F480102
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 772 | 346 | 1544 | 112 |
Family's Representative Sequence
| Representative Sequence | 3300000546|LJNas_1026590|LJNas_10265902 |
| Length | 117 |
| Sequence | MRESSETLSGSTWDVEQLLTDALRPIEPPERLTGRFEDTLSAVTQAAAAELSDWAEELSESELRALRDPRNWVRPVVAVGAGSVATGALVLIELRRRSKNKGESGLRALSGGLRSRL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 180 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 181 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 182 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 183 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 184 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 185 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 188 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 190 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 192 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 194 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 197 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 198 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 199 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 200 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 202 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 203 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 204 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 206 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 207 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 209 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 211 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 212 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 215 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 216 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 217 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 218 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 219 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 278 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 279 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 280 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 281 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 282 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 283 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 286 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 287 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 288 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 289 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 290 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 291 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 292 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 293 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 294 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 295 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 296 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 297 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 298 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 299 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 300 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 328 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 329 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 330 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 331 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 342 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 343 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 344 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 345 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.74 |
| Metatranscriptomes | 0.26 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.2 |
| Nodule | 0 |
| Rhizoplane | 10.88 |
| Rhizosphere | 83.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1026590 | 3300000546 | Bacteria | 619 |
| 2 | JGI24746J21847_1000082 | 3300001977 | Bacteria | 10321 |
| 3 | JGI24740J21852_10002425 | 3300001979 | Bacteria | 8470 |
| 4 | JGI24034J26672_10000100 | 3300002239 | Bacteria | 14378 |
| 5 | JGI25406J46586_10071415 | 3300003203 | Bacteria | 1088 |
| 6 | JGI25407J50210_10114449 | 3300003373 | Bacteria | 665 |
| 7 | JGI25404J52841_10093533 | 3300003659 | Bacteria | 629 |
| 8 | Ga0065707_10778225 | 3300005295 | Bacteria | 600 |
| 9 | Ga0070658_10173125 | 3300005327 | Bacteria | 1814 |
| 10 | Ga0070683_100001949 | 3300005329 | Bacteria | 16174 |
| 11 | Ga0070683_100004000 | 3300005329 | Bacteria | 12072 |
| 12 | Ga0070683_100012150 | 3300005329 | Bacteria | 7473 |
| 13 | Ga0070683_100127418 | 3300005329 | Bacteria | 2407 |
| 14 | Ga0070683_100132343 | 3300005329 | Bacteria | 2361 |
| 15 | Ga0070683_100166516 | 3300005329 | Bacteria | 2091 |
| 16 | Ga0070683_100499763 | 3300005329 | Bacteria | 1162 |
| 17 | Ga0070690_100264005 | 3300005330 | Bacteria | 1222 |
| 18 | Ga0070690_101317765 | 3300005330 | Bacteria | 579 |
| 19 | Ga0070670_100346520 | 3300005331 | Bacteria | 1304 |
| 20 | Ga0070677_10000515 | 3300005333 | Bacteria | 13266 |
| 21 | Ga0068869_100175188 | 3300005334 | Bacteria | 1678 |
| 22 | Ga0070666_10010679 | 3300005335 | Bacteria | 5749 |
| 23 | Ga0070666_10010680 | 3300005335 | Bacteria | 5749 |
| 24 | Ga0070680_100385948 | 3300005336 | Bacteria | 1193 |
| 25 | Ga0070682_100000061 | 3300005337 | Bacteria | 105134 |
| 26 | Ga0070682_100016669 | 3300005337 | Bacteria | 4276 |
| 27 | Ga0070682_101349262 | 3300005337 | Bacteria | 608 |
| 28 | Ga0068868_100003592 | 3300005338 | Bacteria | 10807 |
| 29 | Ga0068868_100117677 | 3300005338 | Bacteria | 2165 |
| 30 | Ga0070660_100000254 | 3300005339 | Bacteria | 35147 |
| 31 | Ga0070660_100539046 | 3300005339 | Bacteria | 973 |
| 32 | Ga0070660_100752835 | 3300005339 | Bacteria | 818 |
| 33 | Ga0070689_100090411 | 3300005340 | Bacteria | 2412 |
| 34 | Ga0070689_100171111 | 3300005340 | Bacteria | 1760 |
| 35 | Ga0070691_10000046 | 3300005341 | Bacteria | 35659 |
| 36 | Ga0070691_10085429 | 3300005341 | Bacteria | 1550 |
| 37 | Ga0070691_10447236 | 3300005341 | Bacteria | 737 |
| 38 | Ga0070687_100299903 | 3300005343 | Bacteria | 1019 |
| 39 | Ga0070661_100000279 | 3300005344 | Bacteria | 41265 |
| 40 | Ga0070661_100724244 | 3300005344 | Bacteria | 812 |
| 41 | Ga0070692_10033559 | 3300005345 | Bacteria | 2587 |
| 42 | Ga0070692_10309891 | 3300005345 | Bacteria | 967 |
| 43 | Ga0070669_100271469 | 3300005353 | Bacteria | 1356 |
| 44 | Ga0070675_100000069 | 3300005354 | Bacteria | 59717 |
| 45 | Ga0070671_101707048 | 3300005355 | Bacteria | 559 |
| 46 | Ga0070674_100000074 | 3300005356 | Bacteria | 46384 |
| 47 | Ga0070674_101297920 | 3300005356 | Bacteria | 649 |
| 48 | Ga0070673_101771310 | 3300005364 | Bacteria | 585 |
| 49 | Ga0070688_100000211 | 3300005365 | Bacteria | 30817 |
| 50 | Ga0070688_100006275 | 3300005365 | Bacteria | 6342 |
| 51 | Ga0070688_100016289 | 3300005365 | Bacteria | 4247 |
| 52 | Ga0070688_100370127 | 3300005365 | Bacteria | 1054 |
| 53 | Ga0070659_100003627 | 3300005366 | Bacteria | 10992 |
| 54 | Ga0070659_100010404 | 3300005366 | Bacteria | 6842 |
| 55 | Ga0070659_100087161 | 3300005366 | Bacteria | 2499 |
| 56 | Ga0070667_100007228 | 3300005367 | Bacteria | 9225 |
| 57 | Ga0070667_100073843 | 3300005367 | Bacteria | 2909 |
| 58 | Ga0070667_100966986 | 3300005367 | Bacteria | 794 |
| 59 | Ga0070709_10749187 | 3300005434 | Bacteria | 763 |
| 60 | Ga0070714_100037764 | 3300005435 | Bacteria | 4060 |
| 61 | Ga0070714_101089448 | 3300005435 | Bacteria | 778 |
| 62 | Ga0070713_100000023 | 3300005436 | Bacteria | 98528 |
| 63 | Ga0070713_100051767 | 3300005436 | Bacteria | 3397 |
| 64 | Ga0070701_10184007 | 3300005438 | Bacteria | 1225 |
| 65 | Ga0070701_10447142 | 3300005438 | Bacteria | 829 |
| 66 | Ga0070711_100001230 | 3300005439 | Bacteria | 13841 |
| 67 | Ga0070711_100235786 | 3300005439 | Bacteria | 1428 |
| 68 | Ga0070711_100788892 | 3300005439 | Bacteria | 805 |
| 69 | Ga0070705_101006704 | 3300005440 | Bacteria | 677 |
| 70 | Ga0070700_100011692 | 3300005441 | Bacteria | 4870 |
| 71 | Ga0070700_100068842 | 3300005441 | Bacteria | 2252 |
| 72 | Ga0070700_100291468 | 3300005441 | Bacteria | 1187 |
| 73 | Ga0070663_100004452 | 3300005455 | Bacteria | 8240 |
| 74 | Ga0070663_100082479 | 3300005455 | Bacteria | 2365 |
| 75 | Ga0070663_101012510 | 3300005455 | Bacteria | 723 |
| 76 | Ga0070663_102110783 | 3300005455 | Bacteria | 508 |
| 77 | Ga0070678_100102651 | 3300005456 | Bacteria | 2220 |
| 78 | Ga0070678_100622074 | 3300005456 | Bacteria | 966 |
| 79 | Ga0070662_100018204 | 3300005457 | Bacteria | 4748 |
| 80 | Ga0070662_101176802 | 3300005457 | Bacteria | 659 |
| 81 | Ga0070681_10235753 | 3300005458 | Bacteria | 1744 |
| 82 | Ga0070681_11294148 | 3300005458 | Bacteria | 652 |
| 83 | Ga0068867_100023035 | 3300005459 | Bacteria | 4457 |
| 84 | Ga0068867_100855966 | 3300005459 | Bacteria | 815 |
| 85 | Ga0070685_10000032 | 3300005466 | Bacteria | 84253 |
| 86 | Ga0070685_10000540 | 3300005466 | Bacteria | 21390 |
| 87 | Ga0070685_10068347 | 3300005466 | Bacteria | 2099 |
| 88 | Ga0070679_100018595 | 3300005530 | Bacteria | 6746 |
| 89 | Ga0070679_100133381 | 3300005530 | Bacteria | 2465 |
| 90 | Ga0070684_100000542 | 3300005535 | Bacteria | 25958 |
| 91 | Ga0070684_100012296 | 3300005535 | Bacteria | 6854 |
| 92 | Ga0070684_100023153 | 3300005535 | Bacteria | 5189 |
| 93 | Ga0070684_100361092 | 3300005535 | Bacteria | 1337 |
| 94 | Ga0070684_100390520 | 3300005535 | Bacteria | 1282 |
| 95 | Ga0070684_100468753 | 3300005535 | Bacteria | 1165 |
| 96 | Ga0070684_100585640 | 3300005535 | Bacteria | 1037 |
| 97 | Ga0070684_100627573 | 3300005535 | Bacteria | 1000 |
| 98 | Ga0070684_101901207 | 3300005535 | Bacteria | 562 |
| 99 | Ga0068853_100013341 | 3300005539 | Bacteria | 6709 |
| 100 | Ga0068853_100025791 | 3300005539 | Bacteria | 4934 |
| 101 | Ga0068853_100370538 | 3300005539 | Bacteria | 1336 |
| 102 | Ga0070672_100000005 | 3300005543 | Bacteria | 121014 |
| 103 | Ga0070672_100052973 | 3300005543 | Bacteria | 3171 |
| 104 | Ga0070686_100008940 | 3300005544 | Bacteria | 5614 |
| 105 | Ga0070686_100268702 | 3300005544 | Bacteria | 1253 |
| 106 | Ga0070686_101298358 | 3300005544 | Bacteria | 608 |
| 107 | Ga0070695_100037702 | 3300005545 | Bacteria | 3048 |
| 108 | Ga0070695_100195199 | 3300005545 | Bacteria | 1443 |
| 109 | Ga0070693_100217393 | 3300005547 | Bacteria | 1250 |
| 110 | Ga0070693_101286222 | 3300005547 | Unclassified | 565 |
| 111 | Ga0070665_100001182 | 3300005548 | Bacteria | 31862 |
| 112 | Ga0070665_100127161 | 3300005548 | Bacteria | 2551 |
| 113 | Ga0070665_100175868 | 3300005548 | Bacteria | 2141 |
| 114 | Ga0070665_100965378 | 3300005548 | Bacteria | 865 |
| 115 | Ga0070665_101288792 | 3300005548 | Bacteria | 741 |
| 116 | Ga0068855_100496369 | 3300005563 | Bacteria | 1327 |
| 117 | Ga0070664_100048993 | 3300005564 | Bacteria | 3572 |
| 118 | Ga0070664_100068063 | 3300005564 | Bacteria | 3044 |
| 119 | Ga0070664_101369951 | 3300005564 | Bacteria | 668 |
| 120 | Ga0068857_100099628 | 3300005577 | Bacteria | 2607 |
| 121 | Ga0068857_100210379 | 3300005577 | Bacteria | 1775 |
| 122 | Ga0068857_100901832 | 3300005577 | Bacteria | 848 |
| 123 | Ga0068854_100000094 | 3300005578 | Bacteria | 62790 |
| 124 | Ga0068854_100029841 | 3300005578 | Bacteria | 3779 |
| 125 | Ga0068856_100001548 | 3300005614 | Bacteria | 24057 |
| 126 | Ga0068856_100014086 | 3300005614 | Bacteria | 7731 |
| 127 | Ga0068856_100092123 | 3300005614 | Bacteria | 3015 |
| 128 | Ga0070702_100012454 | 3300005615 | Bacteria | 4263 |
| 129 | Ga0070702_100989786 | 3300005615 | Bacteria | 665 |
| 130 | Ga0068852_100000595 | 3300005616 | Bacteria | 23764 |
| 131 | Ga0068852_100008522 | 3300005616 | Bacteria | 7563 |
| 132 | Ga0068859_101781622 | 3300005617 | Bacteria | 680 |
| 133 | Ga0068864_100142292 | 3300005618 | Bacteria | 2165 |
| 134 | Ga0068866_10000349 | 3300005718 | Bacteria | 21712 |
| 135 | Ga0068866_10045476 | 3300005718 | Bacteria | 2202 |
| 136 | Ga0068866_10562748 | 3300005718 | Bacteria | 764 |
| 137 | Ga0068861_100304376 | 3300005719 | Bacteria | 1382 |
| 138 | Ga0068861_100429499 | 3300005719 | Bacteria | 1179 |
| 139 | Ga0068861_100713821 | 3300005719 | Bacteria | 933 |
| 140 | Ga0068851_10006008 | 3300005834 | Bacteria | 5532 |
| 141 | Ga0068851_10009469 | 3300005834 | Bacteria | 4532 |
| 142 | Ga0068851_10021879 | 3300005834 | Bacteria | 3108 |
| 143 | Ga0068870_10139754 | 3300005840 | Bacteria | 1416 |
| 144 | Ga0068870_10237800 | 3300005840 | Bacteria | 1123 |
| 145 | Ga0068863_100000229 | 3300005841 | Bacteria | 59324 |
| 146 | Ga0068863_100194056 | 3300005841 | Bacteria | 1952 |
| 147 | Ga0068863_101134523 | 3300005841 | Bacteria | 787 |
| 148 | Ga0068858_100000017 | 3300005842 | Bacteria | 186913 |
| 149 | Ga0068858_100322246 | 3300005842 | Bacteria | 1477 |
| 150 | Ga0068860_100128482 | 3300005843 | Bacteria | 2430 |
| 151 | Ga0068860_100699832 | 3300005843 | Bacteria | 1023 |
| 152 | Ga0068860_101231060 | 3300005843 | Bacteria | 769 |
| 153 | Ga0068862_100017083 | 3300005844 | Bacteria | 6038 |
| 154 | Ga0081455_10015052 | 3300005937 | Bacteria | 7533 |
| 155 | Ga0081455_10182740 | 3300005937 | Bacteria | 1586 |
| 156 | Ga0081455_10524826 | 3300005937 | Bacteria | 789 |
| 157 | Ga0081538_10022789 | 3300005981 | Bacteria | 4523 |
| 158 | Ga0081540_1000046 | 3300005983 | Bacteria | 131375 |
| 159 | Ga0081539_10002029 | 3300005985 | Bacteria | 30518 |
| 160 | Ga0075365_10004268 | 3300006038 | Bacteria | 7543 |
| 161 | Ga0075363_100011280 | 3300006048 | Bacteria | 4275 |
| 162 | Ga0075364_10027080 | 3300006051 | Bacteria | 3660 |
| 163 | Ga0075364_10221070 | 3300006051 | Bacteria | 1285 |
| 164 | Ga0075364_10392574 | 3300006051 | Bacteria | 947 |
| 165 | Ga0070715_10104200 | 3300006163 | Bacteria | 1328 |
| 166 | Ga0070716_100059536 | 3300006173 | Bacteria | 2202 |
| 167 | Ga0070712_100004870 | 3300006175 | Bacteria | 8303 |
| 168 | Ga0075367_10134744 | 3300006178 | Bacteria | 1528 |
| 169 | Ga0068871_100619970 | 3300006358 | Bacteria | 985 |
| 170 | Ga0075433_10012873 | 3300006852 | Bacteria | 6778 |
| 171 | Ga0068865_100000293 | 3300006881 | Bacteria | 27538 |
| 172 | Ga0068865_100015784 | 3300006881 | Bacteria | 4819 |
| 173 | Ga0068865_102023360 | 3300006881 | Bacteria | 523 |
| 174 | Ga0097620_101781395 | 3300006931 | Bacteria | 680 |
| 175 | Ga0075435_100504652 | 3300007076 | Bacteria | 1046 |
| 176 | Ga0105240_12218355 | 3300009093 | Bacteria | 569 |
| 177 | Ga0111539_10044614 | 3300009094 | Bacteria | 5311 |
| 178 | Ga0111539_12142115 | 3300009094 | Unclassified | 649 |
| 179 | Ga0105245_10000249 | 3300009098 | Bacteria | 51282 |
| 180 | Ga0105245_10000330 | 3300009098 | Bacteria | 44516 |
| 181 | Ga0105245_10001943 | 3300009098 | Bacteria | 18774 |
| 182 | Ga0105245_10042800 | 3300009098 | Bacteria | 4040 |
| 183 | Ga0105245_11813389 | 3300009098 | Bacteria | 663 |
| 184 | Ga0105247_10000629 | 3300009101 | Bacteria | 28167 |
| 185 | Ga0105247_10296170 | 3300009101 | Bacteria | 1121 |
| 186 | Ga0105243_10018797 | 3300009148 | Bacteria | 5236 |
| 187 | Ga0105243_10060666 | 3300009148 | Bacteria | 3021 |
| 188 | Ga0105243_10161333 | 3300009148 | Bacteria | 1933 |
| 189 | Ga0105243_10509838 | 3300009148 | Bacteria | 1142 |
| 190 | Ga0105241_10165675 | 3300009174 | Bacteria | 1821 |
| 191 | Ga0105242_10000139 | 3300009176 | Bacteria | 52585 |
| 192 | Ga0105242_10000264 | 3300009176 | Bacteria | 41690 |
| 193 | Ga0105242_10044641 | 3300009176 | Bacteria | 3590 |
| 194 | Ga0105242_10767097 | 3300009176 | Bacteria | 951 |
| 195 | Ga0105242_10968143 | 3300009176 | Bacteria | 856 |
| 196 | Ga0105248_10000017 | 3300009177 | Bacteria | 298089 |
| 197 | Ga0105248_11539962 | 3300009177 | Bacteria | 753 |
| 198 | Ga0105237_12336532 | 3300009545 | Bacteria | 545 |
| 199 | Ga0105238_10000016 | 3300009551 | Bacteria | 236218 |
| 200 | Ga0105238_10136897 | 3300009551 | Bacteria | 2427 |
| 201 | Ga0105238_10171646 | 3300009551 | Bacteria | 2145 |
| 202 | Ga0105249_10000054 | 3300009553 | Bacteria | 162883 |
| 203 | Ga0105249_10629008 | 3300009553 | Bacteria | 1130 |
| 204 | Ga0105239_10092973 | 3300010375 | Bacteria | 3330 |
| 205 | Ga0105239_10195215 | 3300010375 | Bacteria | 2267 |
| 206 | Ga0105246_10705072 | 3300011119 | Bacteria | 885 |
| 207 | Ga0157371_10005742 | 3300013102 | Bacteria | 10396 |
| 208 | Ga0157370_10007930 | 3300013104 | Bacteria | 11498 |
| 209 | Ga0157370_10070465 | 3300013104 | Bacteria | 3300 |
| 210 | Ga0157369_10000105 | 3300013105 | Bacteria | 117996 |
| 211 | Ga0157374_10000242 | 3300013296 | Bacteria | 50857 |
| 212 | Ga0157374_10729583 | 3300013296 | Bacteria | 1005 |
| 213 | Ga0157374_10899664 | 3300013296 | Bacteria | 903 |
| 214 | Ga0157374_11171875 | 3300013296 | Unclassified | 789 |
| 215 | Ga0157378_10035367 | 3300013297 | Bacteria | 4417 |
| 216 | Ga0157378_10244006 | 3300013297 | Bacteria | 1717 |
| 217 | Ga0163162_10257874 | 3300013306 | Bacteria | 1875 |
| 218 | Ga0163162_10829343 | 3300013306 | Bacteria | 1041 |
| 219 | Ga0163162_11205029 | 3300013306 | Bacteria | 859 |
| 220 | Ga0163162_12325988 | 3300013306 | Unclassified | 616 |
| 221 | Ga0157372_10000556 | 3300013307 | Bacteria | 41040 |
| 222 | Ga0157372_10572197 | 3300013307 | Bacteria | 1317 |
| 223 | Ga0157372_11025021 | 3300013307 | Bacteria | 955 |
| 224 | Ga0157375_10000368 | 3300013308 | Bacteria | 41066 |
| 225 | Ga0157375_10007785 | 3300013308 | Bacteria | 9372 |
| 226 | Ga0157375_10144911 | 3300013308 | Bacteria | 2505 |
| 227 | Ga0157375_10258077 | 3300013308 | Bacteria | 1904 |
| 228 | Ga0157375_10456179 | 3300013308 | Unclassified | 1444 |
| 229 | Ga0163163_10265847 | 3300014325 | Unclassified | 1766 |
| 230 | Ga0163163_10418142 | 3300014325 | Bacteria | 1399 |
| 231 | Ga0163163_10907496 | 3300014325 | Bacteria | 944 |
| 232 | Ga0163163_11502968 | 3300014325 | Bacteria | 735 |
| 233 | Ga0157380_10000448 | 3300014326 | Bacteria | 25238 |
| 234 | Ga0157380_10000641 | 3300014326 | Bacteria | 21588 |
| 235 | Ga0157380_10092518 | 3300014326 | Bacteria | 2499 |
| 236 | Ga0157380_10139935 | 3300014326 | Bacteria | 2078 |
| 237 | Ga0157380_11290674 | 3300014326 | Bacteria | 777 |
| 238 | Ga0157377_10002909 | 3300014745 | Bacteria | 7655 |
| 239 | Ga0157377_10697283 | 3300014745 | Bacteria | 737 |
| 240 | Ga0157377_10948756 | 3300014745 | Bacteria | 647 |
| 241 | Ga0157379_10205732 | 3300014968 | Bacteria | 1780 |
| 242 | Ga0157379_12027983 | 3300014968 | Bacteria | 569 |
| 243 | Ga0157376_10072594 | 3300014969 | Bacteria | 2928 |
| 244 | Ga0157376_10693552 | 3300014969 | Bacteria | 1023 |
| 245 | Ga0163161_10000240 | 3300017792 | Bacteria | 49520 |
| 246 | Ga0163161_10093151 | 3300017792 | Bacteria | 2232 |
| 247 | Ga0163161_11113299 | 3300017792 | Bacteria | 679 |
| 248 | Ga0206353_11846088 | 3300020082 | Bacteria | 956 |
| 249 | Ga0206353_12016716 | 3300020082 | Bacteria | 644 |
| 250 | Ga0207656_10000372 | 3300025321 | Bacteria | 15020 |
| 251 | Ga0207656_10013051 | 3300025321 | Bacteria | 3168 |
| 252 | Ga0207656_10040792 | 3300025321 | Bacteria | 1969 |
| 253 | Ga0207653_10223232 | 3300025885 | Bacteria | 716 |
| 254 | Ga0207682_10001663 | 3300025893 | Bacteria | 10194 |
| 255 | Ga0207642_10000109 | 3300025899 | Bacteria | 22332 |
| 256 | Ga0207642_10190004 | 3300025899 | Bacteria | 1126 |
| 257 | Ga0207642_10394536 | 3300025899 | Bacteria | 827 |
| 258 | Ga0207710_10000096 | 3300025900 | Bacteria | 116063 |
| 259 | Ga0207688_10010299 | 3300025901 | Bacteria | 5089 |
| 260 | Ga0207680_10011203 | 3300025903 | Bacteria | 4520 |
| 261 | Ga0207680_10037190 | 3300025903 | Bacteria | 2809 |
| 262 | Ga0207647_10502343 | 3300025904 | Bacteria | 676 |
| 263 | Ga0207647_10568024 | 3300025904 | Bacteria | 628 |
| 264 | Ga0207685_10431402 | 3300025905 | Bacteria | 681 |
| 265 | Ga0207645_10080049 | 3300025907 | Bacteria | 2094 |
| 266 | Ga0207643_10088116 | 3300025908 | Bacteria | 1806 |
| 267 | Ga0207705_10100639 | 3300025909 | Bacteria | 2126 |
| 268 | Ga0207705_10400598 | 3300025909 | Bacteria | 1061 |
| 269 | Ga0207654_10156486 | 3300025911 | Bacteria | 1468 |
| 270 | Ga0207707_10138975 | 3300025912 | Bacteria | 2124 |
| 271 | Ga0207707_11247119 | 3300025912 | Bacteria | 600 |
| 272 | Ga0207695_10633968 | 3300025913 | Bacteria | 950 |
| 273 | Ga0207693_10009775 | 3300025915 | Bacteria | 7810 |
| 274 | Ga0207693_10916695 | 3300025915 | Bacteria | 672 |
| 275 | Ga0207663_10003933 | 3300025916 | Bacteria | 7350 |
| 276 | Ga0207663_10666413 | 3300025916 | Bacteria | 822 |
| 277 | Ga0207660_10355449 | 3300025917 | Bacteria | 1175 |
| 278 | Ga0207662_10075821 | 3300025918 | Bacteria | 2043 |
| 279 | Ga0207657_10000895 | 3300025919 | Bacteria | 31534 |
| 280 | Ga0207657_10076447 | 3300025919 | Bacteria | 2824 |
| 281 | Ga0207657_10131398 | 3300025919 | Bacteria | 2052 |
| 282 | Ga0207649_10000015 | 3300025920 | Bacteria | 245662 |
| 283 | Ga0207652_10001027 | 3300025921 | Bacteria | 25599 |
| 284 | Ga0207652_10226522 | 3300025921 | Bacteria | 1685 |
| 285 | Ga0207681_10156701 | 3300025923 | Bacteria | 1712 |
| 286 | Ga0207681_10185136 | 3300025923 | Bacteria | 1589 |
| 287 | Ga0207694_10000012 | 3300025924 | Bacteria | 411218 |
| 288 | Ga0207694_10139289 | 3300025924 | Bacteria | 1950 |
| 289 | Ga0207694_10466642 | 3300025924 | Bacteria | 1055 |
| 290 | Ga0207650_10394434 | 3300025925 | Bacteria | 1145 |
| 291 | Ga0207650_10952763 | 3300025925 | Bacteria | 729 |
| 292 | Ga0207659_10000126 | 3300025926 | Bacteria | 45034 |
| 293 | Ga0207659_10100378 | 3300025926 | Bacteria | 2181 |
| 294 | Ga0207687_10000094 | 3300025927 | Bacteria | 64753 |
| 295 | Ga0207687_10000106 | 3300025927 | Bacteria | 61275 |
| 296 | Ga0207687_10000211 | 3300025927 | Bacteria | 39509 |
| 297 | Ga0207687_10071643 | 3300025927 | Bacteria | 2477 |
| 298 | Ga0207700_10000003 | 3300025928 | Bacteria | 500797 |
| 299 | Ga0207700_10027642 | 3300025928 | Bacteria | 3977 |
| 300 | Ga0207700_11927132 | 3300025928 | Bacteria | 517 |
| 301 | Ga0207664_10031461 | 3300025929 | Bacteria | 4060 |
| 302 | Ga0207644_11400983 | 3300025931 | Bacteria | 587 |
| 303 | Ga0207690_10002156 | 3300025932 | Bacteria | 12029 |
| 304 | Ga0207690_10013969 | 3300025932 | Bacteria | 4839 |
| 305 | Ga0207690_10026329 | 3300025932 | Bacteria | 3661 |
| 306 | Ga0207706_10005227 | 3300025933 | Bacteria | 12115 |
| 307 | Ga0207686_10000035 | 3300025934 | Bacteria | 130483 |
| 308 | Ga0207686_10000242 | 3300025934 | Bacteria | 41739 |
| 309 | Ga0207686_10012305 | 3300025934 | Bacteria | 4702 |
| 310 | Ga0207686_10455476 | 3300025934 | Bacteria | 985 |
| 311 | Ga0207686_11089416 | 3300025934 | Bacteria | 651 |
| 312 | Ga0207709_10005413 | 3300025935 | Bacteria | 7257 |
| 313 | Ga0207709_10136361 | 3300025935 | Bacteria | 1681 |
| 314 | Ga0207709_10145526 | 3300025935 | Bacteria | 1634 |
| 315 | Ga0207670_10054052 | 3300025936 | Bacteria | 2708 |
| 316 | Ga0207670_10064975 | 3300025936 | Bacteria | 2503 |
| 317 | Ga0207670_10470094 | 3300025936 | Bacteria | 1017 |
| 318 | Ga0207669_10000002 | 3300025937 | Bacteria | 377651 |
| 319 | Ga0207669_10545829 | 3300025937 | Bacteria | 934 |
| 320 | Ga0207704_10000018 | 3300025938 | Bacteria | 153994 |
| 321 | Ga0207704_10008926 | 3300025938 | Bacteria | 4816 |
| 322 | Ga0207704_10234165 | 3300025938 | Bacteria | 1368 |
| 323 | Ga0207665_10137458 | 3300025939 | Bacteria | 1740 |
| 324 | Ga0207691_10000028 | 3300025940 | Bacteria | 121090 |
| 325 | Ga0207691_10018193 | 3300025940 | Bacteria | 6656 |
| 326 | Ga0207711_10000011 | 3300025941 | Bacteria | 518817 |
| 327 | Ga0207711_11029397 | 3300025941 | Bacteria | 763 |
| 328 | Ga0207689_10236944 | 3300025942 | Bacteria | 1508 |
| 329 | Ga0207661_10000348 | 3300025944 | Bacteria | 29705 |
| 330 | Ga0207661_10001988 | 3300025944 | Bacteria | 14066 |
| 331 | Ga0207661_10007679 | 3300025944 | Bacteria | 7674 |
| 332 | Ga0207661_10090051 | 3300025944 | Bacteria | 2554 |
| 333 | Ga0207661_10332112 | 3300025944 | Bacteria | 1368 |
| 334 | Ga0207661_10495629 | 3300025944 | Bacteria | 1116 |
| 335 | Ga0207679_10105381 | 3300025945 | Bacteria | 2214 |
| 336 | Ga0207679_10289241 | 3300025945 | Bacteria | 1408 |
| 337 | Ga0207667_10099967 | 3300025949 | Bacteria | 2992 |
| 338 | Ga0207651_10074933 | 3300025960 | Bacteria | 2412 |
| 339 | Ga0207712_10000032 | 3300025961 | Bacteria | 210628 |
| 340 | Ga0207712_10131246 | 3300025961 | Bacteria | 1909 |
| 341 | Ga0207712_10446929 | 3300025961 | Bacteria | 1095 |
| 342 | Ga0207668_10011738 | 3300025972 | Bacteria | 5337 |
| 343 | Ga0207668_10245003 | 3300025972 | Bacteria | 1452 |
| 344 | Ga0207640_10000077 | 3300025981 | Bacteria | 76155 |
| 345 | Ga0207658_10003057 | 3300025986 | Bacteria | 11974 |
| 346 | Ga0207658_10055754 | 3300025986 | Bacteria | 2930 |
| 347 | Ga0207658_10249685 | 3300025986 | Bacteria | 1507 |
| 348 | Ga0207677_10000551 | 3300026023 | Bacteria | 23665 |
| 349 | Ga0207677_10000817 | 3300026023 | Bacteria | 17805 |
| 350 | Ga0207677_10042336 | 3300026023 | Bacteria | 3019 |
| 351 | Ga0207703_10000030 | 3300026035 | Bacteria | 199014 |
| 352 | Ga0207703_10467639 | 3300026035 | Bacteria | 1180 |
| 353 | Ga0207703_11429211 | 3300026035 | Bacteria | 665 |
| 354 | Ga0207639_10008950 | 3300026041 | Bacteria | 6891 |
| 355 | Ga0207639_10017923 | 3300026041 | Bacteria | 5023 |
| 356 | Ga0207639_10035932 | 3300026041 | Bacteria | 3669 |
| 357 | Ga0207639_10125273 | 3300026041 | Bacteria | 2118 |
| 358 | Ga0207678_10007063 | 3300026067 | Bacteria | 9971 |
| 359 | Ga0207678_10026150 | 3300026067 | Bacteria | 5092 |
| 360 | Ga0207678_10527404 | 3300026067 | Bacteria | 1031 |
| 361 | Ga0207678_11081541 | 3300026067 | Bacteria | 710 |
| 362 | Ga0207708_10001040 | 3300026075 | Bacteria | 20775 |
| 363 | Ga0207708_10367025 | 3300026075 | Bacteria | 1184 |
| 364 | Ga0207702_10000534 | 3300026078 | Bacteria | 42535 |
| 365 | Ga0207702_10020626 | 3300026078 | Bacteria | 5454 |
| 366 | Ga0207702_10046394 | 3300026078 | Bacteria | 3658 |
| 367 | Ga0207702_10457589 | 3300026078 | Bacteria | 1239 |
| 368 | Ga0207702_10742622 | 3300026078 | Bacteria | 969 |
| 369 | Ga0207641_10002613 | 3300026088 | Bacteria | 16523 |
| 370 | Ga0207641_10019958 | 3300026088 | Bacteria | 5501 |
| 371 | Ga0207641_10432371 | 3300026088 | Bacteria | 1269 |
| 372 | Ga0207641_10858440 | 3300026088 | Bacteria | 900 |
| 373 | Ga0207648_10029476 | 3300026089 | Bacteria | 4866 |
| 374 | Ga0207648_11047191 | 3300026089 | Bacteria | 765 |
| 375 | Ga0207674_10088649 | 3300026116 | Bacteria | 3087 |
| 376 | Ga0207674_10331307 | 3300026116 | Bacteria | 1472 |
| 377 | Ga0207674_10446657 | 3300026116 | Bacteria | 1250 |
| 378 | Ga0207675_100335474 | 3300026118 | Bacteria | 1479 |
| 379 | Ga0207675_100624007 | 3300026118 | Bacteria | 1082 |
| 380 | Ga0207675_100772862 | 3300026118 | Bacteria | 973 |
| 381 | Ga0207683_10013190 | 3300026121 | Bacteria | 7050 |
| 382 | Ga0207683_10129353 | 3300026121 | Bacteria | 2270 |
| 383 | Ga0207698_10000450 | 3300026142 | Bacteria | 23764 |
| 384 | Ga0207698_10018467 | 3300026142 | Bacteria | 4752 |
| 385 | Ga0207698_10028769 | 3300026142 | Bacteria | 3968 |
| 386 | Ga0207698_10650956 | 3300026142 | Bacteria | 1044 |
| 387 | Ga0268266_10000781 | 3300028379 | Bacteria | 42591 |
| 388 | Ga0268266_10001302 | 3300028379 | Bacteria | 30313 |
| 389 | Ga0268266_10025581 | 3300028379 | Bacteria | 5021 |
| 390 | Ga0268266_10057962 | 3300028379 | Bacteria | 3334 |
| 391 | Ga0268266_10167561 | 3300028379 | Bacteria | 1991 |
| 392 | Ga0268266_12279305 | 3300028379 | Unclassified | 513 |
| 393 | Ga0268265_10223962 | 3300028380 | Bacteria | 1648 |
| 394 | Ga0268264_10473771 | 3300028381 | Bacteria | 1217 |
| 395 | Ga0265337_1000462 | 3300028556 | Bacteria | 21477 |
| 396 | Ga0265326_10000033 | 3300028558 | Bacteria | 91972 |
| 397 | Ga0265319_1000010 | 3300028563 | Bacteria | 188773 |
| 398 | Ga0265318_10057725 | 3300028577 | Bacteria | 1450 |
| 399 | Ga0265322_10000005 | 3300028654 | Bacteria | 246112 |
| 400 | Ga0265336_10015097 | 3300028666 | Bacteria | 2548 |
| 401 | Ga0265338_10000051 | 3300028800 | Bacteria | 211202 |
| 402 | Ga0265324_10001579 | 3300029957 | Bacteria | 12679 |
| 403 | Ga0307511_10127344 | 3300030521 | Bacteria | 1548 |
| 404 | Ga0265332_10009473 | 3300031238 | Bacteria | 4346 |
| 405 | Ga0265332_10050960 | 3300031238 | Bacteria | 1779 |
| 406 | Ga0265328_10000811 | 3300031239 | Bacteria | 14425 |
| 407 | Ga0265320_10000010 | 3300031240 | Bacteria | 250501 |
| 408 | Ga0265320_10469816 | 3300031240 | Bacteria | 555 |
| 409 | Ga0265325_10024230 | 3300031241 | Bacteria | 3303 |
| 410 | Ga0265329_10001349 | 3300031242 | Bacteria | 11919 |
| 411 | Ga0265340_10379933 | 3300031247 | Bacteria | 623 |
| 412 | Ga0265339_10334464 | 3300031249 | Unclassified | 716 |
| 413 | Ga0265331_10000549 | 3300031250 | Bacteria | 34013 |
| 414 | Ga0265331_10034893 | 3300031250 | Bacteria | 2478 |
| 415 | Ga0265327_10000040 | 3300031251 | Bacteria | 291052 |
| 416 | Ga0265327_10206608 | 3300031251 | Bacteria | 888 |
| 417 | Ga0265316_10057316 | 3300031344 | Bacteria | 3038 |
| 418 | Ga0265316_10239578 | 3300031344 | Bacteria | 1334 |
| 419 | Ga0307513_10771902 | 3300031456 | Bacteria | 667 |
| 420 | Ga0316579_10617453 | 3300031691 | Bacteria | 525 |
| 421 | Ga0265314_10006416 | 3300031711 | Bacteria | 10420 |
| 422 | Ga0265342_10064498 | 3300031712 | Bacteria | 2149 |
| 423 | Ga0265342_10135058 | 3300031712 | Bacteria | 1379 |
| 424 | Ga0307415_100019193 | 3300032126 | Bacteria | 4145 |
| 425 | Ga0373953_0204583 | 3300035117 | Bacteria | 854 |
| 426 | Ga0373955_0340332 | 3300035172 | Bacteria | 908 |
| 427 | Ga0316574_0007154 | 3300035398 | Bacteria | 6100 |
| 428 | Ga0373924_0320616 | 3300035410 | Bacteria | 689 |
| 429 | Ga0373931_0562274 | 3300035691 | Unclassified | 742 |
| 430 | Ga0373947_0467276 | 3300035725 | Bacteria | 855 |
| 431 | Ga0373937_0052434 | 3300036401 | Bacteria | 3740 |
| 432 | Ga0373937_0161694 | 3300036401 | Bacteria | 2099 |
| 433 | Ga0316582_0856350 | 3300036647 | Unclassified | 622 |
| 434 | Ga0395901_0350635 | 3300038443 | Bacteria | 1523 |
| 435 | Ga0451804_1135842 | 3300041463 | Unclassified | 512 |
| 436 | Ga0451807_1046215 | 3300041486 | Bacteria | 709 |
| 437 | Ga0451839_1259115 | 3300041496 | Bacteria | 751 |
| 438 | Ga0451853_2362759 | 3300041512 | Bacteria | 1354 |
| 439 | Ga0466963_0000548 | 3300044694 | Bacteria | 17637 |
| 440 | Ga0466963_0716143 | 3300044694 | Bacteria | 706 |
| 441 | Ga0466957_0001600 | 3300044842 | Bacteria | 11888 |
| 442 | Ga0466960_0095017 | 3300044901 | Bacteria | 1526 |
| 443 | Ga0466958_0029643 | 3300045836 | Bacteria | 3247 |
| 444 | Ga0466967_0000012 | 3300045976 | Bacteria | 104270 |
| 445 | Ga0466967_0134346 | 3300045976 | Bacteria | 2300 |
| 446 | Ga0466967_0353777 | 3300045976 | Bacteria | 1422 |
| 447 | Ga0495592_0032908 | 3300046454 | Bacteria | 3911 |
| 448 | Ga0495592_0227223 | 3300046454 | Bacteria | 1244 |
| 449 | Ga0495592_0257617 | 3300046454 | Bacteria | 1150 |
| 450 | Ga0495592_0319266 | 3300046454 | Bacteria | 1004 |
| 451 | Ga0495603_0001342 | 3300046455 | Bacteria | 14292 |
| 452 | Ga0495603_0004246 | 3300046455 | Bacteria | 8534 |
| 453 | Ga0495603_0131153 | 3300046455 | Bacteria | 1459 |
| 454 | Ga0495629_0000421 | 3300046459 | Bacteria | 35460 |
| 455 | Ga0495629_0001522 | 3300046459 | Bacteria | 18233 |
| 456 | Ga0495629_0007414 | 3300046459 | Bacteria | 8085 |
| 457 | Ga0495629_0755210 | 3300046459 | Bacteria | 643 |
| 458 | Ga0495638_0034168 | 3300046460 | Bacteria | 3247 |
| 459 | Ga0495641_0000440 | 3300046461 | Bacteria | 34775 |
| 460 | Ga0495641_0008689 | 3300046461 | Bacteria | 6145 |
| 461 | Ga0495641_0054791 | 3300046461 | Bacteria | 1811 |
| 462 | Ga0495641_0088197 | 3300046461 | Bacteria | 1388 |
| 463 | Ga0495653_0035156 | 3300046463 | Bacteria | 3956 |
| 464 | Ga0495653_0122373 | 3300046463 | Bacteria | 1852 |
| 465 | Ga0495653_0186821 | 3300046463 | Bacteria | 1417 |
| 466 | Ga0495653_0261498 | 3300046463 | Bacteria | 1144 |
| 467 | Ga0495662_0003232 | 3300046476 | Bacteria | 8230 |
| 468 | Ga0495662_0262372 | 3300046476 | Bacteria | 850 |
| 469 | Ga0495662_0307837 | 3300046476 | Bacteria | 779 |
| 470 | Ga0495664_0195461 | 3300046477 | Bacteria | 1226 |
| 471 | Ga0495594_0000166 | 3300046499 | Bacteria | 31439 |
| 472 | Ga0495596_0210647 | 3300046500 | Bacteria | 755 |
| 473 | Ga0495606_0000908 | 3300046507 | Bacteria | 43982 |
| 474 | Ga0495608_0000071 | 3300046511 | Bacteria | 77182 |
| 475 | Ga0495608_0000346 | 3300046511 | Bacteria | 32424 |
| 476 | Ga0495608_0106249 | 3300046511 | Bacteria | 1807 |
| 477 | Ga0495610_0245770 | 3300046512 | Bacteria | 711 |
| 478 | Ga0495618_0000218 | 3300046514 | Bacteria | 41741 |
| 479 | Ga0495618_0456444 | 3300046514 | Bacteria | 775 |
| 480 | Ga0495620_0000947 | 3300046515 | Bacteria | 17886 |
| 481 | Ga0495620_0026815 | 3300046515 | Bacteria | 2705 |
| 482 | Ga0495628_0000663 | 3300046516 | Bacteria | 31565 |
| 483 | Ga0495628_0031836 | 3300046516 | Bacteria | 4263 |
| 484 | Ga0495628_0104500 | 3300046516 | Bacteria | 2183 |
| 485 | Ga0495628_0116471 | 3300046516 | Bacteria | 2052 |
| 486 | Ga0495628_0142305 | 3300046516 | Bacteria | 1830 |
| 487 | Ga0495630_0000592 | 3300046517 | Bacteria | 26406 |
| 488 | Ga0495630_0000752 | 3300046517 | Bacteria | 22843 |
| 489 | Ga0495630_0016660 | 3300046517 | Bacteria | 5374 |
| 490 | Ga0495630_0381863 | 3300046517 | Bacteria | 1079 |
| 491 | Ga0495630_0747779 | 3300046517 | Bacteria | 747 |
| 492 | Ga0495644_0006894 | 3300046523 | Bacteria | 4398 |
| 493 | Ga0495652_0000009 | 3300046529 | Bacteria | 311000 |
| 494 | Ga0495652_0008072 | 3300046529 | Bacteria | 9640 |
| 495 | Ga0495652_0561378 | 3300046529 | Bacteria | 784 |
| 496 | Ga0495586_0000359 | 3300046535 | Bacteria | 28382 |
| 497 | Ga0495586_0093922 | 3300046535 | Bacteria | 1659 |
| 498 | Ga0495587_0006597 | 3300046536 | Bacteria | 7556 |
| 499 | Ga0495587_0027615 | 3300046536 | Bacteria | 3456 |
| 500 | Ga0495587_0217029 | 3300046536 | Bacteria | 1079 |
| 501 | Ga0495587_0371127 | 3300046536 | Bacteria | 796 |
| 502 | Ga0495621_0000491 | 3300046539 | Bacteria | 9742 |
| 503 | Ga0495645_0031530 | 3300046543 | Bacteria | 3863 |
| 504 | Ga0495645_0247128 | 3300046543 | Bacteria | 1187 |
| 505 | Ga0495622_0000076 | 3300046557 | Bacteria | 86777 |
| 506 | Ga0495633_0040611 | 3300046558 | Bacteria | 2215 |
| 507 | Ga0495667_0000019 | 3300046559 | Bacteria | 181645 |
| 508 | Ga0495667_0070832 | 3300046559 | Bacteria | 2274 |
| 509 | Ga0495667_0845848 | 3300046559 | Bacteria | 563 |
| 510 | Ga0495656_0000204 | 3300046615 | Bacteria | 21157 |
| 511 | Ga0495634_0000558 | 3300046642 | Bacteria | 36397 |
| 512 | Ga0495634_0000933 | 3300046642 | Bacteria | 27697 |
| 513 | Ga0495634_0008513 | 3300046642 | Bacteria | 7627 |
| 514 | Ga0495625_0000395 | 3300046660 | Bacteria | 66640 |
| 515 | Ga0495635_0015400 | 3300046663 | Bacteria | 5349 |
| 516 | Ga0495588_0000647 | 3300046674 | Bacteria | 16200 |
| 517 | Ga0495657_0000096 | 3300046675 | Bacteria | 77239 |
| 518 | Ga0495657_0011081 | 3300046675 | Bacteria | 6759 |
| 519 | Ga0495657_0114221 | 3300046675 | Bacteria | 1707 |
| 520 | Ga0495599_0181345 | 3300046678 | Bacteria | 1298 |
| 521 | Ga0495623_0159064 | 3300046679 | Bacteria | 1329 |
| 522 | Ga0495647_0000028 | 3300046681 | Bacteria | 56683 |
| 523 | Ga0495647_0000310 | 3300046681 | Bacteria | 13667 |
| 524 | Ga0495647_0126280 | 3300046681 | Bacteria | 1080 |
| 525 | Ga0495658_0000001 | 3300046683 | Bacteria | 385362 |
| 526 | Ga0495658_0001763 | 3300046683 | Bacteria | 11187 |
| 527 | Ga0495658_0409302 | 3300046683 | Bacteria | 865 |
| 528 | Ga0495669_0125527 | 3300046684 | Bacteria | 1205 |
| 529 | Ga0495669_0148389 | 3300046684 | Bacteria | 1109 |
| 530 | Ga0495669_0380223 | 3300046684 | Bacteria | 683 |
| 531 | Ga0495613_0000132 | 3300046689 | Bacteria | 74233 |
| 532 | Ga0495613_0002052 | 3300046689 | Bacteria | 15307 |
| 533 | Ga0495624_0000711 | 3300046690 | Bacteria | 26091 |
| 534 | Ga0495624_0002444 | 3300046690 | Bacteria | 14095 |
| 535 | Ga0495624_0265433 | 3300046690 | Bacteria | 1037 |
| 536 | Ga0495670_0210453 | 3300046691 | Bacteria | 1031 |
| 537 | Ga0495649_0006549 | 3300046694 | Bacteria | 7244 |
| 538 | Ga0495600_0006449 | 3300046809 | Bacteria | 7144 |
| 539 | Ga0495600_0278797 | 3300046809 | Bacteria | 1059 |
| 540 | Ga0495600_0335310 | 3300046809 | Bacteria | 949 |
| 541 | Ga0495600_0472057 | 3300046809 | Bacteria | 774 |
| 542 | Ga0495604_0000104 | 3300047317 | Bacteria | 71390 |
| 543 | Ga0495604_0000527 | 3300047317 | Bacteria | 33774 |
| 544 | Ga0495604_0225629 | 3300047317 | Bacteria | 1287 |
| 545 | Ga0495674_0000024 | 3300047319 | Bacteria | 141746 |
| 546 | Ga0495672_0123531 | 3300047320 | Bacteria | 1372 |
| 547 | Ga0495676_0008324 | 3300047321 | Bacteria | 9511 |
| 548 | Ga0495680_0002158 | 3300047322 | Bacteria | 20383 |
| 549 | Ga0495680_0066079 | 3300047322 | Bacteria | 2769 |
| 550 | Ga0495675_0000715 | 3300047444 | Bacteria | 20721 |
| 551 | Ga0495679_035991 | 3300047446 | Bacteria | 1566 |
| 552 | Ga0495685_017187 | 3300047447 | Bacteria | 2476 |
| 553 | Ga0495684_0088553 | 3300047471 | Bacteria | 2346 |
| 554 | Ga0495686_0252841 | 3300047472 | Bacteria | 990 |
| 555 | Ga0495593_0009754 | 3300047673 | Bacteria | 5568 |
| 556 | Ga0495593_0041504 | 3300047673 | Bacteria | 2473 |
| 557 | Ga0495602_0000641 | 3300048088 | Bacteria | 32698 |
| 558 | Ga0495602_0000911 | 3300048088 | Bacteria | 28599 |
| 559 | Ga0496100_0000019 | 3300048903 | Bacteria | 149995 |
| 560 | Ga0496100_0017081 | 3300048903 | Bacteria | 4276 |
| 561 | Ga0496100_0510723 | 3300048903 | Bacteria | 927 |
| 562 | Ga0496101_0000005 | 3300048904 | Bacteria | 331455 |
| 563 | Ga0496101_0277394 | 3300048904 | Bacteria | 1309 |
| 564 | Ga0496102_0000438 | 3300048905 | Bacteria | 47526 |
| 565 | Ga0496102_0005175 | 3300048905 | Bacteria | 11068 |
| 566 | Ga0496102_0041706 | 3300048905 | Bacteria | 4158 |
| 567 | Ga0496102_0078416 | 3300048905 | Bacteria | 3041 |
| 568 | Ga0496102_0136538 | 3300048905 | Bacteria | 2298 |
| 569 | Ga0496102_0673693 | 3300048905 | Bacteria | 957 |
| 570 | Ga0496102_0676220 | 3300048905 | Bacteria | 955 |
| 571 | Ga0496102_1608250 | 3300048905 | Bacteria | 568 |
| 572 | Ga0496103_0000001 | 3300048906 | Bacteria | 643471 |
| 573 | Ga0496103_0003939 | 3300048906 | Bacteria | 9020 |
| 574 | Ga0496103_0073809 | 3300048906 | Bacteria | 2137 |
| 575 | Ga0496103_0378309 | 3300048906 | Bacteria | 910 |
| 576 | Ga0496103_0789426 | 3300048906 | Bacteria | 599 |
| 577 | Ga0496104_0000010 | 3300048907 | Bacteria | 475255 |
| 578 | Ga0496104_0002977 | 3300048907 | Bacteria | 14597 |
| 579 | Ga0496104_0081146 | 3300048907 | Bacteria | 3093 |
| 580 | Ga0496104_0106136 | 3300048907 | Bacteria | 2691 |
| 581 | Ga0496104_0324894 | 3300048907 | Bacteria | 1451 |
| 582 | Ga0496104_0342447 | 3300048907 | Bacteria | 1408 |
| 583 | Ga0496105_0000005 | 3300048908 | Bacteria | 475797 |
| 584 | Ga0496105_0002572 | 3300048908 | Bacteria | 13183 |
| 585 | Ga0496105_0002721 | 3300048908 | Bacteria | 12894 |
| 586 | Ga0496105_0088315 | 3300048908 | Bacteria | 2561 |
| 587 | Ga0496105_0156207 | 3300048908 | Bacteria | 1873 |
| 588 | Ga0496105_0359162 | 3300048908 | Bacteria | 1162 |
| 589 | Ga0496106_0000033 | 3300048909 | Bacteria | 131412 |
| 590 | Ga0496106_0000137 | 3300048909 | Bacteria | 54395 |
| 591 | Ga0496106_0007514 | 3300048909 | Bacteria | 8057 |
| 592 | Ga0496106_0008110 | 3300048909 | Bacteria | 7759 |
| 593 | Ga0496107_0000004 | 3300048910 | Bacteria | 297680 |
| 594 | Ga0496107_0013937 | 3300048910 | Bacteria | 5623 |
| 595 | Ga0496107_0050875 | 3300048910 | Bacteria | 2987 |
| 596 | Ga0496107_0053158 | 3300048910 | Bacteria | 2922 |
| 597 | Ga0496107_0055180 | 3300048910 | Bacteria | 2870 |
| 598 | Ga0496107_0363081 | 3300048910 | Bacteria | 1077 |
| 599 | Ga0496108_0000004 | 3300048911 | Bacteria | 545055 |
| 600 | Ga0496108_0000349 | 3300048911 | Bacteria | 39032 |
| 601 | Ga0496108_0000413 | 3300048911 | Bacteria | 34974 |
| 602 | Ga0496108_0005020 | 3300048911 | Bacteria | 10693 |
| 603 | Ga0496108_0007240 | 3300048911 | Bacteria | 8995 |
| 604 | Ga0496108_0013024 | 3300048911 | Bacteria | 6776 |
| 605 | Ga0496108_0028457 | 3300048911 | Bacteria | 4624 |
| 606 | Ga0496108_0509956 | 3300048911 | Bacteria | 1050 |
| 607 | Ga0496109_0000011 | 3300048912 | Bacteria | 234908 |
| 608 | Ga0496109_0000031 | 3300048912 | Bacteria | 163998 |
| 609 | Ga0496109_0000307 | 3300048912 | Bacteria | 46191 |
| 610 | Ga0496109_0000333 | 3300048912 | Bacteria | 44006 |
| 611 | Ga0496109_0003508 | 3300048912 | Bacteria | 13101 |
| 612 | Ga0496109_0024868 | 3300048912 | Bacteria | 5330 |
| 613 | Ga0496109_0279353 | 3300048912 | Bacteria | 1574 |
| 614 | Ga0496109_0310543 | 3300048912 | Bacteria | 1487 |
| 615 | Ga0496110_0000166 | 3300048913 | Bacteria | 40195 |
| 616 | Ga0496110_0014143 | 3300048913 | Bacteria | 6619 |
| 617 | Ga0496110_0023581 | 3300048913 | Bacteria | 5236 |
| 618 | Ga0496110_0316736 | 3300048913 | Unclassified | 1421 |
| 619 | Ga0496110_1524238 | 3300048913 | Bacteria | 578 |
| 620 | Ga0496111_0000046 | 3300048914 | Bacteria | 48246 |
| 621 | Ga0496111_0016446 | 3300048914 | Bacteria | 5096 |
| 622 | Ga0496111_0036062 | 3300048914 | Bacteria | 3536 |
| 623 | Ga0496111_0359217 | 3300048914 | Bacteria | 1078 |
| 624 | Ga0496111_0533691 | 3300048914 | Bacteria | 862 |
| 625 | Ga0496111_1266739 | 3300048914 | Bacteria | 520 |
| 626 | Ga0496112_0000002 | 3300048915 | Bacteria | 782039 |
| 627 | Ga0496112_0256798 | 3300048915 | Bacteria | 1698 |
| 628 | Ga0496112_0890495 | 3300048915 | Bacteria | 812 |
| 629 | Ga0496113_0000382 | 3300048916 | Bacteria | 21412 |
| 630 | Ga0496113_0003337 | 3300048916 | Bacteria | 9589 |
| 631 | Ga0496113_0086377 | 3300048916 | Bacteria | 2410 |
| 632 | Ga0496113_0559065 | 3300048916 | Bacteria | 917 |
| 633 | Ga0496114_0000003 | 3300048917 | Bacteria | 630981 |
| 634 | Ga0496114_0005493 | 3300048917 | Bacteria | 9922 |
| 635 | Ga0496114_0006238 | 3300048917 | Bacteria | 9383 |
| 636 | Ga0496114_0162625 | 3300048917 | Bacteria | 1942 |
| 637 | Ga0496114_0179527 | 3300048917 | Bacteria | 1848 |
| 638 | Ga0496115_0000022 | 3300048918 | Bacteria | 164224 |
| 639 | Ga0496115_0000027 | 3300048918 | Bacteria | 145505 |
| 640 | Ga0496115_0066821 | 3300048918 | Bacteria | 2906 |
| 641 | Ga0496116_0000120 | 3300048919 | Bacteria | 166804 |
| 642 | Ga0496117_0003475 | 3300048920 | Bacteria | 18288 |
| 643 | Ga0496118_0001146 | 3300048921 | Bacteria | 40888 |
| 644 | Ga0496118_0128472 | 3300048921 | Bacteria | 1633 |
| 645 | Ga0496118_0283129 | 3300048921 | Bacteria | 921 |
| 646 | Ga0496119_0003031 | 3300048922 | Bacteria | 17784 |
| 647 | Ga0496119_0008829 | 3300048922 | Bacteria | 8768 |
| 648 | Ga0496119_0024921 | 3300048922 | Bacteria | 4192 |
| 649 | Ga0496119_0058284 | 3300048922 | Bacteria | 2328 |
| 650 | Ga0496120_0002373 | 3300048923 | Bacteria | 19225 |
| 651 | Ga0496120_0026562 | 3300048923 | Bacteria | 3573 |
| 652 | Ga0496121_0010929 | 3300048924 | Bacteria | 10140 |
| 653 | Ga0496121_0022712 | 3300048924 | Bacteria | 6072 |
| 654 | Ga0496121_0149043 | 3300048924 | Bacteria | 1724 |
| 655 | Ga0496121_0377222 | 3300048924 | Unclassified | 936 |
| 656 | Ga0496124_0150244 | 3300048927 | Bacteria | 1828 |
| 657 | Ga0496124_0371783 | 3300048927 | Bacteria | 1003 |
| 658 | Ga0496124_0726129 | 3300048927 | Bacteria | 626 |
| 659 | Ga0496125_0082356 | 3300048928 | Bacteria | 2453 |
| 660 | Ga0496125_0183625 | 3300048928 | Bacteria | 1390 |
| 661 | Ga0496126_0485724 | 3300048929 | Bacteria | 989 |
| 662 | Ga0501031_0304132 | 3300049568 | Bacteria | 1033 |
| 663 | Ga0501031_0550248 | 3300049568 | Bacteria | 743 |
| 664 | Ga0501033_0045821 | 3300049570 | Bacteria | 3253 |
| 665 | Ga0501034_0091793 | 3300049571 | Bacteria | 3034 |
| 666 | Ga0501034_0158767 | 3300049571 | Bacteria | 2234 |
| 667 | Ga0501034_0177639 | 3300049571 | Bacteria | 2094 |
| 668 | Ga0501034_0411408 | 3300049571 | Bacteria | 1274 |
| 669 | Ga0501038_0055915 | 3300049574 | Bacteria | 3389 |
| 670 | Ga0501039_0538583 | 3300049575 | Bacteria | 916 |
| 671 | Ga0501039_0686785 | 3300049575 | Bacteria | 801 |
| 672 | Ga0501040_0138554 | 3300049576 | Bacteria | 1713 |
| 673 | Ga0501042_0040009 | 3300049578 | Bacteria | 3333 |
| 674 | Ga0501042_0623728 | 3300049578 | Bacteria | 784 |
| 675 | Ga0501043_0089573 | 3300049579 | Bacteria | 2418 |
| 676 | Ga0501043_0291545 | 3300049579 | Bacteria | 1249 |
| 677 | Ga0501043_0432149 | 3300049579 | Bacteria | 991 |
| 678 | Ga0501043_0885003 | 3300049579 | Bacteria | 641 |
| 679 | Ga0501046_0001831 | 3300049580 | Bacteria | 20273 |
| 680 | Ga0501046_1176579 | 3300049580 | Bacteria | 527 |
| 681 | Ga0501047_0023553 | 3300049581 | Bacteria | 5909 |
| 682 | Ga0501047_0039258 | 3300049581 | Bacteria | 4579 |
| 683 | Ga0501047_0237918 | 3300049581 | Bacteria | 1672 |
| 684 | Ga0501047_0300887 | 3300049581 | Bacteria | 1446 |
| 685 | Ga0501047_0864228 | 3300049581 | Bacteria | 718 |
| 686 | Ga0501048_0068919 | 3300049582 | Bacteria | 2498 |
| 687 | Ga0501048_0487639 | 3300049582 | Bacteria | 883 |
| 688 | Ga0501067_0488776 | 3300049583 | Bacteria | 688 |
| 689 | Ga0501068_0039982 | 3300049584 | Bacteria | 2814 |
| 690 | Ga0501068_0111008 | 3300049584 | Bacteria | 1705 |
| 691 | Ga0501069_0343152 | 3300049585 | Bacteria | 879 |
| 692 | Ga0501069_0509205 | 3300049585 | Bacteria | 718 |
| 693 | Ga0501069_0663311 | 3300049585 | Bacteria | 628 |
| 694 | Ga0501070_0004723 | 3300049586 | Bacteria | 11667 |
| 695 | Ga0501070_0021704 | 3300049586 | Bacteria | 5383 |
| 696 | Ga0501070_0105763 | 3300049586 | Bacteria | 2326 |
| 697 | Ga0501070_0199725 | 3300049586 | Bacteria | 1642 |
| 698 | Ga0501070_0239231 | 3300049586 | Bacteria | 1486 |
| 699 | Ga0501070_0309283 | 3300049586 | Bacteria | 1286 |
| 700 | Ga0501071_0044828 | 3300049587 | Bacteria | 3173 |
| 701 | Ga0501073_0135155 | 3300049589 | Bacteria | 1709 |
| 702 | Ga0501074_0020387 | 3300049590 | Bacteria | 4819 |
| 703 | Ga0501074_0417034 | 3300049590 | Bacteria | 952 |
| 704 | Ga0501075_0001204 | 3300049591 | Bacteria | 16745 |
| 705 | Ga0501076_0114901 | 3300049592 | Bacteria | 2178 |
| 706 | Ga0501079_0035824 | 3300049741 | Bacteria | 3820 |
| 707 | Ga0501080_0038591 | 3300049742 | Bacteria | 4458 |
| 708 | Ga0501080_0261243 | 3300049742 | Bacteria | 1578 |
| 709 | Ga0501080_0420653 | 3300049742 | Bacteria | 1200 |
| 710 | Ga0501080_1819758 | 3300049742 | Bacteria | 511 |
| 711 | Ga0501081_1003258 | 3300049743 | Bacteria | 631 |
| 712 | Ga0501083_0007397 | 3300049744 | Bacteria | 7789 |
| 713 | Ga0501083_0056209 | 3300049744 | Bacteria | 2637 |
| 714 | Ga0501083_0082419 | 3300049744 | Bacteria | 2131 |
| 715 | Ga0501035_0028315 | 3300049822 | Bacteria | 5115 |
| 716 | Ga0501035_0048103 | 3300049822 | Bacteria | 3825 |
| 717 | Ga0501035_1110521 | 3300049822 | Bacteria | 617 |
| 718 | Ga0501044_0035974 | 3300049823 | Bacteria | 5182 |
| 719 | Ga0501044_0091449 | 3300049823 | Bacteria | 3069 |
| 720 | Ga0501044_0121114 | 3300049823 | Bacteria | 2617 |
| 721 | Ga0501044_0309804 | 3300049823 | Unclassified | 1506 |
| 722 | Ga0501044_0395448 | 3300049823 | Bacteria | 1295 |
| 723 | Ga0501045_0480926 | 3300049824 | Bacteria | 923 |
| 724 | nmdc:mga03n38_599995_c1 | 3300050490 | Bacteria | 627 |
| 725 | nmdc:mga00v17_31399_c1 | 3300050491 | Bacteria | 3132 |
| 726 | nmdc:mga00v17_415851_c1 | 3300050491 | Bacteria | 873 |
| 727 | nmdc:mga00v17_618390_c1 | 3300050491 | Bacteria | 698 |
| 728 | nmdc:mga00v17_99220_c1 | 3300050491 | Bacteria | 1837 |
| 729 | nmdc:mga0yw44_5758_c1 | 3300050492 | Bacteria | 5905 |
| 730 | nmdc:mga06z11_43278_c1 | 3300050494 | Bacteria | 2264 |
| 731 | nmdc:mga05p37_1337194_c1 | 3300050507 | Bacteria | 727 |
| 732 | nmdc:mga05p37_217112_c1 | 3300050507 | Bacteria | 2309 |
| 733 | nmdc:mga08y16_1471105_c1 | 3300050511 | Unclassified | 642 |
| 734 | nmdc:mga08y16_42807_c1 | 3300050511 | Bacteria | 4742 |
| 735 | nmdc:mga0rr50_340539_c1 | 3300050513 | Bacteria | 1260 |
| 736 | nmdc:mga08x19_206543_c1 | 3300050514 | Bacteria | 1347 |
| 737 | nmdc:mga0a205_4_c1 | 3300050515 | Bacteria | 168154 |
| 738 | nmdc:mga0a205_507_c1 | 3300050515 | Bacteria | 15066 |
| 739 | Ga0495601_0000618 | 3300053077 | Bacteria | 18918 |
| 740 | Ga0495601_0012796 | 3300053077 | Bacteria | 5036 |
| 741 | Ga0495601_0032168 | 3300053077 | Bacteria | 3264 |
| 742 | Ga0495601_0100172 | 3300053077 | Bacteria | 1871 |
| 743 | Ga0495601_0110732 | 3300053077 | Bacteria | 1778 |
| 744 | Ga0495601_0128333 | 3300053077 | Bacteria | 1651 |
| 745 | Ga0495601_0141014 | 3300053077 | Bacteria | 1572 |
| 746 | Ga0495601_0541482 | 3300053077 | Unclassified | 749 |
| 747 | Ga0495612_0001837 | 3300053078 | Bacteria | 8704 |
| 748 | Ga0495612_0010971 | 3300053078 | Bacteria | 3658 |
| 749 | Ga0495612_0018436 | 3300053078 | Bacteria | 2796 |
| 750 | Ga0495612_0044017 | 3300053078 | Bacteria | 1826 |
| 751 | Ga0495612_0149420 | 3300053078 | Bacteria | 1016 |
| 752 | Ga0495655_0000010 | 3300053083 | Bacteria | 125615 |
| 753 | Ga0495655_0000171 | 3300053083 | Bacteria | 12258 |
| 754 | Ga0495595_0000009 | 3300053084 | Bacteria | 193039 |
| 755 | Ga0495595_0000148 | 3300053084 | Bacteria | 28375 |
| 756 | Ga0495595_0021984 | 3300053084 | Bacteria | 2794 |
| 757 | Ga0495595_0506958 | 3300053084 | Bacteria | 615 |
| 758 | Ga0495619_0000001 | 3300053085 | Bacteria | 586054 |
| 759 | Ga0495619_0000177 | 3300053085 | Bacteria | 46800 |
| 760 | Ga0495619_0000413 | 3300053085 | Bacteria | 29033 |
| 761 | Ga0495619_0000867 | 3300053085 | Bacteria | 19839 |
| 762 | Ga0495619_0003424 | 3300053085 | Bacteria | 10239 |
| 763 | Ga0495619_0014796 | 3300053085 | Bacteria | 4929 |
| 764 | Ga0495619_0045943 | 3300053085 | Bacteria | 2870 |
| 765 | Ga0495619_0053614 | 3300053085 | Bacteria | 2668 |
| 766 | Ga0495619_0838692 | 3300053085 | Bacteria | 620 |
| 767 | Ga0500566_0002814 | 3300053094 | Bacteria | 10359 |
| 768 | Ga0500595_179189 | 3300053119 | Bacteria | 588 |
| 769 | Ga0500614_001529 | 3300053123 | Bacteria | 5484 |
| 770 | Ga0500628_000039 | 3300053129 | Bacteria | 49907 |
| 771 | Ga0501082_0110513 | 3300060353 | Bacteria | 2379 |
| 772 | Ga0530510_0140972 | 3300061734 | Bacteria | 1776 |
| 773 | LJNas_1026590 | |||
| 774 | JGI24746J21847_1000082 | |||
| 775 | JGI24740J21852_10002425 | |||
| 776 | JGI24034J26672_10000100 | |||
| 777 | JGI25406J46586_10071415 | |||
| 778 | JGI25407J50210_10114449 | |||
| 779 | JGI25404J52841_10093533 | |||
| 780 | Ga0065707_10778225 | |||
| 781 | Ga0070658_10173125 | |||
| 782 | Ga0070683_100001949 | |||
| 783 | Ga0070683_100004000 | |||
| 784 | Ga0070683_100012150 | |||
| 785 | Ga0070683_100127418 | |||
| 786 | Ga0070683_100132343 | |||
| 787 | Ga0070683_100166516 | |||
| 788 | Ga0070683_100499763 | |||
| 789 | Ga0070690_100264005 | |||
| 790 | Ga0070690_101317765 | |||
| 791 | Ga0070670_100346520 | |||
| 792 | Ga0070677_10000515 | |||
| 793 | Ga0068869_100175188 | |||
| 794 | Ga0070666_10010679 | |||
| 795 | Ga0070666_10010680 | |||
| 796 | Ga0070680_100385948 | |||
| 797 | Ga0070682_100000061 | |||
| 798 | Ga0070682_100016669 | |||
| 799 | Ga0070682_101349262 | |||
| 800 | Ga0068868_100003592 | |||
| 801 | Ga0068868_100117677 | |||
| 802 | Ga0070660_100000254 | |||
| 803 | Ga0070660_100539046 | |||
| 804 | Ga0070660_100752835 | |||
| 805 | Ga0070689_100090411 | |||
| 806 | Ga0070689_100171111 | |||
| 807 | Ga0070691_10000046 | |||
| 808 | Ga0070691_10085429 | |||
| 809 | Ga0070691_10447236 | |||
| 810 | Ga0070687_100299903 | |||
| 811 | Ga0070661_100000279 | |||
| 812 | Ga0070661_100724244 | |||
| 813 | Ga0070692_10033559 | |||
| 814 | Ga0070692_10309891 | |||
| 815 | Ga0070669_100271469 | |||
| 816 | Ga0070675_100000069 | |||
| 817 | Ga0070671_101707048 | |||
| 818 | Ga0070674_100000074 | |||
| 819 | Ga0070674_101297920 | |||
| 820 | Ga0070673_101771310 | |||
| 821 | Ga0070688_100000211 | |||
| 822 | Ga0070688_100006275 | |||
| 823 | Ga0070688_100016289 | |||
| 824 | Ga0070688_100370127 | |||
| 825 | Ga0070659_100003627 | |||
| 826 | Ga0070659_100010404 | |||
| 827 | Ga0070659_100087161 | |||
| 828 | Ga0070667_100007228 | |||
| 829 | Ga0070667_100073843 | |||
| 830 | Ga0070667_100966986 | |||
| 831 | Ga0070709_10749187 | |||
| 832 | Ga0070714_100037764 | |||
| 833 | Ga0070714_101089448 | |||
| 834 | Ga0070713_100000023 | |||
| 835 | Ga0070713_100051767 | |||
| 836 | Ga0070701_10184007 | |||
| 837 | Ga0070701_10447142 | |||
| 838 | Ga0070711_100001230 | |||
| 839 | Ga0070711_100235786 | |||
| 840 | Ga0070711_100788892 | |||
| 841 | Ga0070705_101006704 | |||
| 842 | Ga0070700_100011692 | |||
| 843 | Ga0070700_100068842 | |||
| 844 | Ga0070700_100291468 | |||
| 845 | Ga0070663_100004452 | |||
| 846 | Ga0070663_100082479 | |||
| 847 | Ga0070663_101012510 | |||
| 848 | Ga0070663_102110783 | |||
| 849 | Ga0070678_100102651 | |||
| 850 | Ga0070678_100622074 | |||
| 851 | Ga0070662_100018204 | |||
| 852 | Ga0070662_101176802 | |||
| 853 | Ga0070681_10235753 | |||
| 854 | Ga0070681_11294148 | |||
| 855 | Ga0068867_100023035 | |||
| 856 | Ga0068867_100855966 | |||
| 857 | Ga0070685_10000032 | |||
| 858 | Ga0070685_10000540 | |||
| 859 | Ga0070685_10068347 | |||
| 860 | Ga0070679_100018595 | |||
| 861 | Ga0070679_100133381 | |||
| 862 | Ga0070684_100000542 | |||
| 863 | Ga0070684_100012296 | |||
| 864 | Ga0070684_100023153 | |||
| 865 | Ga0070684_100361092 | |||
| 866 | Ga0070684_100390520 | |||
| 867 | Ga0070684_100468753 | |||
| 868 | Ga0070684_100585640 | |||
| 869 | Ga0070684_100627573 | |||
| 870 | Ga0070684_101901207 | |||
| 871 | Ga0068853_100013341 | |||
| 872 | Ga0068853_100025791 | |||
| 873 | Ga0068853_100370538 | |||
| 874 | Ga0070672_100000005 | |||
| 875 | Ga0070672_100052973 | |||
| 876 | Ga0070686_100008940 | |||
| 877 | Ga0070686_100268702 | |||
| 878 | Ga0070686_101298358 | |||
| 879 | Ga0070695_100037702 | |||
| 880 | Ga0070695_100195199 | |||
| 881 | Ga0070693_100217393 | |||
| 882 | Ga0070693_101286222 | |||
| 883 | Ga0070665_100001182 | |||
| 884 | Ga0070665_100127161 | |||
| 885 | Ga0070665_100175868 | |||
| 886 | Ga0070665_100965378 | |||
| 887 | Ga0070665_101288792 | |||
| 888 | Ga0068855_100496369 | |||
| 889 | Ga0070664_100048993 | |||
| 890 | Ga0070664_100068063 | |||
| 891 | Ga0070664_101369951 | |||
| 892 | Ga0068857_100099628 | |||
| 893 | Ga0068857_100210379 | |||
| 894 | Ga0068857_100901832 | |||
| 895 | Ga0068854_100000094 | |||
| 896 | Ga0068854_100029841 | |||
| 897 | Ga0068856_100001548 | |||
| 898 | Ga0068856_100014086 | |||
| 899 | Ga0068856_100092123 | |||
| 900 | Ga0070702_100012454 | |||
| 901 | Ga0070702_100989786 | |||
| 902 | Ga0068852_100000595 | |||
| 903 | Ga0068852_100008522 | |||
| 904 | Ga0068859_101781622 | |||
| 905 | Ga0068864_100142292 | |||
| 906 | Ga0068866_10000349 | |||
| 907 | Ga0068866_10045476 | |||
| 908 | Ga0068866_10562748 | |||
| 909 | Ga0068861_100304376 | |||
| 910 | Ga0068861_100429499 | |||
| 911 | Ga0068861_100713821 | |||
| 912 | Ga0068851_10006008 | |||
| 913 | Ga0068851_10009469 | |||
| 914 | Ga0068851_10021879 | |||
| 915 | Ga0068870_10139754 | |||
| 916 | Ga0068870_10237800 | |||
| 917 | Ga0068863_100000229 | |||
| 918 | Ga0068863_100194056 | |||
| 919 | Ga0068863_101134523 | |||
| 920 | Ga0068858_100000017 | |||
| 921 | Ga0068858_100322246 | |||
| 922 | Ga0068860_100128482 | |||
| 923 | Ga0068860_100699832 | |||
| 924 | Ga0068860_101231060 | |||
| 925 | Ga0068862_100017083 | |||
| 926 | Ga0081455_10015052 | |||
| 927 | Ga0081455_10182740 | |||
| 928 | Ga0081455_10524826 | |||
| 929 | Ga0081538_10022789 | |||
| 930 | Ga0081540_1000046 | |||
| 931 | Ga0081539_10002029 | |||
| 932 | Ga0075365_10004268 | |||
| 933 | Ga0075363_100011280 | |||
| 934 | Ga0075364_10027080 | |||
| 935 | Ga0075364_10221070 | |||
| 936 | Ga0075364_10392574 | |||
| 937 | Ga0070715_10104200 | |||
| 938 | Ga0070716_100059536 | |||
| 939 | Ga0070712_100004870 | |||
| 940 | Ga0075367_10134744 | |||
| 941 | Ga0068871_100619970 | |||
| 942 | Ga0075433_10012873 | |||
| 943 | Ga0068865_100000293 | |||
| 944 | Ga0068865_100015784 | |||
| 945 | Ga0068865_102023360 | |||
| 946 | Ga0097620_101781395 | |||
| 947 | Ga0075435_100504652 | |||
| 948 | Ga0105240_12218355 | |||
| 949 | Ga0111539_10044614 | |||
| 950 | Ga0111539_12142115 | |||
| 951 | Ga0105245_10000249 | |||
| 952 | Ga0105245_10000330 | |||
| 953 | Ga0105245_10001943 | |||
| 954 | Ga0105245_10042800 | |||
| 955 | Ga0105245_11813389 | |||
| 956 | Ga0105247_10000629 | |||
| 957 | Ga0105247_10296170 | |||
| 958 | Ga0105243_10018797 | |||
| 959 | Ga0105243_10060666 | |||
| 960 | Ga0105243_10161333 | |||
| 961 | Ga0105243_10509838 | |||
| 962 | Ga0105241_10165675 | |||
| 963 | Ga0105242_10000139 | |||
| 964 | Ga0105242_10000264 | |||
| 965 | Ga0105242_10044641 | |||
| 966 | Ga0105242_10767097 | |||
| 967 | Ga0105242_10968143 | |||
| 968 | Ga0105248_10000017 | |||
| 969 | Ga0105248_11539962 | |||
| 970 | Ga0105237_12336532 | |||
| 971 | Ga0105238_10000016 | |||
| 972 | Ga0105238_10136897 | |||
| 973 | Ga0105238_10171646 | |||
| 974 | Ga0105249_10000054 | |||
| 975 | Ga0105249_10629008 | |||
| 976 | Ga0105239_10092973 | |||
| 977 | Ga0105239_10195215 | |||
| 978 | Ga0105246_10705072 | |||
| 979 | Ga0157371_10005742 | |||
| 980 | Ga0157370_10007930 | |||
| 981 | Ga0157370_10070465 | |||
| 982 | Ga0157369_10000105 | |||
| 983 | Ga0157374_10000242 | |||
| 984 | Ga0157374_10729583 | |||
| 985 | Ga0157374_10899664 | |||
| 986 | Ga0157374_11171875 | |||
| 987 | Ga0157378_10035367 | |||
| 988 | Ga0157378_10244006 | |||
| 989 | Ga0163162_10257874 | |||
| 990 | Ga0163162_10829343 | |||
| 991 | Ga0163162_11205029 | |||
| 992 | Ga0163162_12325988 | |||
| 993 | Ga0157372_10000556 | |||
| 994 | Ga0157372_10572197 | |||
| 995 | Ga0157372_11025021 | |||
| 996 | Ga0157375_10000368 | |||
| 997 | Ga0157375_10007785 | |||
| 998 | Ga0157375_10144911 | |||
| 999 | Ga0157375_10258077 | |||
| 1000 | Ga0157375_10456179 | |||
| 1001 | Ga0163163_10265847 | |||
| 1002 | Ga0163163_10418142 | |||
| 1003 | Ga0163163_10907496 | |||
| 1004 | Ga0163163_11502968 | |||
| 1005 | Ga0157380_10000448 | |||
| 1006 | Ga0157380_10000641 | |||
| 1007 | Ga0157380_10092518 | |||
| 1008 | Ga0157380_10139935 | |||
| 1009 | Ga0157380_11290674 | |||
| 1010 | Ga0157377_10002909 | |||
| 1011 | Ga0157377_10697283 | |||
| 1012 | Ga0157377_10948756 | |||
| 1013 | Ga0157379_10205732 | |||
| 1014 | Ga0157379_12027983 | |||
| 1015 | Ga0157376_10072594 | |||
| 1016 | Ga0157376_10693552 | |||
| 1017 | Ga0163161_10000240 | |||
| 1018 | Ga0163161_10093151 | |||
| 1019 | Ga0163161_11113299 | |||
| 1020 | Ga0206353_11846088 | |||
| 1021 | Ga0206353_12016716 | |||
| 1022 | Ga0207656_10000372 | |||
| 1023 | Ga0207656_10013051 | |||
| 1024 | Ga0207656_10040792 | |||
| 1025 | Ga0207653_10223232 | |||
| 1026 | Ga0207682_10001663 | |||
| 1027 | Ga0207642_10000109 | |||
| 1028 | Ga0207642_10190004 | |||
| 1029 | Ga0207642_10394536 | |||
| 1030 | Ga0207710_10000096 | |||
| 1031 | Ga0207688_10010299 | |||
| 1032 | Ga0207680_10011203 | |||
| 1033 | Ga0207680_10037190 | |||
| 1034 | Ga0207647_10502343 | |||
| 1035 | Ga0207647_10568024 | |||
| 1036 | Ga0207685_10431402 | |||
| 1037 | Ga0207645_10080049 | |||
| 1038 | Ga0207643_10088116 | |||
| 1039 | Ga0207705_10100639 | |||
| 1040 | Ga0207705_10400598 | |||
| 1041 | Ga0207654_10156486 | |||
| 1042 | Ga0207707_10138975 | |||
| 1043 | Ga0207707_11247119 | |||
| 1044 | Ga0207695_10633968 | |||
| 1045 | Ga0207693_10009775 | |||
| 1046 | Ga0207693_10916695 | |||
| 1047 | Ga0207663_10003933 | |||
| 1048 | Ga0207663_10666413 | |||
| 1049 | Ga0207660_10355449 | |||
| 1050 | Ga0207662_10075821 | |||
| 1051 | Ga0207657_10000895 | |||
| 1052 | Ga0207657_10076447 | |||
| 1053 | Ga0207657_10131398 | |||
| 1054 | Ga0207649_10000015 | |||
| 1055 | Ga0207652_10001027 | |||
| 1056 | Ga0207652_10226522 | |||
| 1057 | Ga0207681_10156701 | |||
| 1058 | Ga0207681_10185136 | |||
| 1059 | Ga0207694_10000012 | |||
| 1060 | Ga0207694_10139289 | |||
| 1061 | Ga0207694_10466642 | |||
| 1062 | Ga0207650_10394434 | |||
| 1063 | Ga0207650_10952763 | |||
| 1064 | Ga0207659_10000126 | |||
| 1065 | Ga0207659_10100378 | |||
| 1066 | Ga0207687_10000094 | |||
| 1067 | Ga0207687_10000106 | |||
| 1068 | Ga0207687_10000211 | |||
| 1069 | Ga0207687_10071643 | |||
| 1070 | Ga0207700_10000003 | |||
| 1071 | Ga0207700_10027642 | |||
| 1072 | Ga0207700_11927132 | |||
| 1073 | Ga0207664_10031461 | |||
| 1074 | Ga0207644_11400983 | |||
| 1075 | Ga0207690_10002156 | |||
| 1076 | Ga0207690_10013969 | |||
| 1077 | Ga0207690_10026329 | |||
| 1078 | Ga0207706_10005227 | |||
| 1079 | Ga0207686_10000035 | |||
| 1080 | Ga0207686_10000242 | |||
| 1081 | Ga0207686_10012305 | |||
| 1082 | Ga0207686_10455476 | |||
| 1083 | Ga0207686_11089416 | |||
| 1084 | Ga0207709_10005413 | |||
| 1085 | Ga0207709_10136361 | |||
| 1086 | Ga0207709_10145526 | |||
| 1087 | Ga0207670_10054052 | |||
| 1088 | Ga0207670_10064975 | |||
| 1089 | Ga0207670_10470094 | |||
| 1090 | Ga0207669_10000002 | |||
| 1091 | Ga0207669_10545829 | |||
| 1092 | Ga0207704_10000018 | |||
| 1093 | Ga0207704_10008926 | |||
| 1094 | Ga0207704_10234165 | |||
| 1095 | Ga0207665_10137458 | |||
| 1096 | Ga0207691_10000028 | |||
| 1097 | Ga0207691_10018193 | |||
| 1098 | Ga0207711_10000011 | |||
| 1099 | Ga0207711_11029397 | |||
| 1100 | Ga0207689_10236944 | |||
| 1101 | Ga0207661_10000348 | |||
| 1102 | Ga0207661_10001988 | |||
| 1103 | Ga0207661_10007679 | |||
| 1104 | Ga0207661_10090051 | |||
| 1105 | Ga0207661_10332112 | |||
| 1106 | Ga0207661_10495629 | |||
| 1107 | Ga0207679_10105381 | |||
| 1108 | Ga0207679_10289241 | |||
| 1109 | Ga0207667_10099967 | |||
| 1110 | Ga0207651_10074933 | |||
| 1111 | Ga0207712_10000032 | |||
| 1112 | Ga0207712_10131246 | |||
| 1113 | Ga0207712_10446929 | |||
| 1114 | Ga0207668_10011738 | |||
| 1115 | Ga0207668_10245003 | |||
| 1116 | Ga0207640_10000077 | |||
| 1117 | Ga0207658_10003057 | |||
| 1118 | Ga0207658_10055754 | |||
| 1119 | Ga0207658_10249685 | |||
| 1120 | Ga0207677_10000551 | |||
| 1121 | Ga0207677_10000817 | |||
| 1122 | Ga0207677_10042336 | |||
| 1123 | Ga0207703_10000030 | |||
| 1124 | Ga0207703_10467639 | |||
| 1125 | Ga0207703_11429211 | |||
| 1126 | Ga0207639_10008950 | |||
| 1127 | Ga0207639_10017923 | |||
| 1128 | Ga0207639_10035932 | |||
| 1129 | Ga0207639_10125273 | |||
| 1130 | Ga0207678_10007063 | |||
| 1131 | Ga0207678_10026150 | |||
| 1132 | Ga0207678_10527404 | |||
| 1133 | Ga0207678_11081541 | |||
| 1134 | Ga0207708_10001040 | |||
| 1135 | Ga0207708_10367025 | |||
| 1136 | Ga0207702_10000534 | |||
| 1137 | Ga0207702_10020626 | |||
| 1138 | Ga0207702_10046394 | |||
| 1139 | Ga0207702_10457589 | |||
| 1140 | Ga0207702_10742622 | |||
| 1141 | Ga0207641_10002613 | |||
| 1142 | Ga0207641_10019958 | |||
| 1143 | Ga0207641_10432371 | |||
| 1144 | Ga0207641_10858440 | |||
| 1145 | Ga0207648_10029476 | |||
| 1146 | Ga0207648_11047191 | |||
| 1147 | Ga0207674_10088649 | |||
| 1148 | Ga0207674_10331307 | |||
| 1149 | Ga0207674_10446657 | |||
| 1150 | Ga0207675_100335474 | |||
| 1151 | Ga0207675_100624007 | |||
| 1152 | Ga0207675_100772862 | |||
| 1153 | Ga0207683_10013190 | |||
| 1154 | Ga0207683_10129353 | |||
| 1155 | Ga0207698_10000450 | |||
| 1156 | Ga0207698_10018467 | |||
| 1157 | Ga0207698_10028769 | |||
| 1158 | Ga0207698_10650956 | |||
| 1159 | Ga0268266_10000781 | |||
| 1160 | Ga0268266_10001302 | |||
| 1161 | Ga0268266_10025581 | |||
| 1162 | Ga0268266_10057962 | |||
| 1163 | Ga0268266_10167561 | |||
| 1164 | Ga0268266_12279305 | |||
| 1165 | Ga0268265_10223962 | |||
| 1166 | Ga0268264_10473771 | |||
| 1167 | Ga0265337_1000462 | |||
| 1168 | Ga0265326_10000033 | |||
| 1169 | Ga0265319_1000010 | |||
| 1170 | Ga0265318_10057725 | |||
| 1171 | Ga0265322_10000005 | |||
| 1172 | Ga0265336_10015097 | |||
| 1173 | Ga0265338_10000051 | |||
| 1174 | Ga0265324_10001579 | |||
| 1175 | Ga0307511_10127344 | |||
| 1176 | Ga0265332_10009473 | |||
| 1177 | Ga0265332_10050960 | |||
| 1178 | Ga0265328_10000811 | |||
| 1179 | Ga0265320_10000010 | |||
| 1180 | Ga0265320_10469816 | |||
| 1181 | Ga0265325_10024230 | |||
| 1182 | Ga0265329_10001349 | |||
| 1183 | Ga0265340_10379933 | |||
| 1184 | Ga0265339_10334464 | |||
| 1185 | Ga0265331_10000549 | |||
| 1186 | Ga0265331_10034893 | |||
| 1187 | Ga0265327_10000040 | |||
| 1188 | Ga0265327_10206608 | |||
| 1189 | Ga0265316_10057316 | |||
| 1190 | Ga0265316_10239578 | |||
| 1191 | Ga0307513_10771902 | |||
| 1192 | Ga0316579_10617453 | |||
| 1193 | Ga0265314_10006416 | |||
| 1194 | Ga0265342_10064498 | |||
| 1195 | Ga0265342_10135058 | |||
| 1196 | Ga0307415_100019193 | |||
| 1197 | Ga0373953_0204583 | |||
| 1198 | Ga0373955_0340332 | |||
| 1199 | Ga0316574_0007154 | |||
| 1200 | Ga0373924_0320616 | |||
| 1201 | Ga0373931_0562274 | |||
| 1202 | Ga0373947_0467276 | |||
| 1203 | Ga0373937_0052434 | |||
| 1204 | Ga0373937_0161694 | |||
| 1205 | Ga0316582_0856350 | |||
| 1206 | Ga0395901_0350635 | |||
| 1207 | Ga0451804_1135842 | |||
| 1208 | Ga0451807_1046215 | |||
| 1209 | Ga0451839_1259115 | |||
| 1210 | Ga0451853_2362759 | |||
| 1211 | Ga0466963_0000548 | |||
| 1212 | Ga0466963_0716143 | |||
| 1213 | Ga0466957_0001600 | |||
| 1214 | Ga0466960_0095017 | |||
| 1215 | Ga0466958_0029643 | |||
| 1216 | Ga0466967_0000012 | |||
| 1217 | Ga0466967_0134346 | |||
| 1218 | Ga0466967_0353777 | |||
| 1219 | Ga0495592_0032908 | |||
| 1220 | Ga0495592_0227223 | |||
| 1221 | Ga0495592_0257617 | |||
| 1222 | Ga0495592_0319266 | |||
| 1223 | Ga0495603_0001342 | |||
| 1224 | Ga0495603_0004246 | |||
| 1225 | Ga0495603_0131153 | |||
| 1226 | Ga0495629_0000421 | |||
| 1227 | Ga0495629_0001522 | |||
| 1228 | Ga0495629_0007414 | |||
| 1229 | Ga0495629_0755210 | |||
| 1230 | Ga0495638_0034168 | |||
| 1231 | Ga0495641_0000440 | |||
| 1232 | Ga0495641_0008689 | |||
| 1233 | Ga0495641_0054791 | |||
| 1234 | Ga0495641_0088197 | |||
| 1235 | Ga0495653_0035156 | |||
| 1236 | Ga0495653_0122373 | |||
| 1237 | Ga0495653_0186821 | |||
| 1238 | Ga0495653_0261498 | |||
| 1239 | Ga0495662_0003232 | |||
| 1240 | Ga0495662_0262372 | |||
| 1241 | Ga0495662_0307837 | |||
| 1242 | Ga0495664_0195461 | |||
| 1243 | Ga0495594_0000166 | |||
| 1244 | Ga0495596_0210647 | |||
| 1245 | Ga0495606_0000908 | |||
| 1246 | Ga0495608_0000071 | |||
| 1247 | Ga0495608_0000346 | |||
| 1248 | Ga0495608_0106249 | |||
| 1249 | Ga0495610_0245770 | |||
| 1250 | Ga0495618_0000218 | |||
| 1251 | Ga0495618_0456444 | |||
| 1252 | Ga0495620_0000947 | |||
| 1253 | Ga0495620_0026815 | |||
| 1254 | Ga0495628_0000663 | |||
| 1255 | Ga0495628_0031836 | |||
| 1256 | Ga0495628_0104500 | |||
| 1257 | Ga0495628_0116471 | |||
| 1258 | Ga0495628_0142305 | |||
| 1259 | Ga0495630_0000592 | |||
| 1260 | Ga0495630_0000752 | |||
| 1261 | Ga0495630_0016660 | |||
| 1262 | Ga0495630_0381863 | |||
| 1263 | Ga0495630_0747779 | |||
| 1264 | Ga0495644_0006894 | |||
| 1265 | Ga0495652_0000009 | |||
| 1266 | Ga0495652_0008072 | |||
| 1267 | Ga0495652_0561378 | |||
| 1268 | Ga0495586_0000359 | |||
| 1269 | Ga0495586_0093922 | |||
| 1270 | Ga0495587_0006597 | |||
| 1271 | Ga0495587_0027615 | |||
| 1272 | Ga0495587_0217029 | |||
| 1273 | Ga0495587_0371127 | |||
| 1274 | Ga0495621_0000491 | |||
| 1275 | Ga0495645_0031530 | |||
| 1276 | Ga0495645_0247128 | |||
| 1277 | Ga0495622_0000076 | |||
| 1278 | Ga0495633_0040611 | |||
| 1279 | Ga0495667_0000019 | |||
| 1280 | Ga0495667_0070832 | |||
| 1281 | Ga0495667_0845848 | |||
| 1282 | Ga0495656_0000204 | |||
| 1283 | Ga0495634_0000558 | |||
| 1284 | Ga0495634_0000933 | |||
| 1285 | Ga0495634_0008513 | |||
| 1286 | Ga0495625_0000395 | |||
| 1287 | Ga0495635_0015400 | |||
| 1288 | Ga0495588_0000647 | |||
| 1289 | Ga0495657_0000096 | |||
| 1290 | Ga0495657_0011081 | |||
| 1291 | Ga0495657_0114221 | |||
| 1292 | Ga0495599_0181345 | |||
| 1293 | Ga0495623_0159064 | |||
| 1294 | Ga0495647_0000028 | |||
| 1295 | Ga0495647_0000310 | |||
| 1296 | Ga0495647_0126280 | |||
| 1297 | Ga0495658_0000001 | |||
| 1298 | Ga0495658_0001763 | |||
| 1299 | Ga0495658_0409302 | |||
| 1300 | Ga0495669_0125527 | |||
| 1301 | Ga0495669_0148389 | |||
| 1302 | Ga0495669_0380223 | |||
| 1303 | Ga0495613_0000132 | |||
| 1304 | Ga0495613_0002052 | |||
| 1305 | Ga0495624_0000711 | |||
| 1306 | Ga0495624_0002444 | |||
| 1307 | Ga0495624_0265433 | |||
| 1308 | Ga0495670_0210453 | |||
| 1309 | Ga0495649_0006549 | |||
| 1310 | Ga0495600_0006449 | |||
| 1311 | Ga0495600_0278797 | |||
| 1312 | Ga0495600_0335310 | |||
| 1313 | Ga0495600_0472057 | |||
| 1314 | Ga0495604_0000104 | |||
| 1315 | Ga0495604_0000527 | |||
| 1316 | Ga0495604_0225629 | |||
| 1317 | Ga0495674_0000024 | |||
| 1318 | Ga0495672_0123531 | |||
| 1319 | Ga0495676_0008324 | |||
| 1320 | Ga0495680_0002158 | |||
| 1321 | Ga0495680_0066079 | |||
| 1322 | Ga0495675_0000715 | |||
| 1323 | Ga0495679_035991 | |||
| 1324 | Ga0495685_017187 | |||
| 1325 | Ga0495684_0088553 | |||
| 1326 | Ga0495686_0252841 | |||
| 1327 | Ga0495593_0009754 | |||
| 1328 | Ga0495593_0041504 | |||
| 1329 | Ga0495602_0000641 | |||
| 1330 | Ga0495602_0000911 | |||
| 1331 | Ga0496100_0000019 | |||
| 1332 | Ga0496100_0017081 | |||
| 1333 | Ga0496100_0510723 | |||
| 1334 | Ga0496101_0000005 | |||
| 1335 | Ga0496101_0277394 | |||
| 1336 | Ga0496102_0000438 | |||
| 1337 | Ga0496102_0005175 | |||
| 1338 | Ga0496102_0041706 | |||
| 1339 | Ga0496102_0078416 | |||
| 1340 | Ga0496102_0136538 | |||
| 1341 | Ga0496102_0673693 | |||
| 1342 | Ga0496102_0676220 | |||
| 1343 | Ga0496102_1608250 | |||
| 1344 | Ga0496103_0000001 | |||
| 1345 | Ga0496103_0003939 | |||
| 1346 | Ga0496103_0073809 | |||
| 1347 | Ga0496103_0378309 | |||
| 1348 | Ga0496103_0789426 | |||
| 1349 | Ga0496104_0000010 | |||
| 1350 | Ga0496104_0002977 | |||
| 1351 | Ga0496104_0081146 | |||
| 1352 | Ga0496104_0106136 | |||
| 1353 | Ga0496104_0324894 | |||
| 1354 | Ga0496104_0342447 | |||
| 1355 | Ga0496105_0000005 | |||
| 1356 | Ga0496105_0002572 | |||
| 1357 | Ga0496105_0002721 | |||
| 1358 | Ga0496105_0088315 | |||
| 1359 | Ga0496105_0156207 | |||
| 1360 | Ga0496105_0359162 | |||
| 1361 | Ga0496106_0000033 | |||
| 1362 | Ga0496106_0000137 | |||
| 1363 | Ga0496106_0007514 | |||
| 1364 | Ga0496106_0008110 | |||
| 1365 | Ga0496107_0000004 | |||
| 1366 | Ga0496107_0013937 | |||
| 1367 | Ga0496107_0050875 | |||
| 1368 | Ga0496107_0053158 | |||
| 1369 | Ga0496107_0055180 | |||
| 1370 | Ga0496107_0363081 | |||
| 1371 | Ga0496108_0000004 | |||
| 1372 | Ga0496108_0000349 | |||
| 1373 | Ga0496108_0000413 | |||
| 1374 | Ga0496108_0005020 | |||
| 1375 | Ga0496108_0007240 | |||
| 1376 | Ga0496108_0013024 | |||
| 1377 | Ga0496108_0028457 | |||
| 1378 | Ga0496108_0509956 | |||
| 1379 | Ga0496109_0000011 | |||
| 1380 | Ga0496109_0000031 | |||
| 1381 | Ga0496109_0000307 | |||
| 1382 | Ga0496109_0000333 | |||
| 1383 | Ga0496109_0003508 | |||
| 1384 | Ga0496109_0024868 | |||
| 1385 | Ga0496109_0279353 | |||
| 1386 | Ga0496109_0310543 | |||
| 1387 | Ga0496110_0000166 | |||
| 1388 | Ga0496110_0014143 | |||
| 1389 | Ga0496110_0023581 | |||
| 1390 | Ga0496110_0316736 | |||
| 1391 | Ga0496110_1524238 | |||
| 1392 | Ga0496111_0000046 | |||
| 1393 | Ga0496111_0016446 | |||
| 1394 | Ga0496111_0036062 | |||
| 1395 | Ga0496111_0359217 | |||
| 1396 | Ga0496111_0533691 | |||
| 1397 | Ga0496111_1266739 | |||
| 1398 | Ga0496112_0000002 | |||
| 1399 | Ga0496112_0256798 | |||
| 1400 | Ga0496112_0890495 | |||
| 1401 | Ga0496113_0000382 | |||
| 1402 | Ga0496113_0003337 | |||
| 1403 | Ga0496113_0086377 | |||
| 1404 | Ga0496113_0559065 | |||
| 1405 | Ga0496114_0000003 | |||
| 1406 | Ga0496114_0005493 | |||
| 1407 | Ga0496114_0006238 | |||
| 1408 | Ga0496114_0162625 | |||
| 1409 | Ga0496114_0179527 | |||
| 1410 | Ga0496115_0000022 | |||
| 1411 | Ga0496115_0000027 | |||
| 1412 | Ga0496115_0066821 | |||
| 1413 | Ga0496116_0000120 | |||
| 1414 | Ga0496117_0003475 | |||
| 1415 | Ga0496118_0001146 | |||
| 1416 | Ga0496118_0128472 | |||
| 1417 | Ga0496118_0283129 | |||
| 1418 | Ga0496119_0003031 | |||
| 1419 | Ga0496119_0008829 | |||
| 1420 | Ga0496119_0024921 | |||
| 1421 | Ga0496119_0058284 | |||
| 1422 | Ga0496120_0002373 | |||
| 1423 | Ga0496120_0026562 | |||
| 1424 | Ga0496121_0010929 | |||
| 1425 | Ga0496121_0022712 | |||
| 1426 | Ga0496121_0149043 | |||
| 1427 | Ga0496121_0377222 | |||
| 1428 | Ga0496124_0150244 | |||
| 1429 | Ga0496124_0371783 | |||
| 1430 | Ga0496124_0726129 | |||
| 1431 | Ga0496125_0082356 | |||
| 1432 | Ga0496125_0183625 | |||
| 1433 | Ga0496126_0485724 | |||
| 1434 | Ga0501031_0304132 | |||
| 1435 | Ga0501031_0550248 | |||
| 1436 | Ga0501033_0045821 | |||
| 1437 | Ga0501034_0091793 | |||
| 1438 | Ga0501034_0158767 | |||
| 1439 | Ga0501034_0177639 | |||
| 1440 | Ga0501034_0411408 | |||
| 1441 | Ga0501038_0055915 | |||
| 1442 | Ga0501039_0538583 | |||
| 1443 | Ga0501039_0686785 | |||
| 1444 | Ga0501040_0138554 | |||
| 1445 | Ga0501042_0040009 | |||
| 1446 | Ga0501042_0623728 | |||
| 1447 | Ga0501043_0089573 | |||
| 1448 | Ga0501043_0291545 | |||
| 1449 | Ga0501043_0432149 | |||
| 1450 | Ga0501043_0885003 | |||
| 1451 | Ga0501046_0001831 | |||
| 1452 | Ga0501046_1176579 | |||
| 1453 | Ga0501047_0023553 | |||
| 1454 | Ga0501047_0039258 | |||
| 1455 | Ga0501047_0237918 | |||
| 1456 | Ga0501047_0300887 | |||
| 1457 | Ga0501047_0864228 | |||
| 1458 | Ga0501048_0068919 | |||
| 1459 | Ga0501048_0487639 | |||
| 1460 | Ga0501067_0488776 | |||
| 1461 | Ga0501068_0039982 | |||
| 1462 | Ga0501068_0111008 | |||
| 1463 | Ga0501069_0343152 | |||
| 1464 | Ga0501069_0509205 | |||
| 1465 | Ga0501069_0663311 | |||
| 1466 | Ga0501070_0004723 | |||
| 1467 | Ga0501070_0021704 | |||
| 1468 | Ga0501070_0105763 | |||
| 1469 | Ga0501070_0199725 | |||
| 1470 | Ga0501070_0239231 | |||
| 1471 | Ga0501070_0309283 | |||
| 1472 | Ga0501071_0044828 | |||
| 1473 | Ga0501073_0135155 | |||
| 1474 | Ga0501074_0020387 | |||
| 1475 | Ga0501074_0417034 | |||
| 1476 | Ga0501075_0001204 | |||
| 1477 | Ga0501076_0114901 | |||
| 1478 | Ga0501079_0035824 | |||
| 1479 | Ga0501080_0038591 | |||
| 1480 | Ga0501080_0261243 | |||
| 1481 | Ga0501080_0420653 | |||
| 1482 | Ga0501080_1819758 | |||
| 1483 | Ga0501081_1003258 | |||
| 1484 | Ga0501083_0007397 | |||
| 1485 | Ga0501083_0056209 | |||
| 1486 | Ga0501083_0082419 | |||
| 1487 | Ga0501035_0028315 | |||
| 1488 | Ga0501035_0048103 | |||
| 1489 | Ga0501035_1110521 | |||
| 1490 | Ga0501044_0035974 | |||
| 1491 | Ga0501044_0091449 | |||
| 1492 | Ga0501044_0121114 | |||
| 1493 | Ga0501044_0309804 | |||
| 1494 | Ga0501044_0395448 | |||
| 1495 | Ga0501045_0480926 | |||
| 1496 | nmdc:mga03n38_599995_c1 | |||
| 1497 | nmdc:mga00v17_31399_c1 | |||
| 1498 | nmdc:mga00v17_415851_c1 | |||
| 1499 | nmdc:mga00v17_618390_c1 | |||
| 1500 | nmdc:mga00v17_99220_c1 | |||
| 1501 | nmdc:mga0yw44_5758_c1 | |||
| 1502 | nmdc:mga06z11_43278_c1 | |||
| 1503 | nmdc:mga05p37_1337194_c1 | |||
| 1504 | nmdc:mga05p37_217112_c1 | |||
| 1505 | nmdc:mga08y16_1471105_c1 | |||
| 1506 | nmdc:mga08y16_42807_c1 | |||
| 1507 | nmdc:mga0rr50_340539_c1 | |||
| 1508 | nmdc:mga08x19_206543_c1 | |||
| 1509 | nmdc:mga0a205_4_c1 | |||
| 1510 | nmdc:mga0a205_507_c1 | |||
| 1511 | Ga0495601_0000618 | |||
| 1512 | Ga0495601_0012796 | |||
| 1513 | Ga0495601_0032168 | |||
| 1514 | Ga0495601_0100172 | |||
| 1515 | Ga0495601_0110732 | |||
| 1516 | Ga0495601_0128333 | |||
| 1517 | Ga0495601_0141014 | |||
| 1518 | Ga0495601_0541482 | |||
| 1519 | Ga0495612_0001837 | |||
| 1520 | Ga0495612_0010971 | |||
| 1521 | Ga0495612_0018436 | |||
| 1522 | Ga0495612_0044017 | |||
| 1523 | Ga0495612_0149420 | |||
| 1524 | Ga0495655_0000010 | |||
| 1525 | Ga0495655_0000171 | |||
| 1526 | Ga0495595_0000009 | |||
| 1527 | Ga0495595_0000148 | |||
| 1528 | Ga0495595_0021984 | |||
| 1529 | Ga0495595_0506958 | |||
| 1530 | Ga0495619_0000001 | |||
| 1531 | Ga0495619_0000177 | |||
| 1532 | Ga0495619_0000413 | |||
| 1533 | Ga0495619_0000867 | |||
| 1534 | Ga0495619_0003424 | |||
| 1535 | Ga0495619_0014796 | |||
| 1536 | Ga0495619_0045943 | |||
| 1537 | Ga0495619_0053614 | |||
| 1538 | Ga0495619_0838692 | |||
| 1539 | Ga0500566_0002814 | |||
| 1540 | Ga0500595_179189 | |||
| 1541 | Ga0500614_001529 | |||
| 1542 | Ga0500628_000039 | |||
| 1543 | Ga0501082_0110513 | |||
| 1544 | Ga0530510_0140972 |