406_1281 274
574 3300046474 Ga0495605_0080485 Ga0495605_0080485_197_1078 274
575 3300046501 Ga0495607_0157468 Ga0495607_0157468_31_915 274
576 3300046518 Ga0495631_0076484 Ga0495631_0076484_86_967 274
577 3300046526 Ga0495666_0057086 Ga0495666_0057086_163_1044 274
578 3300046557 Ga0495622_0010612 Ga0495622_0010612_1001_1876 274
579 3300046674 Ga0495588_0227710 Ga0495588_0227710_73_954 274
580 3300046689 Ga0495613_0001088 Ga0495613_0001088_15461_16375 274
581 3300046690 Ga0495624_0154461 Ga0495624_0154461_307_1191 274
582 3300046691 Ga0495670_0004047 Ga0495670_0004047_3200_4084 274
583 3300046691 Ga0495670_0142498 Ga0495670_0142498_163_1044 274
584 3300046692 Ga0495671_0081712 Ga0495671_0081712_172_1056 274
585 3300046794 Ga0495589_0015789 Ga0495589_0015789_2746_3627 274
586 3300046794 Ga0495589_0055002 Ga0495589_0055002_255_1136 274
587 3300046794 Ga0495589_0061613 Ga0495589_0061613_75_959 274
588 3300047443 Ga0495687_111154 Ga0495687_111154_81_965 274
589 3300047446 Ga0495679_026603 Ga0495679_026603_926_1810 274
590 3300047447 Ga0495685_007903 Ga0495685_007903_66_950 274
591 3300047447 Ga0495685_038735 Ga0495685_038735_295_1176 274
592 3300047470 Ga0495681_0001091 Ga0495681_0001091_19701_20585 274
593 3300048089 Ga0495614_0002730 Ga0495614_0002730_188_1102 274
594 3300049569 Ga0501032_0005106 Ga0501032_0005106_2687_3598 274
595 3300049569 Ga0501032_0010731 Ga0501032_0010731_455_1366 274
596 3300049570 Ga0501033_0268821 Ga0501033_0268821_13_924 274
597 3300049572 Ga0501036_0177680 Ga0501036_0177680_43_954 274
598 3300049573 Ga0501037_0018704 Ga0501037_0018704_3049_3960 274
599 3300049574 Ga0501038_0221943 Ga0501038_0221943_287_1198 274
600 3300049575 Ga0501039_0024561 Ga0501039_0024561_690_1601 274
601 3300049579 Ga0501043_0081655 Ga0501043_0081655_1348_2259 274
602 3300049581 Ga0501047_0054939 Ga0501047_0054939_1451_2362 274
603 3300049593 Ga0501077_0033415 Ga0501077_0033415_179_1054 274
604 3300049822 Ga0501035_0005555 Ga0501035_0005555_3064_3975 274
605 3300049822 Ga0501035_0019226 Ga0501035_0019226_5068_5979 274
606 3300049823 Ga0501044_0041906 Ga0501044_0041906_310_1221 274
607 3300049823 Ga0501044_0235589 Ga0501044_0235589_876_1742 274
608 3300049823 Ga0501044_0310807 Ga0501044_0310807_262_1128 274
609 3300050494 nmdc:mga06z11_9505_c1 nmdc:mga06z11_9505_c1_1378_2253 274
610 3300053086 Ga0500578_0031319 Ga0500578_0031319_2380_3264 274
611 3300053099 Ga0500654_034732 Ga0500654_034732_72_956 274
612 3300053107 Ga0500560_023076 Ga0500560_023076_20_904 274
613 3300053109 Ga0500569_016937 Ga0500569_016937_455_1339 274
614 3300053123 Ga0500614_025713 Ga0500614_025713_68_952 274
615 3300053131 Ga0500652_003553 Ga0500652_003553_1056_2099 274
616 3300053134 Ga0500658_0004751 Ga0500658_0004751_1341_2225 274
617 3300053137 Ga0500561_0000736 Ga0500561_0000736_4281_5165 274
618 3300053149 Ga0500600_0136894 Ga0500600_0136894_153_1037 274
619 3300053158 Ga0500627_0150266 Ga0500627_0150266_34_918 274
620 3300053177 Ga0500636_0165813 Ga0500636_0165813_40_924 274
621 3300053732 Ga0500656_005217 Ga0500656_005217_44_928 274
622 iso_pu_bacteria 2862281513 2862287920 274
623 iso_pu_bacteria 2862507626 2862511542 274
624 iso_pu_bacteria 2863404153 2863405321 274
625 iso_pu_bacteria 2867475112 2867475337 274
626 iso_pu_bacteria 2935390628 2935394617 274
627 iso_pu_bacteria 2990044586 2990048558 274
628 iso_pu_bacteria 2997451912 2997456688 274
629 iso_pu_bacteria 2997600082 2997608020 274
630 iso_pu_bacteria 3006425503 3006426790 274
631 iso_pu_bacteria 3006486233 3006489932 274
632 iso_pu_bacteria 8033684223 8033690422 274
633 iso_pu_bacteria 8048406513 8048413329 274
634 iso_pu_bacteria 8056829672 8056830229 274
635 3300003322 rootL2_10041909 rootL2_100419092 275
636 3300003578 Ga0006562J51391_1012167 Ga0006562J51391_10121672 275
637 3300003578 Ga0006562J51391_1012168 Ga0006562J51391_10121682 275
638 3300014497 Ga0182008_10021356 Ga0182008_100213565 275
639 3300015262 Ga0182007_10000885 Ga0182007_1000088511 275
640 3300015688 Ga0183367_1006 Ga0183367_1006274 275
641 3300025302 Ga0207426_1000981 Ga0207426_100098120 275
642 3300031616 Ga0307508_10002336 Ga0307508_100023362 275
643 3300031649 Ga0307514_10010004 Ga0307514_100100047 275
644 3300031730 Ga0307516_10016228 Ga0307516_100162282 275
645 3300033180 Ga0307510_10020300 Ga0307510_100203002 275
646 3300037466 Ga0395898_0004973 Ga0395898_0004973_448_1326 275
647 3300038443 Ga0395901_0578250 Ga0395901_0578250_75_953 275
648 3300041512 Ga0451853_1117734 Ga0451853_1117734_223_1122 275
649 3300041512 Ga0451853_1420060 Ga0451853_1420060_598_1470 275
650 3300042005 Ga0439448_0026804 Ga0439448_0026804_832_1704 275
651 3300042012 Ga0439455_0013856 Ga0439455_0013856_208_1080 275
652 3300042138 Ga0450903_000044 Ga0450903_000044_8823_9695 275
653 3300046454 Ga0495592_0034890 Ga0495592_0034890_1302_2255 275
654 3300046455 Ga0495603_0027757 Ga0495603_0027757_165_1049 275
655 3300046459 Ga0495629_0008226 Ga0495629_0008226_4056_5009 275
656 3300046459 Ga0495629_0093414 Ga0495629_0093414_232_1116 275
657 3300046462 Ga0495651_0051428 Ga0495651_0051428_24_977 275
658 3300046499 Ga0495594_0083629 Ga0495594_0083629_302_1255 275
659 3300046514 Ga0495618_0247349 Ga0495618_0247349_106_1059 275
660 3300046516 Ga0495628_0087105 Ga0495628_0087105_890_1843 275
661 3300046529 Ga0495652_0005221 Ga0495652_0005221_10356_11309 275
662 3300046533 Ga0495640_0001063 Ga0495640_0001063_3770_4723 275
663 3300046642 Ga0495634_0036275 Ga0495634_0036275_1117_2070 275
664 3300046674 Ga0495588_0040166 Ga0495588_0040166_1264_2148 275
665 3300046675 Ga0495657_0002793 Ga0495657_0002793_5507_6460 275
666 3300046689 Ga0495613_0012265 Ga0495613_0012265_3596_4549 275
667 3300046690 Ga0495624_0030537 Ga0495624_0030537_491_1444 275
668 3300046809 Ga0495600_0001432 Ga0495600_0001432_6844_7797 275
669 3300047317 Ga0495604_0003476 Ga0495604_0003476_5479_6432 275
670 3300047321 Ga0495676_0016662 Ga0495676_0016662_2551_3504 275
671 3300049570 Ga0501033_0001270 Ga0501033_0001270_13905_14774 275
672 3300049823 Ga0501044_0057150 Ga0501044_0057150_2128_3030 275
673 iso_pu_bacteria 2547132111 2547406991 275
674 iso_pu_bacteria 2643221678 2644436568 275
675 iso_pu_bacteria 2643221714 2644625596 275
676 iso_pu_bacteria 2767802112 2768646947 275
677 iso_pu_bacteria 2784132148 2784588025 275
678 iso_pu_bacteria 2786546132 2786669894 275
679 iso_pu_bacteria 2791355406 2793981854 275
680 iso_pu_bacteria 2808606359 2808841461 275
681 iso_pu_bacteria 2808606448 2809231625 275
682 iso_pu_bacteria 2811994917 2812481084 275
683 iso_pu_bacteria 2867428634 2867431712 275
684 iso_pu_bacteria 2912715099 2912720682 275
685 iso_pu_bacteria 2919468124 2919473534 275
686 iso_pu_bacteria 2946064051 2946067086 275
687 iso_pu_bacteria 2946072368 2946075382 275
688 iso_pu_bacteria 2947224130 2947230158 275
689 iso_pu_bacteria 2954002825 2954003356 275
690 iso_pu_bacteria 2954673503 2954676323 275
691 iso_pu_bacteria 2954682443 2954687845 275
692 iso_pu_bacteria 2954711539 2954716819 275
693 iso_pu_bacteria 2954721474 2954726767 275
694 iso_pu_bacteria 2954731030 2954735029 275
695 iso_pu_bacteria 2954749733 2954753900 275
696 iso_pu_bacteria 2954759201 2954764663 275
697 iso_pu_bacteria 2990088156 2990093567 275
698 iso_pu_bacteria 8008574985 8008579392 275
699 iso_pu_bacteria 8023623736 8023631031 275
700 iso_pu_bacteria 8025478263 8025482627 275
701 iso_pu_bacteria 8047893842 8047898714 275
702 iso_pu_bacteria 8048127548 8048131512 275
703 iso_pu_bacteria 8048356638 8048360205 275
704 iso_pu_bacteria 8048369669 8048375676 275
705 iso_pu_bacteria 8048379754 8048382529 275
706 iso_pu_bacteria 8054160619 8054162871 275
707 3300003316 rootH1_10045223 rootH1_100452232 276
708 3300003323 rootH1_10025603 rootH1_100256032 276
709 3300025302 Ga0207426_1003579 Ga0207426_10035793 276
710 3300028794 Ga0307515_10000541 Ga0307515_1000054168 276
711 3300030521 Ga0307511_10155622 Ga0307511_101556222 276
712 3300031616 Ga0307508_10365789 Ga0307508_103657891 276
713 3300031649 Ga0307514_10234409 Ga0307514_102344092 276
714 3300033179 Ga0307507_10007895 Ga0307507_100078952 276
715 3300033180 Ga0307510_10142764 Ga0307510_101427642 276
716 3300041509 Ga0451843_0686416 Ga0451843_0686416_279_1160 276
717 3300044656 Ga0466969_0012487 Ga0466969_0012487_3304_4188 276
718 3300044658 Ga0466972_0009323 Ga0466972_0009323_1650_2549 276
719 3300044658 Ga0466972_0029298 Ga0466972_0029298_822_1706 276
720 3300044683 Ga0466965_0028690 Ga0466965_0028690_1667_2551 276
721 3300044684 Ga0466966_0026339 Ga0466966_0026339_1374_2258 276
722 3300044693 Ga0466961_0009568 Ga0466961_0009568_1444_2328 276
723 3300044693 Ga0466961_0050467 Ga0466961_0050467_1526_2425 276
724 3300044694 Ga0466963_0010858 Ga0466963_0010858_585_1469 276
725 3300044694 Ga0466963_0016533 Ga0466963_0016533_200_1081 276
726 3300044706 Ga0466964_0004728 Ga0466964_0004728_3986_4870 276
727 3300044719 Ga0466971_0004505 Ga0466971_0004505_4332_5216 276
728 3300044765 Ga0466970_0007537 Ga0466970_0007537_136_1020 276
729 3300044765 Ga0466970_0026797 Ga0466970_0026797_1601_2482 276
730 3300044765 Ga0466970_0045023 Ga0466970_0045023_666_1565 276
731 3300044842 Ga0466957_0004601 Ga0466957_0004601_3447_4331 276
732 3300044842 Ga0466957_0240331 Ga0466957_0240331_102_983 276
733 3300044901 Ga0466960_0003551 Ga0466960_0003551_3517_4416 276
734 3300045049 Ga0466959_0016300 Ga0466959_0016300_807_1691 276
735 3300045836 Ga0466958_0000949 Ga0466958_0000949_8708_9592 276
736 3300046660 Ga0495625_0010878 Ga0495625_0010878_2935_3816 276
737 3300046674 Ga0495588_0076053 Ga0495588_0076053_206_1087 276
738 3300047470 Ga0495681_0003731 Ga0495681_0003731_9356_10237 276
739 3300049568 Ga0501031_0012912 Ga0501031_0012912_3938_4819 276
740 3300049569 Ga0501032_0052072 Ga0501032_0052072_324_1205 276
741 3300049570 Ga0501033_0193746 Ga0501033_0193746_130_1011 276
742 3300049570 Ga0501033_0199044 Ga0501033_0199044_298_1179 276
743 3300049570 Ga0501033_0313197 Ga0501033_0313197_155_1036 276
744 3300049571 Ga0501034_0001007 Ga0501034_0001007_19904_20776 276
745 3300049571 Ga0501034_0198629 Ga0501034_0198629_185_1066 276
746 3300049571 Ga0501034_0326153 Ga0501034_0326153_277_1158 276
747 3300049572 Ga0501036_0002177 Ga0501036_0002177_12053_12925 276
748 3300049572 Ga0501036_0007043 Ga0501036_0007043_4981_5862 276
749 3300049573 Ga0501037_0028698 Ga0501037_0028698_1927_2808 276
750 3300049573 Ga0501037_0269874 Ga0501037_0269874_38_919 276
751 3300049574 Ga0501038_0010421 Ga0501038_0010421_247_1119 276
752 3300049575 Ga0501039_0340689 Ga0501039_0340689_108_989 276
753 3300049578 Ga0501042_0047649 Ga0501042_0047649_1571_2452 276
754 3300049579 Ga0501043_0099574 Ga0501043_0099574_161_1042 276
755 3300049579 Ga0501043_0147748 Ga0501043_0147748_747_1628 276
756 3300049580 Ga0501046_0102405 Ga0501046_0102405_40_921 276
757 3300049581 Ga0501047_0011628 Ga0501047_0011628_2580_3452 276
758 3300049581 Ga0501047_0109683 Ga0501047_0109683_1418_2299 276
759 3300049581 Ga0501047_0119606 Ga0501047_0119606_37_918 276
760 3300049581 Ga0501047_0157822 Ga0501047_0157822_601_1482 276
761 3300049582 Ga0501048_0122813 Ga0501048_0122813_271_1152 276
762 3300049584 Ga0501068_0068044 Ga0501068_0068044_1052_1924 276
763 3300049586 Ga0501070_0001453 Ga0501070_0001453_19228_20100 276
764 3300049590 Ga0501074_0000798 Ga0501074_0000798_16570_17442 276
765 3300049822 Ga0501035_0003677 Ga0501035_0003677_11189_12061 276
766 3300049822 Ga0501035_0062275 Ga0501035_0062275_1086_1964 276
767 3300049822 Ga0501035_0154379 Ga0501035_0154379_833_1714 276
768 3300049822 Ga0501035_0203248 Ga0501035_0203248_367_1239 276
769 3300049822 Ga0501035_0237957 Ga0501035_0237957_344_1225 276
770 3300049823 Ga0501044_0167103 Ga0501044_0167103_344_1225 276
771 3300061719 Ga0466962_0006434 Ga0466962_0006434_3216_4100 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13622

4HBT_3

Acyl-CoA thioesterase N-terminal domain

26

110

0.93

PF02551

Acyl_CoA_thio

Acyl-CoA thioesterase

155

287

0.89

PF20789

4HBT_3C

Acyl-CoA thioesterase C-terminal domain

123

288

0.86

PF02551

Acyl_CoA_thio

Acyl-CoA thioesterase

18

116

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qfw-assembly1.cif.gz_A crystal structure of acyl-coa thioesterase tesb from yersinia pestis 0.9658 5 273
4r4u-assembly1.cif.gz_A crystal structure of acyl-coa thioesterase tesb from yersinia pestis in complex with coenzyme a 0.9607 5 273
4r4u-assembly2.cif.gz_C crystal structure of acyl-coa thioesterase tesb from yersinia pestis in complex with coenzyme a 0.9582 5 273
1tbu-assembly1.cif.gz_D crystal structure of n-terminal domain of yeast peroxisomal thioesterase-1 0.9551 21 98
4r9z-assembly1.cif.gz_A mycobacterium avium subs paratuberculosis tesb protein map1729c 0.9512 7 270
ID Description Score Start End Superfamily
1c8uB02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9731 5 102 3.10.129.10
4gwhA00 Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain 0.9585 5 273 2.40.160.210
4r9zA00 Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain 0.9512 7 270 2.40.160.210
1c8uB01 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9498 143 272 3.10.129.10
1tbuC00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9487 7 97 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A3D2S1K8-F1-model_v4 Acyl-CoA thioesterase II 0.9845 211 274 GO:0005829
GO:0006637
GO:0009062
GO:0047617
AF-A0A1C4QRL6-F1-model_v4 Acyl-CoA thioesterase-2 0.9833 81 275 GO:0006637
GO:0009062
GO:0047617
AF-A0A6G2TZU7-F1-model_v4 Acyl-CoA thioesterase II 0.9821 6 274 GO:0006637
GO:0009062
GO:0047617
AF-D8SM83-F1-model_v4 palmitoyl-CoA hydrolase (EC 3.1.2.2) 0.9731 5 114 GO:0006637
GO:0009062
GO:0047617
AF-A0A376ZMF1-F1-model_v4 Acyl-CoA thioesterase (EC 3.1.2.-) 0.9713 168 272 GO:0005829
GO:0006637
GO:0009062
GO:0047617

Feature Viewer

pLDDT pTM Quality
92.92 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map