F480103

General Info

Members Datasets Scaffolds Average Seq Length
772 558 425 416

Family's Representative Sequence

Representative Sequence 3300003781|Ga0055536_1005851|Ga0055536_10058513
Length 452
Sequence MPGIIDPTRAMTGNLRGAIGVLERHPPNSDSEVFMSDTRQKETTWASLPYHRRWLLDQADGLFDFFQYRAINPKGGFFDLDDQGSALGGANPTRGIHASARMVHCFSIGYLLGRPGSGDIIDHGMRTLWERHRDTEYGGYFWQVNDEGAVDSNKQGYGHAFVLLAASSAKVAGHPLADKMLADIGEILETRFWEPRHGAIAEEFNRDWSPIDGGSYRGQNSNMHLTEALMAAFEATGETAYLDKAESIADLVIRRSAGSVGXRVAEHFDPDWTIDXDYYHPDEMFRPAGTTPGHWLEWSRLLLQLWTLGGKKHAWMPDAAKSLFVQSMSLGWDKEKGGFXYTLDWADKPAKXNKLWWPMCEAAGAAHFLNEHLPADGFYEDSYRRIWGTIANRFIDHKNGGWHEELTEDLVPAHTLFPGKGDIYHALQACLIPLFPANGSLTRVIAEAEGRI

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
7 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
8 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
9 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
10 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
11 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
12 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
13 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
14 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
15 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
16 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
17 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
18 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
19 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
20 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
21 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
22 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
23 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
24 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
25 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
26 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
27 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
28 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
29 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
30 2519899620 Rhizobium sp. Pop5 Isolate Nodule
31 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
32 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
33 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
34 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
35 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
36 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
37 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
38 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
39 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
40 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
41 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
42 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
43 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
44 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
45 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
46 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
47 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
48 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
49 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
50 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
51 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
52 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
53 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
54 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
55 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
56 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
57 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
58 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
59 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
60 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
61 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
62 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
63 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
64 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
65 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
66 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
67 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
68 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
69 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
70 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
71 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
72 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
73 2643221558 Rhizobium sp. Root149 Isolate Unclassified
74 2643221568 Rhizobium sp. Root564 Isolate Unclassified
75 2643221580 Devosia sp. Root635 Isolate Unclassified
76 2643221582 Rhizobium sp. Root651 Isolate Unclassified
77 2643221599 Rhizobium sp. Root708 Isolate Unclassified
78 2643221629 Devosia sp. Root105 Isolate Unclassified
79 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
80 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
81 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
82 2643221662 Devosia sp. Root413D1 Isolate Unclassified
83 2643221674 Devosia sp. Root436 Isolate Unclassified
84 2643221693 Rhizobium sp. Root491 Isolate Unclassified
85 2643221719 Rhizobium sp. Root274 Isolate Unclassified
86 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
87 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
88 2718217882 Rhizobium sp. N741 Isolate Nodule
89 2718217927 Rhizobium sp. N324 Isolate Nodule
90 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
91 2718218009 Rhizobium sp. N561 Isolate Nodule
92 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
93 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
94 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
95 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
96 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
97 2718218363 Rhizobium sp. N113 Isolate Nodule
98 2718218365 Rhizobium sp. N731 Isolate Nodule
99 2718218366 Rhizobium sp. N621 Isolate Nodule
100 2718218423 Rhizobium sp. N941 Isolate Nodule
101 2721755514 Rhizobium sp. N6212 Isolate Nodule
102 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
103 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
104 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
105 2721755809 Rhizobium sp. N541 Isolate Nodule
106 2721755810 Rhizobium sp. N871 Isolate Nodule
107 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
108 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
109 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
110 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
111 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
112 2728369365 Rhizobium sp. N1341 Isolate Nodule
113 2728369397 Rhizobium sp. N1314 Isolate Nodule
114 2738541293 Rhizobium sp. GV031 Isolate Unclassified
115 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
116 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
117 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
118 2773857925 Microvirga vignae BR3299 Isolate Unclassified
119 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
120 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
121 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
122 2791355256 Rhizobium sp. M10 Isolate Nodule
123 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
124 2791355260 Rhizobium sp. L9 Isolate Nodule
125 2791355261 Rhizobium sp. J15 Isolate Nodule
126 2791355262 Rhizobium sp. M1 Isolate Nodule
127 2791355263 Rhizobium chutanense C5 Isolate Nodule
128 2791355264 Rhizobium sp. S9 Isolate Nodule
129 2791355265 Rhizobium sp. H4 Isolate Nodule
130 2791355266 Rhizobium sp. L43 Isolate Nodule
131 2791355267 Rhizobium sp. L18 Isolate Nodule
132 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
133 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
134 2802429633 Rhizobium anhuiense J3 Isolate Nodule
135 2802429634 Rhizobium anhuiense S10 Isolate Nodule
136 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
137 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
138 2802429637 Rhizobium anhuiense C15 Isolate Nodule
139 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
140 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
141 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
142 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
143 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
144 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
145 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
146 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
147 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
148 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
149 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
150 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
151 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
152 2838048938 Rhizobium pisi 27/80 Isolate Nodule
153 2838061910 Rhizobium phaseoli L15 Isolate Nodule
154 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
155 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
156 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
157 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
158 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
159 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
160 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
161 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
162 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
163 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
164 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
165 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
166 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
167 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
168 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
169 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
170 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
171 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
172 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
173 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
174 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
175 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
176 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
177 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
178 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
179 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
180 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
181 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
182 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
183 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
184 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
185 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
186 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
187 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
188 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
189 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
190 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
191 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
192 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
193 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
194 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
195 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
196 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
197 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
198 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
199 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
200 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
201 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
202 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
203 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
204 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
205 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
206 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
207 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
208 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
209 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
210 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
211 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
212 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
213 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
214 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
215 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
216 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
217 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
218 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
219 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
220 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
221 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
222 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
223 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
224 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
225 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
226 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
227 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
228 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
229 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
230 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
231 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
232 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
233 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
234 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
235 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
236 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
237 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
238 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
239 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
240 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
241 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
242 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
243 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
244 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
245 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
246 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
247 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
248 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
249 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
250 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
251 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
252 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
253 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
254 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
255 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
256 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
257 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
258 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
259 2932401849 Devosia sp. 2618 Isolate Rhizosphere
260 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
261 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
262 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
263 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
264 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
265 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
266 2933599457 Rhizobium phaseoli M3 Isolate Nodule
267 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
268 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
269 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
270 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
271 2936381700 Rhizobium chutanense C16 Isolate Unclassified
272 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
273 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
274 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
275 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
276 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
277 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
278 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
279 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
280 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
281 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
282 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
283 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
284 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
285 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
286 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
287 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
288 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
289 2996887358 Rhizobium sp. R711 Isolate Nodule
290 2996893221 Rhizobium sp. R635 Isolate Nodule
291 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
292 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
293 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
294 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
295 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
296 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
297 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
298 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
299 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
300 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
301 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
302 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
303 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
304 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
305 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
306 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
307 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
308 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
309 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
310 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
311 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
312 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
313 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
314 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
315 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
316 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
317 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
318 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
319 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
320 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
321 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
322 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
323 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
324 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
325 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
326 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
327 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
328 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
329 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
330 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
331 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
332 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
333 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
334 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
335 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
336 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
337 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
338 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
339 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
340 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
341 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
342 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
343 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
344 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
345 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
346 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
347 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
348 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
349 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
350 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
351 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
352 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
353 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
354 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
355 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
356 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
357 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
358 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
359 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
360 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
361 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
362 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
363 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
364 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
365 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
366 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
367 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
368 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
369 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
370 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
371 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
372 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
373 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
374 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
375 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
376 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
377 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
378 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
389 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
390 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
391 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
392 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
393 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
395 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
396 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
397 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
398 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
399 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
400 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
401 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
402 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
403 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
404 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
405 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
406 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
407 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
408 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
409 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
410 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
411 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
412 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
413 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
414 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
415 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
416 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
417 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
418 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
419 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
420 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
421 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
422 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
423 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
424 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
425 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
426 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
427 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
428 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
429 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
430 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
431 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
432 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
433 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
434 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
435 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
436 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
437 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
438 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
439 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
440 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
441 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
442 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
443 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
444 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
445 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
446 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
447 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
448 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
449 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
450 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
451 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
452 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
453 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
454 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
455 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
456 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
457 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
458 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
459 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
460 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
461 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
462 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
463 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
464 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
465 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
466 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
467 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
468 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
469 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
470 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
471 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
472 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
473 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
474 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
475 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
476 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
477 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
478 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
479 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
480 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
481 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
482 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
483 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
484 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
485 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
486 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
487 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
488 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
489 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
490 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
491 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
492 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
493 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
494 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
495 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
496 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
497 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
498 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
499 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
500 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
501 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
502 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
503 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
504 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
505 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
506 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
507 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
508 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
509 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
510 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
511 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
512 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
513 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
514 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
515 8005258706 Rhizobium sp. R693 Isolate Nodule
516 8005275841 Rhizobium sp. N4311 Isolate Nodule
517 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
518 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
519 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
520 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
521 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
522 8005321885 Rhizobium sp. R72 Isolate Nodule
523 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
524 8005382845 Rhizobium sp. R634 Isolate Nodule
525 8005395548 Rhizobium sp. R339 Isolate Nodule
526 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
527 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
528 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
529 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
530 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
531 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
532 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
533 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
534 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
535 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
536 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
537 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
538 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
539 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
540 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
541 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
542 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
543 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
544 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
545 8018176218 Rhizobium sp. N122 Isolate Nodule
546 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
547 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
548 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
549 8024501048 Rhizobium sp. H4 Isolate Nodule
550 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
551 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
552 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
553 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
554 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
555 8056382006 Rhizobium croatiense 13T Isolate Nodule
556 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
557 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
558 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 54.92
Metatranscriptomes 0.13
Isolates 44.95

Biome Distribution

Category Percentage (%)
Aerial Root 0.65
Bulb 0
Endosphere 20.85
Nodule 28.5
Rhizoplane 3.5
Rhizosphere 25
Stem 0
Stem Tuber 0
Unclassified 21.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000010 3300001979 Bacteria 72485
2 JGI25155J39150_1000044 3300002704 Bacteria 86149
3 JGI25156J39149_1000058 3300002705 Bacteria 86233
4 JGI25156J39149_1003119 3300002705 Bacteria 5588
5 JGI25162J39368_1000143 3300002737 Bacteria 77302
6 JGI25162J39368_1000510 3300002737 Bacteria 29069
7 JGI25154J39366_1000174 3300002738 Bacteria 49957
8 JGI25157J39369_1000078 3300002741 Bacteria 86233
9 JGI25157J39369_1001962 3300002741 Bacteria 6116
10 JGI25152J39213_1001226 3300002773 Bacteria 11738
11 JGI25152J39213_1001617 3300002773 Bacteria 9411
12 JGI25152J39213_1007947 3300002773 Bacteria 2685
13 JGI25150J39212_1000074 3300002774 Bacteria 60735
14 JGI25159J45721_1000077 3300002987 Bacteria 47586
15 JGI25159J45721_1001896 3300002987 Bacteria 8362
16 JGI25151J46595_10000414 3300003187 Bacteria 43361
17 JGI25151J46595_10000492 3300003187 Bacteria 37383
18 JGI25151J46595_10003675 3300003187 Bacteria 8352
19 JGI25151J46595_10004196 3300003187 Bacteria 7675
20 JGI25165J46597_1000282 3300003214 Bacteria 64762
21 JGI25165J46597_1000356 3300003214 Bacteria 51368
22 JGI25153J46596_10004715 3300003215 Bacteria 7273
23 JGI25153J46596_10006417 3300003215 Bacteria 5952
24 JGI25153J46596_10008900 3300003215 Bacteria 4738
25 rootL2_10005277 3300003322 Bacteria 17022
26 rootL2_10032282 3300003322 Bacteria 1846
27 JGI25160J50197_1000001 3300003354 Bacteria 782301
28 JGI25160J50197_1000381 3300003354 Bacteria 28878
29 JGI25160J50197_1003601 3300003354 Bacteria 6876
30 JGI25160J50197_1010718 3300003354 Bacteria 3295
31 JGI25161J50226_1000001 3300003374 Bacteria 655036
32 JGI25161J50226_1000793 3300003374 Bacteria 11888
33 JGI25161J50226_1004937 3300003374 Bacteria 2701
34 Ga0055526_1003424 3300003771 Bacteria 10075
35 Ga0055526_1003987 3300003771 Bacteria 9085
36 Ga0055526_1007821 3300003771 Bacteria 5471
37 Ga0055526_1013623 3300003771 Bacteria 3421
38 Ga0055524_1002257 3300003775 Bacteria 10079
39 Ga0055524_1002760 3300003775 Bacteria 8829
40 Ga0055524_1006795 3300003775 Bacteria 4933
41 Ga0055536_1005851 3300003781 Bacteria 5907
42 Ga0055528_1002824 3300003790 Bacteria 9084
43 Ga0055528_1003222 3300003790 Bacteria 8324
44 Ga0055528_1003301 3300003790 Bacteria 8198
45 Ga0055540_1000293 3300003792 Bacteria 44565
46 Ga0055540_1008651 3300003792 Bacteria 3637
47 Ga0055531_10000880 3300003794 Bacteria 24626
48 Ga0058692_1000800 3300003856 Bacteria 12596
49 Ga0058692_1006540 3300003856 Bacteria 3183
50 Ga0055543_1000003 3300004625 Bacteria 358656
51 Ga0055543_1000352 3300004625 Bacteria 31251
52 Ga0065165_1000469 3300005262 Bacteria 63164
53 Ga0065165_1007860 3300005262 Bacteria 5129
54 Ga0065165_1012170 3300005262 Bacteria 3523
55 Ga0070658_10298323 3300005327 Bacteria 1374
56 Ga0070670_100000566 3300005331 Bacteria 29318
57 Ga0070660_100277762 3300005339 Bacteria 1370
58 Ga0070671_100044019 3300005355 Bacteria 3709
59 Ga0068853_100004315 3300005539 Bacteria 10995
60 Ga0070665_100067542 3300005548 Bacteria 3585
61 Ga0068855_100130931 3300005563 Bacteria 2865
62 Ga0068854_100028798 3300005578 Bacteria 3841
63 Ga0068852_100075608 3300005616 Bacteria 2971
64 Ga0075365_10000682 3300006038 Bacteria 13640
65 Ga0075365_10007870 3300006038 Bacteria 6005
66 Ga0075364_10000023 3300006051 Bacteria 52112
67 Ga0075364_10058196 3300006051 Bacteria 2533
68 Ga0075362_10005136 3300006177 Bacteria 4767
69 Ga0075369_10003554 3300006186 Bacteria 5680
70 Ga0075369_10006118 3300006186 Bacteria 4540
71 Ga0075369_10046911 3300006186 Bacteria 1862
72 Ga0075366_10074272 3300006195 Bacteria 2027
73 Ga0075370_10006226 3300006353 Bacteria 5986
74 Ga0075370_10014728 3300006353 Bacteria 4176
75 Ga0079104_1000045 3300006946 Bacteria 183705
76 Ga0099826_10002051 3300006948 Bacteria 12724
77 Ga0105251_10021203 3300009011 Bacteria 3397
78 Ga0105240_10001458 3300009093 Bacteria 40449
79 Ga0105240_10094889 3300009093 Bacteria 3638
80 Ga0105240_10147696 3300009093 Bacteria 2803
81 Ga0105243_10015957 3300009148 Bacteria 5680
82 Ga0105243_10017209 3300009148 Bacteria 5467
83 Ga0105248_10074822 3300009177 Bacteria 3806
84 Ga0105237_10000658 3300009545 Bacteria 47984
85 Ga0105237_10002043 3300009545 Bacteria 25676
86 Ga0105237_10222306 3300009545 Bacteria 1888
87 Ga0105238_10092973 3300009551 Bacteria 3004
88 Ga0123341_1000007 3300009765 Bacteria 147072
89 Ga0123341_1051853 3300009765 Bacteria 2282
90 Ga0105239_10000972 3300010375 Bacteria 40206
91 Ga0105239_10001871 3300010375 Bacteria 27550
92 Ga0105246_10109340 3300011119 Bacteria 2028
93 Ga0157373_10016945 3300013100 Bacteria 5309
94 Ga0157371_10000017 3300013102 Bacteria 320830
95 Ga0157371_10010603 3300013102 Bacteria 7161
96 Ga0157370_10000494 3300013104 Bacteria 49013
97 Ga0157370_10000960 3300013104 Bacteria 36558
98 Ga0157369_10079229 3300013105 Bacteria 3518
99 Ga0157380_10080306 3300014326 Bacteria 2665
100 Ga0182007_10001170 3300015262 Bacteria 14225
101 Ga0209435_100054 3300025206 Bacteria 86285
102 Ga0209436_100607 3300025208 Bacteria 15330
103 Ga0209563_102009 3300025230 Bacteria 4867
104 Ga0207427_102445 3300025231 Bacteria 5005
105 Ga0209437_100051 3300025233 Bacteria 392523
106 Ga0209437_100098 3300025233 Bacteria 229766
107 Ga0207425_1000075 3300025245 Bacteria 107452
108 Ga0207425_1003257 3300025245 Bacteria 5295
109 Ga0207425_1009285 3300025245 Bacteria 2455
110 Ga0209646_1000170 3300025246 Bacteria 86285
111 Ga0209646_1002615 3300025246 Bacteria 3878
112 Ga0209026_1000013 3300025250 Bacteria 415633
113 Ga0209026_1000193 3300025250 Bacteria 86285
114 Ga0209677_100166 3300025253 Bacteria 56940
115 Ga0209148_1000884 3300025254 Bacteria 20551
116 Ga0209148_1004642 3300025254 Bacteria 3326
117 Ga0209759_1000149 3300025256 Bacteria 120932
118 Ga0209759_1000222 3300025256 Bacteria 86285
119 Ga0209759_1012489 3300025256 Bacteria 2350
120 Ga0209129_1000156 3300025258 Bacteria 107484
121 Ga0209129_1001514 3300025258 Bacteria 12880
122 Ga0209129_1001972 3300025258 Bacteria 10700
123 Ga0209129_1006025 3300025258 Bacteria 4067
124 Ga0209129_1009095 3300025258 Bacteria 2667
125 Ga0209233_1000095 3300025261 Bacteria 303783
126 Ga0209233_1000113 3300025261 Bacteria 253455
127 Ga0209233_1000148 3300025261 Bacteria 185135
128 Ga0209455_1000353 3300025272 Bacteria 42992
129 Ga0209673_1000010 3300025273 Bacteria 596656
130 Ga0209673_1000117 3300025273 Bacteria 172081
131 Ga0209673_1000151 3300025273 Bacteria 148103
132 Ga0209673_1002135 3300025273 Bacteria 14743
133 Ga0209673_1002627 3300025273 Bacteria 12065
134 Ga0209130_1000003 3300025284 Bacteria 677988
135 Ga0209130_1000020 3300025284 Bacteria 379297
136 Ga0209676_1004375 3300025292 Bacteria 7901
137 Ga0209025_1000070 3300025294 Bacteria 287776
138 Ga0209025_1000121 3300025294 Bacteria 208700
139 Ga0209025_1000213 3300025294 Bacteria 139002
140 Ga0209025_1000571 3300025294 Bacteria 66955
141 Ga0209025_1000675 3300025294 Bacteria 58767
142 Ga0209025_1002009 3300025294 Bacteria 23270
143 Ga0209025_1023349 3300025294 Bacteria 3235
144 Ga0209025_1042370 3300025294 Bacteria 1935
145 Ga0209564_1000386 3300025295 Bacteria 79939
146 Ga0209564_1000424 3300025295 Bacteria 74299
147 Ga0209564_1000628 3300025295 Bacteria 53862
148 Ga0209564_1008694 3300025295 Bacteria 4959
149 Ga0209758_1000094 3300025297 Bacteria 241068
150 Ga0209758_1000405 3300025297 Bacteria 73971
151 Ga0209758_1000688 3300025297 Bacteria 50116
152 Ga0209758_1001271 3300025297 Bacteria 31244
153 Ga0209758_1001447 3300025297 Bacteria 27963
154 Ga0209758_1001757 3300025297 Bacteria 24051
155 Ga0209050_1006026 3300025298 Bacteria 7344
156 Ga0209050_1013193 3300025298 Bacteria 3696
157 Ga0209256_1000717 3300025299 Bacteria 43910
158 Ga0209256_1000729 3300025299 Bacteria 43454
159 Ga0209256_1001535 3300025299 Bacteria 23187
160 Ga0209256_1002359 3300025299 Bacteria 15682
161 Ga0209256_1006992 3300025299 Bacteria 5739
162 Ga0209256_1025604 3300025299 Bacteria 1714
163 Ga0207426_1000008 3300025302 Bacteria 848730
164 Ga0207426_1000011 3300025302 Bacteria 791203
165 Ga0207426_1000394 3300025302 Bacteria 74327
166 Ga0207426_1000449 3300025302 Bacteria 65802
167 Ga0209051_1000097 3300025303 Bacteria 167378
168 Ga0209051_1000829 3300025303 Bacteria 31990
169 Ga0209051_1001404 3300025303 Bacteria 20712
170 Ga0209051_1005145 3300025303 Bacteria 7757
171 Ga0209051_1016685 3300025303 Bacteria 3308
172 Ga0209257_1000319 3300025304 Bacteria 100552
173 Ga0209257_1004804 3300025304 Bacteria 10050
174 Ga0209257_1029914 3300025304 Bacteria 1765
175 Ga0207705_10223324 3300025909 Bacteria 1431
176 Ga0207695_10001420 3300025913 Bacteria 40295
177 Ga0207671_10000757 3300025914 Bacteria 40978
178 Ga0207671_10000934 3300025914 Bacteria 36501
179 Ga0207650_10027448 3300025925 Bacteria 4076
180 Ga0207644_10101728 3300025931 Bacteria 2160
181 Ga0207709_10022343 3300025935 Bacteria 3588
182 Ga0207709_10041873 3300025935 Bacteria 2751
183 Ga0207667_10047819 3300025949 Bacteria 4526
184 Ga0207668_10234654 3300025972 Bacteria 1481
185 Ga0207640_10055945 3300025981 Bacteria 2587
186 Ga0207658_10134406 3300025986 Bacteria 1992
187 Ga0207639_10002070 3300026041 Bacteria 13516
188 Ga0207698_10135474 3300026142 Bacteria 2112
189 Ga0209281_1000034 3300027111 Bacteria 382562
190 Ga0209371_1000022 3300027312 Bacteria 536342
191 Ga0209371_1000173 3300027312 Bacteria 96201
192 Ga0209282_1000467 3300027666 Bacteria 19765
193 Ga0268266_10000578 3300028379 Bacteria 50618
194 Ga0268266_10164495 3300028379 Bacteria 2009
195 Ga0268266_10243367 3300028379 Bacteria 1661
196 Ga0307515_10017500 3300028794 Bacteria 13046
197 Ga0307515_10068957 3300028794 Bacteria 4846
198 Ga0307515_10228268 3300028794 Bacteria 1661
199 Ga0268256_1000019 3300030500 Bacteria 587949
200 Ga0268256_1003106 3300030500 Bacteria 7764
201 Ga0316181_1022445 3300030744 Bacteria 6710
202 Ga0265325_10051900 3300031241 Bacteria 2107
203 Ga0265340_10000904 3300031247 Bacteria 16812
204 Ga0265340_10014098 3300031247 Bacteria 4184
205 Ga0265339_10003116 3300031249 Bacteria 11665
206 Ga0265316_10015200 3300031344 Bacteria 6739
207 Ga0307513_10274508 3300031456 Bacteria 1467
208 Ga0265313_10002428 3300031595 Bacteria 16083
209 Ga0265314_10056251 3300031711 Bacteria 2709
210 Ga0265342_10005338 3300031712 Bacteria 9826
211 Ga0307405_10034674 3300031731 Bacteria 3005
212 Ga0307410_10080403 3300031852 Bacteria 2286
213 Ga0307412_10001389 3300031911 Bacteria 13452
214 Ga0307414_10044835 3300032004 Bacteria 3024
215 Ga0373927_0001376 3300035695 Bacteria 18331
216 Ga0373925_0004995 3300037068 Bacteria 9956
217 Ga0395905_0005329 3300037471 Bacteria 13145
218 Ga0395901_0188608 3300038443 Bacteria 2162
219 Ga0400488_07006 3300038741 Bacteria 2299
220 Ga0436365_1764048 3300039437 Bacteria 16656
221 Ga0436361_0715432 3300039447 Bacteria 3458
222 Ga0439465_0010599 3300041413 Bacteria 2893
223 Ga0439465_0013473 3300041413 Bacteria 2548
224 Ga0439465_0046821 3300041413 Bacteria 1409
225 Ga0451787_174959 3300041441 Bacteria 1673
226 Ga0451791_0940235 3300041451 Bacteria 1820
227 Ga0451798_0157085 3300041458 Bacteria 3363
228 Ga0452271_16094 3300041916 Bacteria 1374
229 Ga0466963_0079241 3300044694 Bacteria 2222
230 Ga0466968_0049289 3300044735 Bacteria 1794
231 Ga0466970_0000524 3300044765 Bacteria 18839
232 Ga0466959_0184281 3300045049 Bacteria 1459
233 Ga0466958_0007809 3300045836 Bacteria 5907
234 Ga0466967_0305619 3300045976 Bacteria 1531
235 Ga0495592_0105190 3300046454 Bacteria 2005
236 Ga0495629_0064461 3300046459 Bacteria 2558
237 Ga0495638_0009521 3300046460 Bacteria 6811
238 Ga0495638_0027814 3300046460 Bacteria 3657
239 Ga0495638_0042380 3300046460 Bacteria 2875
240 Ga0495638_0085393 3300046460 Bacteria 1909
241 Ga0495650_0026130 3300046471 Bacteria 2722
242 Ga0495650_0074115 3300046471 Bacteria 1328
243 Ga0495662_0023776 3300046476 Bacteria 2959
244 Ga0495664_0052603 3300046477 Bacteria 2421
245 Ga0495583_0012484 3300046506 Bacteria 4802
246 Ga0495606_0013657 3300046507 Bacteria 6399
247 Ga0495606_0014724 3300046507 Bacteria 6081
248 Ga0495606_0039914 3300046507 Bacteria 3158
249 Ga0495606_0052813 3300046507 Bacteria 2640
250 Ga0495610_0007444 3300046512 Bacteria 7283
251 Ga0495610_0009592 3300046512 Bacteria 6104
252 Ga0495632_0047750 3300046519 Bacteria 2122
253 Ga0495643_0022665 3300046522 Bacteria 3579
254 Ga0495643_0046309 3300046522 Bacteria 2358
255 Ga0495654_0003850 3300046530 Bacteria 9065
256 Ga0495597_0008991 3300046542 Bacteria 4975
257 Ga0495633_0014687 3300046558 Bacteria 4084
258 Ga0495633_0014942 3300046558 Bacteria 4036
259 Ga0495625_0012841 3300046660 Bacteria 6771
260 Ga0495625_0034115 3300046660 Bacteria 3757
261 Ga0495625_0059114 3300046660 Bacteria 2721
262 Ga0495661_0032140 3300046665 Bacteria 3321
263 Ga0495649_0012635 3300046694 Bacteria 4901
264 Ga0495660_0018465 3300046810 Bacteria 4010
265 Ga0495604_0020027 3300047317 Bacteria 5346
266 Ga0495681_0005924 3300047470 Bacteria 8109
267 Ga0495686_0000565 3300047472 Bacteria 52684
268 Ga0495686_0013713 3300047472 Bacteria 5616
269 Ga0495686_0149779 3300047472 Bacteria 1370
270 Ga0496100_0001864 3300048903 Bacteria 10558
271 Ga0496101_0174580 3300048904 Bacteria 1652
272 Ga0496102_0001618 3300048905 Bacteria 19853
273 Ga0496102_0240620 3300048905 Bacteria 1706
274 Ga0496103_0002410 3300048906 Bacteria 11766
275 Ga0496103_0031517 3300048906 Bacteria 3230
276 Ga0496104_0119323 3300048907 Bacteria 2532
277 Ga0496105_0023367 3300048908 Bacteria 5012
278 Ga0496106_0009017 3300048909 Bacteria 7371
279 Ga0496106_0214203 3300048909 Bacteria 1535
280 Ga0496107_0057620 3300048910 Bacteria 2809
281 Ga0496110_0013800 3300048913 Bacteria 6694
282 Ga0496111_0025611 3300048914 Bacteria 4163
283 Ga0496111_0030288 3300048914 Bacteria 3848
284 Ga0496113_0092317 3300048916 Bacteria 2335
285 Ga0496114_0074563 3300048917 Bacteria 2856
286 Ga0496114_0106751 3300048917 Bacteria 2396
287 Ga0496116_0000142 3300048919 Bacteria 150342
288 Ga0496116_0005080 3300048919 Bacteria 12364
289 Ga0496116_0006547 3300048919 Bacteria 10550
290 Ga0496116_0012183 3300048919 Bacteria 7036
291 Ga0496116_0020114 3300048919 Bacteria 5080
292 Ga0496116_0057113 3300048919 Bacteria 2553
293 Ga0496117_0000002 3300048920 Bacteria 2483758
294 Ga0496117_0001463 3300048920 Bacteria 34016
295 Ga0496117_0002281 3300048920 Bacteria 24769
296 Ga0496117_0020391 3300048920 Bacteria 5404
297 Ga0496117_0025738 3300048920 Bacteria 4618
298 Ga0496117_0045011 3300048920 Bacteria 3192
299 Ga0496118_0000087 3300048921 Bacteria 176693
300 Ga0496118_0002480 3300048921 Bacteria 24769
301 Ga0496118_0016824 3300048921 Bacteria 6684
302 Ga0496118_0030218 3300048921 Bacteria 4526
303 Ga0496118_0049139 3300048921 Bacteria 3251
304 Ga0496118_0053430 3300048921 Bacteria 3071
305 Ga0496119_0005992 3300048922 Bacteria 11419
306 Ga0496119_0020173 3300048922 Bacteria 4869
307 Ga0496119_0027753 3300048922 Bacteria 3881
308 Ga0496119_0046658 3300048922 Bacteria 2703
309 Ga0496119_0047199 3300048922 Bacteria 2681
310 Ga0496120_0000399 3300048923 Bacteria 70103
311 Ga0496120_0004100 3300048923 Bacteria 12588
312 Ga0496120_0018905 3300048923 Bacteria 4426
313 Ga0496120_0040924 3300048923 Bacteria 2719
314 Ga0496120_0102394 3300048923 Bacteria 1510
315 Ga0496121_0000003 3300048924 Bacteria 1191431
316 Ga0496121_0002956 3300048924 Bacteria 24769
317 Ga0496121_0009275 3300048924 Bacteria 11352
318 Ga0496121_0009810 3300048924 Bacteria 10937
319 Ga0496121_0093332 3300048924 Bacteria 2344
320 Ga0496122_0000004 3300048925 Bacteria 645283
321 Ga0496122_0000215 3300048925 Bacteria 128810
322 Ga0496122_0001329 3300048925 Bacteria 40484
323 Ga0496122_0007100 3300048925 Bacteria 12580
324 Ga0496122_0013849 3300048925 Bacteria 7853
325 Ga0496122_0016006 3300048925 Bacteria 7130
326 Ga0496122_0020411 3300048925 Bacteria 5987
327 Ga0496122_0029488 3300048925 Bacteria 4626
328 Ga0496122_0112068 3300048925 Bacteria 1787
329 Ga0496123_0000007 3300048926 Bacteria 645283
330 Ga0496123_0000018 3300048926 Bacteria 404553
331 Ga0496123_0000306 3300048926 Bacteria 95266
332 Ga0496123_0002543 3300048926 Bacteria 22299
333 Ga0496123_0018763 3300048926 Bacteria 5482
334 Ga0496123_0024127 3300048926 Bacteria 4632
335 Ga0496123_0074759 3300048926 Bacteria 2095
336 Ga0496124_0000252 3300048927 Bacteria 103596
337 Ga0496124_0001021 3300048927 Bacteria 44387
338 Ga0496124_0003328 3300048927 Bacteria 19797
339 Ga0496124_0010588 3300048927 Bacteria 9322
340 Ga0496124_0019805 3300048927 Bacteria 6244
341 Ga0496124_0020478 3300048927 Bacteria 6109
342 Ga0496124_0038741 3300048927 Bacteria 4136
343 Ga0496124_0085557 3300048927 Bacteria 2583
344 Ga0496124_0102262 3300048927 Bacteria 2319
345 Ga0496125_0000039 3300048928 Bacteria 318665
346 Ga0496125_0000161 3300048928 Bacteria 150707
347 Ga0496125_0003436 3300048928 Bacteria 19195
348 Ga0496125_0017278 3300048928 Bacteria 6888
349 Ga0496125_0030190 3300048928 Bacteria 4853
350 Ga0496125_0118898 3300048928 Bacteria 1891
351 Ga0496125_0133394 3300048928 Bacteria 1743
352 Ga0496126_0000166 3300048929 Bacteria 152470
353 Ga0496126_0000212 3300048929 Bacteria 128871
354 Ga0496126_0130443 3300048929 Bacteria 2172
355 Ga0496126_0145316 3300048929 Bacteria 2037
356 Ga0496126_0288791 3300048929 Bacteria 1357
357 Ga0501032_0058949 3300049569 Bacteria 2577
358 Ga0501032_0067487 3300049569 Bacteria 2389
359 Ga0501032_0116544 3300049569 Bacteria 1766
360 Ga0501033_0001575 3300049570 Bacteria 20086
361 Ga0501034_0000222 3300049571 Bacteria 108857
362 Ga0501034_0055133 3300049571 Bacteria 4001
363 Ga0501036_0083391 3300049572 Bacteria 2702
364 Ga0501037_0080175 3300049573 Bacteria 2369
365 Ga0501038_0036016 3300049574 Bacteria 4343
366 Ga0501038_0105609 3300049574 Bacteria 2339
367 Ga0501038_0169247 3300049574 Bacteria 1770
368 Ga0501039_0052769 3300049575 Bacteria 3145
369 Ga0501046_0011945 3300049580 Bacteria 7409
370 Ga0501047_0040771 3300049581 Bacteria 4489
371 Ga0501047_0050784 3300049581 Bacteria 4005
372 Ga0501047_0179386 3300049581 Bacteria 1984
373 Ga0501070_0023967 3300049586 Bacteria 5116
374 Ga0501070_0095680 3300049586 Bacteria 2457
375 Ga0501070_0140325 3300049586 Bacteria 1995
376 Ga0501252_000845 3300049682 Bacteria 2602
377 Ga0501080_0093593 3300049742 Bacteria 2790
378 Ga0501083_0064272 3300049744 Bacteria 2445
379 Ga0501280_001427 3300049776 Bacteria 4437
380 Ga0501035_0006107 3300049822 Bacteria 11338
381 Ga0501035_0025886 3300049822 Bacteria 5376
382 Ga0501035_0065451 3300049822 Bacteria 3228
383 Ga0501044_0080837 3300049823 Bacteria 3291
384 Ga0501044_0142417 3300049823 Bacteria 2385
385 nmdc:mga03683_66373_c1 3300050489 Bacteria 1534
386 nmdc:mga00v17_12964_c1 3300050491 Bacteria 4615
387 nmdc:mga00v17_238_c1 3300050491 Bacteria 32698
388 nmdc:mga00v17_45_c1 3300050491 Bacteria 78686
389 nmdc:mga0yw44_25378_c1 3300050492 Bacteria 3369
390 nmdc:mga0yw44_34713_c1 3300050492 Bacteria 2958
391 nmdc:mga0yw44_546_c1 3300050492 Bacteria 13524
392 nmdc:mga0k408_82358_c1 3300050493 Bacteria 1885
393 nmdc:mga07m45_22225_c1 3300050496 Bacteria 3462
394 nmdc:mga0sz30_523_c1 3300050516 Bacteria 14337
395 nmdc:mga0sz30_8436_c1 3300050516 Bacteria 3892
396 Ga0500557_008160 3300053105 Bacteria 2491
397 Ga0500560_000143 3300053107 Bacteria 7859
398 Ga0500569_002736 3300053109 Bacteria 3512
399 Ga0500572_004496 3300053111 Bacteria 3163
400 Ga0500608_034540 3300053122 Bacteria 2409
401 Ga0500618_000233 3300053125 Bacteria 43724
402 Ga0500618_003741 3300053125 Bacteria 5096
403 Ga0500618_014564 3300053125 Bacteria 2005
404 Ga0500618_016019 3300053125 Bacteria 1883
405 Ga0500658_0003760 3300053134 Bacteria 5716
406 Ga0500559_0012090 3300053136 Bacteria 3676
407 Ga0500568_0000010 3300053139 Bacteria 249043
408 Ga0500568_0010855 3300053139 Bacteria 4248
409 Ga0500573_0031271 3300053140 Bacteria 3071
410 Ga0500604_0000494 3300053151 Bacteria 10893
411 Ga0500604_0007091 3300053151 Bacteria 2966
412 Ga0500616_0000102 3300053153 Bacteria 168834
413 Ga0500616_0004971 3300053153 Bacteria 9220
414 Ga0500616_0013143 3300053153 Bacteria 4818
415 Ga0500616_0067085 3300053153 Bacteria 1841
416 Ga0500622_0003973 3300053156 Bacteria 9537
417 Ga0500622_0008574 3300053156 Bacteria 5706
418 Ga0500622_0015802 3300053156 Bacteria 4041
419 Ga0500624_000801 3300053157 Bacteria 7322
420 Ga0500633_0002358 3300053160 Bacteria 3864
421 Ga0500634_0000030 3300053161 Bacteria 76925
422 Ga0500634_0022440 3300053161 Bacteria 3425
423 Ga0500634_0035125 3300053161 Bacteria 2731
424 Ga0500636_0000003 3300053177 Bacteria 240189
425 Ga0500636_0006263 3300053177 Bacteria 6824

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046460 Ga0495638_0042380 Ga0495638_0042380_1815_2843 342
2 3300045976 Ga0466967_0305619 Ga0466967_0305619_450_1499 349
3 3300046471 Ga0495650_0074115 Ga0495650_0074115_11_1120 369
4 3300048929 Ga0496126_0288791 Ga0496126_0288791_146_1327 392
5 3300049573 Ga0501037_0080175 Ga0501037_0080175_21_1208 393
6 3300039447 Ga0436361_0715432 Ga0436361_0715432_1306_2547 394
7 3300049581 Ga0501047_0179386 Ga0501047_0179386_45_1265 399
8 3300053136 Ga0500559_0012090 Ga0500559_0012090_524_1750 399
9 3300048925 Ga0496122_0000215 Ga0496122_0000215_102423_103679 405
10 3300048926 Ga0496123_0000306 Ga0496123_0000306_25132_26388 405
11 3300031247 Ga0265340_10014098 Ga0265340_100140982 406
12 3300031711 Ga0265314_10056251 Ga0265314_100562512 406
13 3300053122 Ga0500608_034540 Ga0500608_034540_800_2023 407
14 3300053156 Ga0500622_0003973 Ga0500622_0003973_2520_3743 407
15 iso_pu_bacteria 2643221629 2644165372 407
16 iso_pu_bacteria 2643221662 2644348367 407
17 iso_pu_bacteria 2854681122 2854684396 407
18 iso_pu_bacteria 2989771324 2989773056 407
19 3300025230 Ga0209563_102009 Ga0209563_1020094 408
20 3300028794 Ga0307515_10017500 Ga0307515_100175007 408
21 3300028794 Ga0307515_10228268 Ga0307515_102282681 408
22 3300035695 Ga0373927_0001376 Ga0373927_0001376_12615_13841 408
23 3300037068 Ga0373925_0004995 Ga0373925_0004995_2257_3483 408
24 3300037471 Ga0395905_0005329 Ga0395905_0005329_1098_2324 408
25 3300046460 Ga0495638_0027814 Ga0495638_0027814_1698_2924 408
26 3300046660 Ga0495625_0059114 Ga0495625_0059114_1009_2235 408
27 3300048924 Ga0496121_0093332 Ga0496121_0093332_892_2118 408
28 3300050493 nmdc:mga0k408_82358_c1 nmdc:mga0k408_82358_c1_353_1579 408
29 3300002705 JGI25156J39149_1003119 JGI25156J39149_10031191 409
30 3300002741 JGI25157J39369_1001962 JGI25157J39369_10019624 409
31 3300009093 Ga0105240_10094889 Ga0105240_100948892 409
32 3300025250 Ga0209026_1000013 Ga0209026_10000131 409
33 3300025256 Ga0209759_1000149 Ga0209759_100014941 409
34 3300031241 Ga0265325_10051900 Ga0265325_100519002 409
35 3300031247 Ga0265340_10000904 Ga0265340_100009046 409
36 3300031249 Ga0265339_10003116 Ga0265339_1000311610 409
37 3300031344 Ga0265316_10015200 Ga0265316_100152003 409
38 3300031595 Ga0265313_10002428 Ga0265313_1000242813 409
39 3300031712 Ga0265342_10005338 Ga0265342_100053387 409
40 3300038741 Ga0400488_07006 Ga0400488_07006_417_1682 409
41 3300049570 Ga0501033_0001575 Ga0501033_0001575_14835_16100 409
42 3300049822 Ga0501035_0006107 Ga0501035_0006107_6145_7410 409
43 iso_pu_bacteria 2509276021 2509392004 409
44 iso_pu_bacteria 2510917030 2511199079 409
45 iso_pu_bacteria 2529292951 2530645900 409
46 iso_pu_bacteria 2582581298 2585222882 409
47 iso_pu_bacteria 2585427529 2585545465 409
48 iso_pu_bacteria 2718217927 2719386464 409
49 iso_pu_bacteria 2718218423 2721400168 409
50 iso_pu_bacteria 2721755809 2724038981 409
51 iso_pu_bacteria 2791355256 2793294388 409
52 iso_pu_bacteria 2791355262 2793334540 409
53 iso_pu_bacteria 2841864319 2841870901 409
54 iso_pu_bacteria 2842341865 2842346512 409
55 iso_pu_bacteria 2842363717 2842368905 409
56 iso_pu_bacteria 2842395702 2842399826 409
57 iso_pu_bacteria 2891373044 2891376958 409
58 iso_pu_bacteria 2919100787 2919107605 409
59 iso_pu_bacteria 2989349275 2989352510 409
60 iso_pu_bacteria 3005445848 3005448499 409
61 iso_pu_bacteria 8005275841 8005281262 409
62 iso_pu_bacteria 8005695170 8005697452 409
63 iso_pu_bacteria 8018176218 8018176999 409
64 iso_pu_bacteria 8055431914 8055432714 409
65 3300006946 Ga0079104_1000045 Ga0079104_100004528 410
66 3300027111 Ga0209281_1000034 Ga0209281_1000034104 410
67 3300049574 Ga0501038_0169247 Ga0501038_0169247_322_1575 410
68 3300049581 Ga0501047_0040771 Ga0501047_0040771_1940_3193 410
69 3300049742 Ga0501080_0093593 Ga0501080_0093593_1221_2474 410
70 3300053161 Ga0500634_0022440 Ga0500634_0022440_1798_3033 410
71 iso_pu_bacteria 2537561587 2537876057 410
72 iso_pu_bacteria 2554235003 2554248278 410
73 iso_pu_bacteria 2558860242 2559295394 410
74 iso_pu_bacteria 2599185210 2599601707 410
75 iso_pu_bacteria 2600255279 2601610032 410
76 iso_pu_bacteria 2600255308 2601746807 410
77 iso_pu_bacteria 2643221551 2643776197 410
78 iso_pu_bacteria 2643221555 2643794644 410
79 iso_pu_bacteria 2643221558 2643811490 410
80 iso_pu_bacteria 2643221568 2643856714 410
81 iso_pu_bacteria 2643221582 2643920296 410
82 iso_pu_bacteria 2643221693 2644521912 410
83 iso_pu_bacteria 2808606387 2808987872 410
84 iso_pu_bacteria 2818991439 2819559106 410
85 iso_pu_bacteria 2838675328 2838675725 410
86 iso_pu_bacteria 2838714209 2838714607 410
87 iso_pu_bacteria 2838719591 2838721592 410
88 iso_pu_bacteria 2838724970 2838725367 410
89 iso_pu_bacteria 2841846520 2841848542 410
90 iso_pu_bacteria 2841859092 2841862173 410
91 iso_pu_bacteria 2842124991 2842125427 410
92 iso_pu_bacteria 2842130223 2842130620 410
93 iso_pu_bacteria 2842152218 2842154210 410
94 iso_pu_bacteria 2842170452 2842170851 410
95 iso_pu_bacteria 2842175837 2842177830 410
96 iso_pu_bacteria 2842187318 2842187716 410
97 iso_pu_bacteria 2842211629 2842212027 410
98 iso_pu_bacteria 2842224351 2842226354 410
99 iso_pu_bacteria 2842515876 2842518957 410
100 iso_pu_bacteria 2899792073 2899796004 410
101 iso_pu_bacteria 2899845264 2899849174 410
102 iso_pu_bacteria 2919114240 2919114645 410
103 iso_pu_bacteria 2919166419 2919169299 410
104 iso_pu_bacteria 2926754445 2926755661 410
105 iso_pu_bacteria 2926760298 2926762781 410
106 iso_pu_bacteria 2929138655 2929140918 410
107 iso_pu_bacteria 2933006813 2933008855 410
108 iso_pu_bacteria 2933011516 2933014869 410
109 iso_pu_bacteria 2933594066 2933596546 410
110 iso_pu_bacteria 2978969890 2978974675 410
111 iso_pu_bacteria 2979089926 2979094729 410
112 iso_pu_bacteria 2979095461 2979100705 410
113 iso_pu_bacteria 2979100975 2979103960 410
114 iso_pu_bacteria 2984509177 2984511472 410
115 iso_pu_bacteria 2984518228 2984522167 410
116 iso_pu_bacteria 2984537506 2984541466 410
117 iso_pu_bacteria 2984587000 2984589995 410
118 iso_pu_bacteria 2984601300 2984603743 410
119 iso_pu_bacteria 3003930520 3003935376 410
120 iso_pu_bacteria 650716007 650740604 410
121 iso_pu_bacteria 8003570095 8003571671 410
122 iso_pu_bacteria 8018150411 8018155228 410
123 iso_pu_bacteria 8054460903 8054463029 410
124 iso_pu_bacteria 8054558443 8054560935 410
125 3300041413 Ga0439465_0046821 Ga0439465_0046821_17_1255 411
126 3300049574 Ga0501038_0036016 Ga0501038_0036016_1384_2640 411
127 3300049586 Ga0501070_0140325 Ga0501070_0140325_592_1848 411
128 3300049822 Ga0501035_0065451 Ga0501035_0065451_1983_3218 411
129 iso_pu_bacteria 2558860983 2561468332 411
130 iso_pu_bacteria 2773857925 2774872972 411
131 iso_pu_bacteria 2882456835 2882460783 411
132 iso_pu_bacteria 2884298095 2884300900 411
133 iso_pu_bacteria 2891048133 2891051610 411
134 3300009093 Ga0105240_10147696 Ga0105240_101476962 412
135 3300009545 Ga0105237_10222306 Ga0105237_102223062 412
136 3300009551 Ga0105238_10092973 Ga0105238_100929732 412
137 3300039437 Ga0436365_1764048 Ga0436365_1764048_3782_5053 412
138 3300048910 Ga0496107_0057620 Ga0496107_0057620_1416_2690 412
139 iso_pu_bacteria 2510917026 2511175339 412
140 iso_pu_bacteria 2585427633 2585996245 412
141 iso_pu_bacteria 2585427634 2586000856 412
142 iso_pu_bacteria 2599185236 2599721876 412
143 iso_pu_bacteria 2600254933 2600374323 412
144 iso_pu_bacteria 2821123053 2821127451 412
145 iso_pu_bacteria 2838736955 2838737976 412
146 iso_pu_bacteria 2841840854 2841841655 412
147 iso_pu_bacteria 2842140634 2842141433 412
148 iso_pu_bacteria 2854896431 2854899633 412
149 iso_pu_bacteria 2854916844 2854918456 412
150 iso_pu_bacteria 2857349434 2857353639 412
151 iso_pu_bacteria 2857531043 2857536535 412
152 iso_pu_bacteria 2919171160 2919174668 412
153 iso_pu_bacteria 2958064165 2958066555 412
154 iso_pu_bacteria 2968117919 2968123890 412
155 iso_pu_bacteria 2977942078 2977945759 412
156 iso_pu_bacteria 2987636660 2987642948 412
157 iso_pu_bacteria 2995392953 2995393120 412
158 iso_pu_bacteria 3004203850 3004210741 412
159 iso_pu_bacteria 8024486573 8024488085 412
160 iso_pu_bacteria 8056875544 8056877255 412
161 3300002987 JGI25159J45721_1001896 JGI25159J45721_10018963 413
162 3300003187 JGI25151J46595_10004196 JGI25151J46595_100041967 413
163 3300003215 JGI25153J46596_10006417 JGI25153J46596_100064175 413
164 3300003354 JGI25160J50197_1003601 JGI25160J50197_10036016 413
165 3300003374 JGI25161J50226_1000793 JGI25161J50226_10007936 413
166 3300003775 Ga0055524_1002760 Ga0055524_10027605 413
167 3300003792 Ga0055540_1008651 Ga0055540_10086514 413
168 3300004625 Ga0055543_1000352 Ga0055543_100035221 413
169 3300006186 Ga0075369_10046911 Ga0075369_100469112 413
170 3300025208 Ga0209436_100607 Ga0209436_10060715 413
171 3300025245 Ga0207425_1003257 Ga0207425_10032576 413
172 3300025258 Ga0209129_1001514 Ga0209129_10015146 413
173 3300025258 Ga0209129_1001972 Ga0209129_10019724 413
174 3300025284 Ga0209130_1000020 Ga0209130_1000020201 413
175 3300025294 Ga0209025_1000121 Ga0209025_1000121119 413
176 3300025294 Ga0209025_1002009 Ga0209025_100200920 413
177 3300025295 Ga0209564_1000628 Ga0209564_100062842 413
178 3300025297 Ga0209758_1001271 Ga0209758_100127124 413
179 3300025297 Ga0209758_1001447 Ga0209758_100144710 413
180 3300025297 Ga0209758_1001757 Ga0209758_10017578 413
181 3300025299 Ga0209256_1006992 Ga0209256_10069922 413
182 3300025302 Ga0207426_1000008 Ga0207426_1000008270 413
183 3300025303 Ga0209051_1000829 Ga0209051_10008299 413
184 3300041413 Ga0439465_0013473 Ga0439465_0013473_902_2146 413
185 3300046522 Ga0495643_0046309 Ga0495643_0046309_778_2022 413
186 3300046694 Ga0495649_0012635 Ga0495649_0012635_571_1815 413
187 3300048909 Ga0496106_0009017 Ga0496106_0009017_5072_6316 413
188 3300048920 Ga0496117_0001463 Ga0496117_0001463_22288_23529 413
189 3300048921 Ga0496118_0049139 Ga0496118_0049139_188_1432 413
190 3300048922 Ga0496119_0046658 Ga0496119_0046658_504_1745 413
191 3300048925 Ga0496122_0001329 Ga0496122_0001329_21381_22622 413
192 3300048926 Ga0496123_0000018 Ga0496123_0000018_17024_18265 413
193 3300048927 Ga0496124_0001021 Ga0496124_0001021_17502_18743 413
194 3300048928 Ga0496125_0000161 Ga0496125_0000161_99146_100387 413
195 3300048928 Ga0496125_0118898 Ga0496125_0118898_40_1281 413
196 3300048929 Ga0496126_0000212 Ga0496126_0000212_13707_14948 413
197 3300049569 Ga0501032_0058949 Ga0501032_0058949_1054_2295 413
198 3300049569 Ga0501032_0116544 Ga0501032_0116544_234_1478 413
199 3300049744 Ga0501083_0064272 Ga0501083_0064272_807_2051 413
200 3300049823 Ga0501044_0142417 Ga0501044_0142417_233_1474 413
201 3300053139 Ga0500568_0000010 Ga0500568_0000010_231259_232551 413
202 3300053139 Ga0500568_0010855 Ga0500568_0010855_2173_3417 413
203 3300053151 Ga0500604_0007091 Ga0500604_0007091_1426_2670 413
204 3300053153 Ga0500616_0067085 Ga0500616_0067085_368_1615 413
205 3300053156 Ga0500622_0008574 Ga0500622_0008574_3463_4707 413
206 3300053160 Ga0500633_0002358 Ga0500633_0002358_951_2195 413
207 iso_pu_bacteria 2508501050 2508732993 413
208 iso_pu_bacteria 2508501114 2509078768 413
209 iso_pu_bacteria 2510461069 2510841254 413
210 iso_pu_bacteria 2643221580 2643910041 413
211 iso_pu_bacteria 2643221653 2644298718 413
212 iso_pu_bacteria 2643221674 2644413810 413
213 iso_pu_bacteria 2643221719 2644656947 413
214 iso_pu_bacteria 2775506901 2776260049 413
215 iso_pu_bacteria 2775507049 2776914011 413
216 iso_pu_bacteria 2818991272 2819241358 413
217 iso_pu_bacteria 2835312727 2835319245 413
218 iso_pu_bacteria 2894232714 2894234080 413
219 iso_pu_bacteria 2899803654 2899807214 413
220 iso_pu_bacteria 2932401849 2932404105 413
221 iso_pu_bacteria 2989776772 2989779254 413
222 iso_pu_bacteria 8005246636 8005248813 413
223 iso_pu_bacteria 8005658619 8005658982 413
224 3300003856 Ga0058692_1000800 Ga0058692_10008006 414
225 3300003856 Ga0058692_1006540 Ga0058692_10065405 414
226 3300005339 Ga0070660_100277762 Ga0070660_1002777621 414
227 3300006051 Ga0075364_10058196 Ga0075364_100581962 414
228 3300006186 Ga0075369_10003554 Ga0075369_100035542 414
229 3300006948 Ga0099826_10002051 Ga0099826_100020511 414
230 3300009148 Ga0105243_10017209 Ga0105243_100172094 414
231 3300013100 Ga0157373_10016945 Ga0157373_100169455 414
232 3300013102 Ga0157371_10000017 Ga0157371_10000017106 414
233 3300013102 Ga0157371_10010603 Ga0157371_100106033 414
234 3300013104 Ga0157370_10000494 Ga0157370_1000049421 414
235 3300013105 Ga0157369_10079229 Ga0157369_100792292 414
236 3300025254 Ga0209148_1000884 Ga0209148_10008842 414
237 3300025272 Ga0209455_1000353 Ga0209455_100035332 414
238 3300025294 Ga0209025_1000213 Ga0209025_100021349 414
239 3300025294 Ga0209025_1042370 Ga0209025_10423701 414
240 3300025935 Ga0207709_10022343 Ga0207709_100223432 414
241 3300027312 Ga0209371_1000022 Ga0209371_1000022131 414
242 3300027312 Ga0209371_1000173 Ga0209371_100017339 414
243 3300027666 Ga0209282_1000467 Ga0209282_10004677 414
244 3300030500 Ga0268256_1000019 Ga0268256_1000019389 414
245 3300030500 Ga0268256_1003106 Ga0268256_10031063 414
246 3300030744 Ga0316181_1022445 Ga0316181_10224453 414
247 3300046558 Ga0495633_0014687 Ga0495633_0014687_502_1761 414
248 3300047470 Ga0495681_0005924 Ga0495681_0005924_5421_6680 414
249 3300048916 Ga0496113_0092317 Ga0496113_0092317_396_1655 414
250 3300048919 Ga0496116_0000142 Ga0496116_0000142_28527_29774 414
251 3300048920 Ga0496117_0000002 Ga0496117_0000002_414714_415973 414
252 3300048920 Ga0496117_0020391 Ga0496117_0020391_3920_5167 414
253 3300048921 Ga0496118_0000087 Ga0496118_0000087_26273_27532 414
254 3300048921 Ga0496118_0053430 Ga0496118_0053430_1395_2642 414
255 3300048922 Ga0496119_0027753 Ga0496119_0027753_2453_3712 414
256 3300048922 Ga0496119_0047199 Ga0496119_0047199_942_2189 414
257 3300048923 Ga0496120_0000399 Ga0496120_0000399_1870_3129 414
258 3300048923 Ga0496120_0040924 Ga0496120_0040924_621_1868 414
259 3300048924 Ga0496121_0000003 Ga0496121_0000003_448204_449451 414
260 3300048925 Ga0496122_0000004 Ga0496122_0000004_173885_175144 414
261 3300048925 Ga0496122_0013849 Ga0496122_0013849_973_2220 414
262 3300048926 Ga0496123_0000007 Ga0496123_0000007_173885_175144 414
263 3300048926 Ga0496123_0024127 Ga0496123_0024127_2627_3874 414
264 3300048927 Ga0496124_0000252 Ga0496124_0000252_76445_77704 414
265 3300048927 Ga0496124_0003328 Ga0496124_0003328_1079_2338 414
266 3300048927 Ga0496124_0102262 Ga0496124_0102262_366_1613 414
267 3300048928 Ga0496125_0000039 Ga0496125_0000039_226449_227696 414
268 3300048928 Ga0496125_0030190 Ga0496125_0030190_2526_3785 414
269 3300048929 Ga0496126_0000166 Ga0496126_0000166_23553_24800 414
270 3300048929 Ga0496126_0145316 Ga0496126_0145316_515_1774 414
271 3300050491 nmdc:mga00v17_12964_c1 nmdc:mga00v17_12964_c1_598_1845 414
272 3300050491 nmdc:mga00v17_238_c1 nmdc:mga00v17_238_c1_16011_17270 414
273 3300050492 nmdc:mga0yw44_34713_c1 nmdc:mga0yw44_34713_c1_1392_2651 414
274 3300050516 nmdc:mga0sz30_523_c1 nmdc:mga0sz30_523_c1_12064_13323 414
275 3300053107 Ga0500560_000143 Ga0500560_000143_786_2045 414
276 3300053111 Ga0500572_004496 Ga0500572_004496_623_1870 414
277 3300053157 Ga0500624_000801 Ga0500624_000801_1339_2598 414
278 3300053161 Ga0500634_0035125 Ga0500634_0035125_704_1963 414
279 3300053177 Ga0500636_0000003 Ga0500636_0000003_193110_194357 414
280 3300053177 Ga0500636_0006263 Ga0500636_0006263_1446_2693 414
281 iso_pu_bacteria 2509276033 2509445596 414
282 iso_pu_bacteria 2509276033 2509447103 414
283 iso_pu_bacteria 2510065019 2510134007 414
284 iso_pu_bacteria 2510461076 2510895424 414
285 iso_pu_bacteria 2510917022 2511133981 414
286 iso_pu_bacteria 2510917028 2511187104 414
287 iso_pu_bacteria 2513237084 2513567918 414
288 iso_pu_bacteria 2513237085 2513576994 414
289 iso_pu_bacteria 2513237088 2513596524 414
290 iso_pu_bacteria 2513237093 2513633333 414
291 iso_pu_bacteria 2513237103 2513707648 414
292 iso_pu_bacteria 2513237138 2513865650 414
293 iso_pu_bacteria 2513237144 2513908944 414
294 iso_pu_bacteria 2513237146 2513925337 414
295 iso_pu_bacteria 2513237162 2514019957 414
296 iso_pu_bacteria 2515075009 2515113054 414
297 iso_pu_bacteria 2515154113 2515638331 414
298 iso_pu_bacteria 2515154114 2515641014 414
299 iso_pu_bacteria 2515154116 2515655305 414
300 iso_pu_bacteria 2515154134 2515739534 414
301 iso_pu_bacteria 2516653077 2517036756 414
302 iso_pu_bacteria 2516653085 2517077115 414
303 iso_pu_bacteria 2517093000 2517095883 414
304 iso_pu_bacteria 2517287029 2517407453 414
305 iso_pu_bacteria 2519899620 2520377161 414
306 iso_pu_bacteria 2524023209 2524459642 414
307 iso_pu_bacteria 2534681796 2535516917 414
308 iso_pu_bacteria 2582581294 2585202218 414
309 iso_pu_bacteria 2582581299 2585231786 414
310 iso_pu_bacteria 2582581304 2585255139 414
311 iso_pu_bacteria 2582581307 2585271190 414
312 iso_pu_bacteria 2582581308 2585283377 414
313 iso_pu_bacteria 2582581315 2585323279 414
314 iso_pu_bacteria 2582581316 2585331421 414
315 iso_pu_bacteria 2582581867 2585402347 414
316 iso_pu_bacteria 2585427526 2585527496 414
317 iso_pu_bacteria 2585427527 2585531430 414
318 iso_pu_bacteria 2585427528 2585538234 414
319 iso_pu_bacteria 2585427530 2585552670 414
320 iso_pu_bacteria 2585427531 2585558914 414
321 iso_pu_bacteria 2585427590 2585822966 414
322 iso_pu_bacteria 2585427593 2585836183 414
323 iso_pu_bacteria 2585427594 2585843274 414
324 iso_pu_bacteria 2585427608 2585898297 414
325 iso_pu_bacteria 2585427609 2585904116 414
326 iso_pu_bacteria 2585428125 2587980767 414
327 iso_pu_bacteria 2599185170 2599417250 414
328 iso_pu_bacteria 2615840624 2616293313 414
329 iso_pu_bacteria 2615840626 2616312775 414
330 iso_pu_bacteria 2615840698 2616554283 414
331 iso_pu_bacteria 2617270742 2617383623 414
332 iso_pu_bacteria 2643221599 2644003125 414
333 iso_pu_bacteria 2643221634 2644193556 414
334 iso_pu_bacteria 2643221643 2644238628 414
335 iso_pu_bacteria 2667528174 2671111376 414
336 iso_pu_bacteria 2671180139 2671694316 414
337 iso_pu_bacteria 2718217882 2719181856 414
338 iso_pu_bacteria 2718217997 2719666208 414
339 iso_pu_bacteria 2718218009 2719732520 414
340 iso_pu_bacteria 2718218199 2720492628 414
341 iso_pu_bacteria 2718218232 2720614061 414
342 iso_pu_bacteria 2718218233 2720620869 414
343 iso_pu_bacteria 2718218235 2720632194 414
344 iso_pu_bacteria 2718218269 2720775922 414
345 iso_pu_bacteria 2718218363 2721147947 414
346 iso_pu_bacteria 2718218365 2721159398 414
347 iso_pu_bacteria 2718218366 2721164783 414
348 iso_pu_bacteria 2721755514 2722840953 414
349 iso_pu_bacteria 2721755556 2723027522 414
350 iso_pu_bacteria 2721755684 2723561145 414
351 iso_pu_bacteria 2721755685 2723567741 414
352 iso_pu_bacteria 2721755810 2724045276 414
353 iso_pu_bacteria 2721755819 2724090529 414
354 iso_pu_bacteria 2721755822 2724105006 414
355 iso_pu_bacteria 2721755823 2724110864 414
356 iso_pu_bacteria 2724679232 2725952510 414
357 iso_pu_bacteria 2728369352 2730108458 414
358 iso_pu_bacteria 2728369365 2730165091 414
359 iso_pu_bacteria 2728369397 2730299030 414
360 iso_pu_bacteria 2738541293 2738800131 414
361 iso_pu_bacteria 2738541333 2739032890 414
362 iso_pu_bacteria 2765235942 2766065921 414
363 iso_pu_bacteria 2775507266 2778175468 414
364 iso_pu_bacteria 2791355259 2793314494 414
365 iso_pu_bacteria 2791355260 2793320323 414
366 iso_pu_bacteria 2791355261 2793330831 414
367 iso_pu_bacteria 2791355263 2793339260 414
368 iso_pu_bacteria 2791355264 2793348930 414
369 iso_pu_bacteria 2791355265 2793351784 414
370 iso_pu_bacteria 2791355266 2793362531 414
371 iso_pu_bacteria 2791355267 2793368823 414
372 iso_pu_bacteria 2802429605 2805928750 414
373 iso_pu_bacteria 2802429606 2805935032 414
374 iso_pu_bacteria 2802429633 2806043870 414
375 iso_pu_bacteria 2802429634 2806050199 414
376 iso_pu_bacteria 2802429635 2806057015 414
377 iso_pu_bacteria 2802429636 2806064396 414
378 iso_pu_bacteria 2802429637 2806071663 414
379 iso_pu_bacteria 2818991448 2819609202 414
380 iso_pu_bacteria 2818991453 2819644162 414
381 iso_pu_bacteria 2838016132 2838017602 414
382 iso_pu_bacteria 2838022645 2838027600 414
383 iso_pu_bacteria 2838029111 2838029750 414
384 iso_pu_bacteria 2838035591 2838038548 414
385 iso_pu_bacteria 2838042994 2838045013 414
386 iso_pu_bacteria 2838048938 2838054352 414
387 iso_pu_bacteria 2838061910 2838067685 414
388 iso_pu_bacteria 2838068647 2838070092 414
389 iso_pu_bacteria 2838661181 2838661540 414
390 iso_pu_bacteria 2838668709 2838670413 414
391 iso_pu_bacteria 2838680041 2838683412 414
392 iso_pu_bacteria 2838686498 2838687002 414
393 iso_pu_bacteria 2838694306 2838697645 414
394 iso_pu_bacteria 2838701080 2838702784 414
395 iso_pu_bacteria 2838707686 2838710761 414
396 iso_pu_bacteria 2838729681 2838730025 414
397 iso_pu_bacteria 2838742623 2838742960 414
398 iso_pu_bacteria 2841851746 2841852446 414
399 iso_pu_bacteria 2842077413 2842078934 414
400 iso_pu_bacteria 2842110456 2842113216 414
401 iso_pu_bacteria 2842118031 2842118556 414
402 iso_pu_bacteria 2842146304 2842147958 414
403 iso_pu_bacteria 2842156927 2842158095 414
404 iso_pu_bacteria 2842163707 2842168742 414
405 iso_pu_bacteria 2842180545 2842181714 414
406 iso_pu_bacteria 2842192696 2842197409 414
407 iso_pu_bacteria 2842198810 2842203610 414
408 iso_pu_bacteria 2842205361 2842205429 414
409 iso_pu_bacteria 2842217011 2842217987 414
410 iso_pu_bacteria 2842229732 2842230235 414
411 iso_pu_bacteria 2842237096 2842240468 414
412 iso_pu_bacteria 2842243621 2842244138 414
413 iso_pu_bacteria 2842250916 2842253024 414
414 iso_pu_bacteria 2842257432 2842257776 414
415 iso_pu_bacteria 2842264693 2842266316 414
416 iso_pu_bacteria 2842271015 2842271460 414
417 iso_pu_bacteria 2842278818 2842278886 414
418 iso_pu_bacteria 2842285085 2842285549 414
419 iso_pu_bacteria 2842291075 2842292596 414
420 iso_pu_bacteria 2842298080 2842301425 414
421 iso_pu_bacteria 2842304105 2842305089 414
422 iso_pu_bacteria 2842311132 2842316993 414
423 iso_pu_bacteria 2842317721 2842320761 414
424 iso_pu_bacteria 2842357229 2842357962 414
425 iso_pu_bacteria 2842370503 2842374043 414
426 iso_pu_bacteria 2842377471 2842378994 414
427 iso_pu_bacteria 2842384541 2842385067 414
428 iso_pu_bacteria 2842402390 2842402909 414
429 iso_pu_bacteria 2842409023 2842409719 414
430 iso_pu_bacteria 2842415677 2842416370 414
431 iso_pu_bacteria 2842422224 2842423706 414
432 iso_pu_bacteria 2842428310 2842430779 414
433 iso_pu_bacteria 2842434925 2842437234 414
434 iso_pu_bacteria 2842441272 2842443604 414
435 iso_pu_bacteria 2842447887 2842453891 414
436 iso_pu_bacteria 2842462802 2842464922 414
437 iso_pu_bacteria 2842469257 2842471852 414
438 iso_pu_bacteria 2842475841 2842476965 414
439 iso_pu_bacteria 2842482326 2842484505 414
440 iso_pu_bacteria 2842489311 2842492030 414
441 iso_pu_bacteria 2842495871 2842496774 414
442 iso_pu_bacteria 2842502639 2842503278 414
443 iso_pu_bacteria 2842509118 2842511075 414
444 iso_pu_bacteria 2844454524 2844458369 414
445 iso_pu_bacteria 2852387548 2852390280 414
446 iso_pu_bacteria 2857516855 2857517380 414
447 iso_pu_bacteria 2919408235 2919410035 414
448 iso_pu_bacteria 2919450847 2919451390 414
449 iso_pu_bacteria 2923556063 2923562456 414
450 iso_pu_bacteria 2933016740 2933020005 414
451 iso_pu_bacteria 2933570622 2933570897 414
452 iso_pu_bacteria 2933586486 2933588728 414
453 iso_pu_bacteria 2933599457 2933600898 414
454 iso_pu_bacteria 2935894831 2935896969 414
455 iso_pu_bacteria 2935901341 2935901906 414
456 iso_pu_bacteria 2936367885 2936371985 414
457 iso_pu_bacteria 2936375103 2936379847 414
458 iso_pu_bacteria 2936381700 2936382748 414
459 iso_pu_bacteria 2996887358 2996888987 414
460 iso_pu_bacteria 2996893221 2996894277 414
461 iso_pu_bacteria 3005409236 3005414541 414
462 iso_pu_bacteria 3005416602 3005417432 414
463 iso_pu_bacteria 3005452660 3005454669 414
464 iso_pu_bacteria 639633055 639649236 414
465 iso_pu_bacteria 8001845381 8001847919 414
466 iso_pu_bacteria 8005258706 8005260356 414
467 iso_pu_bacteria 8005282627 8005286083 414
468 iso_pu_bacteria 8005289223 8005293084 414
469 iso_pu_bacteria 8005289223 8005295563 414
470 iso_pu_bacteria 8005301065 8005303175 414
471 iso_pu_bacteria 8005307578 8005312883 414
472 iso_pu_bacteria 8005314921 8005315779 414
473 iso_pu_bacteria 8005321885 8005323514 414
474 iso_pu_bacteria 8005376324 8005380977 414
475 iso_pu_bacteria 8005382845 8005389071 414
476 iso_pu_bacteria 8005395548 8005396053 414
477 iso_pu_bacteria 8005430974 8005435205 414
478 iso_pu_bacteria 8005460587 8005463735 414
479 iso_pu_bacteria 8005484373 8005489132 414
480 iso_pu_bacteria 8005497431 8005500946 414
481 iso_pu_bacteria 8005542996 8005545671 414
482 iso_pu_bacteria 8005556819 8005556969 414
483 iso_pu_bacteria 8005563573 8005568039 414
484 iso_pu_bacteria 8005570704 8005573416 414
485 iso_pu_bacteria 8005619151 8005622319 414
486 iso_pu_bacteria 8005626139 8005629820 414
487 iso_pu_bacteria 8005645114 8005648195 414
488 iso_pu_bacteria 8005668836 8005672364 414
489 iso_pu_bacteria 8005682033 8005682834 414
490 iso_pu_bacteria 8005688590 8005692057 414
491 iso_pu_bacteria 8018127388 8018134142 414
492 iso_pu_bacteria 8018163183 8018164580 414
493 iso_pu_bacteria 8023680758 8023683119 414
494 iso_pu_bacteria 8024479707 8024482815 414
495 iso_pu_bacteria 8024501048 8024504471 414
496 iso_pu_bacteria 8046767195 8046771141 414
497 iso_pu_bacteria 8056375014 8056375981 414
498 iso_pu_bacteria 8056382006 8056386771 414
499 iso_pu_bacteria 8057575449 8057575685 414
500 iso_pu_bacteria 8057874678 8057877625 414
501 3300003322 rootL2_10032282 rootL2_100322821 415
502 3300003794 Ga0055531_10000880 Ga0055531_1000088016 415
503 3300006051 Ga0075364_10000023 Ga0075364_1000002314 415
504 3300025304 Ga0209257_1000319 Ga0209257_100031981 415
505 3300025909 Ga0207705_10223324 Ga0207705_102233241 415
506 3300025949 Ga0207667_10047819 Ga0207667_100478191 415
507 3300048924 Ga0496121_0009275 Ga0496121_0009275_8058_9308 415
508 3300050491 nmdc:mga00v17_45_c1 nmdc:mga00v17_45_c1_37977_39227 415
509 iso_pu_bacteria 2738541317 2738947271 415
510 iso_pu_bacteria 2818991461 2819684956 415
511 iso_pu_bacteria 2913308742 2913312632 415
512 3300003781 Ga0055536_1005851 Ga0055536_10058513 416
513 3300005262 Ga0065165_1007860 Ga0065165_10078602 416
514 3300005327 Ga0070658_10298323 Ga0070658_102983231 416
515 3300005331 Ga0070670_100000566 Ga0070670_10000056630 416
516 3300005539 Ga0068853_100004315 Ga0068853_1000043156 416
517 3300005563 Ga0068855_100130931 Ga0068855_1001309312 416
518 3300009148 Ga0105243_10015957 Ga0105243_100159573 416
519 3300009545 Ga0105237_10000658 Ga0105237_1000065820 416
520 3300010375 Ga0105239_10001871 Ga0105239_100018713 416
521 3300011119 Ga0105246_10109340 Ga0105246_101093402 416
522 3300014326 Ga0157380_10080306 Ga0157380_100803061 416
523 3300025231 Ga0207427_102445 Ga0207427_1024452 416
524 3300025292 Ga0209676_1004375 Ga0209676_10043752 416
525 3300025297 Ga0209758_1000688 Ga0209758_100068811 416
526 3300025298 Ga0209050_1013193 Ga0209050_10131933 416
527 3300025303 Ga0209051_1001404 Ga0209051_10014042 416
528 3300025304 Ga0209257_1004804 Ga0209257_10048042 416
529 3300025914 Ga0207671_10000757 Ga0207671_1000075718 416
530 3300025925 Ga0207650_10027448 Ga0207650_100274483 416
531 3300025935 Ga0207709_10041873 Ga0207709_100418732 416
532 3300026041 Ga0207639_10002070 Ga0207639_100020706 416
533 3300028379 Ga0268266_10000578 Ga0268266_1000057836 416
534 3300028379 Ga0268266_10243367 Ga0268266_102433672 416
535 3300031852 Ga0307410_10080403 Ga0307410_100804032 416
536 3300032004 Ga0307414_10044835 Ga0307414_100448351 416
537 3300038443 Ga0395901_0188608 Ga0395901_0188608_503_1756 416
538 3300044735 Ga0466968_0049289 Ga0466968_0049289_525_1781 416
539 3300046454 Ga0495592_0105190 Ga0495592_0105190_82_1338 416
540 3300046459 Ga0495629_0064461 Ga0495629_0064461_437_1687 416
541 3300046476 Ga0495662_0023776 Ga0495662_0023776_1353_2609 416
542 3300046477 Ga0495664_0052603 Ga0495664_0052603_1089_2345 416
543 3300046530 Ga0495654_0003850 Ga0495654_0003850_2051_3307 416
544 3300047317 Ga0495604_0020027 Ga0495604_0020027_3398_4654 416
545 3300047472 Ga0495686_0149779 Ga0495686_0149779_78_1334 416
546 3300048914 Ga0496111_0025611 Ga0496111_0025611_1646_2902 416
547 3300048925 Ga0496122_0029488 Ga0496122_0029488_1852_3108 416
548 3300048927 Ga0496124_0038741 Ga0496124_0038741_1633_2895 416
549 3300049569 Ga0501032_0067487 Ga0501032_0067487_559_1812 416
550 3300049571 Ga0501034_0000222 Ga0501034_0000222_105623_106894 416
551 3300049571 Ga0501034_0055133 Ga0501034_0055133_2391_3644 416
552 3300049580 Ga0501046_0011945 Ga0501046_0011945_3693_4946 416
553 3300049581 Ga0501047_0050784 Ga0501047_0050784_2311_3564 416
554 3300049586 Ga0501070_0023967 Ga0501070_0023967_1902_3155 416
555 3300049586 Ga0501070_0095680 Ga0501070_0095680_908_2161 416
556 3300049682 Ga0501252_000845 Ga0501252_000845_849_2147 416
557 3300049776 Ga0501280_001427 Ga0501280_001427_1350_2666 416
558 3300049822 Ga0501035_0025886 Ga0501035_0025886_722_1975 416
559 3300050492 nmdc:mga0yw44_546_c1 nmdc:mga0yw44_546_c1_541_1797 416
560 3300053125 Ga0500618_000233 Ga0500618_000233_36931_38187 416
561 3300053151 Ga0500604_0000494 Ga0500604_0000494_8347_9618 416
562 3300053153 Ga0500616_0000102 Ga0500616_0000102_139961_141217 416
563 3300053161 Ga0500634_0000030 Ga0500634_0000030_54447_55718 416
564 3300001979 JGI24740J21852_10000010 JGI24740J21852_1000001024 418
565 3300002704 JGI25155J39150_1000044 JGI25155J39150_100004415 418
566 3300002705 JGI25156J39149_1000058 JGI25156J39149_100005878 418
567 3300002737 JGI25162J39368_1000143 JGI25162J39368_100014368 418
568 3300002737 JGI25162J39368_1000510 JGI25162J39368_100051016 418
569 3300002738 JGI25154J39366_1000174 JGI25154J39366_100017415 418
570 3300002741 JGI25157J39369_1000078 JGI25157J39369_100007877 418
571 3300002773 JGI25152J39213_1001226 JGI25152J39213_10012262 418
572 3300002773 JGI25152J39213_1001617 JGI25152J39213_10016177 418
573 3300002773 JGI25152J39213_1007947 JGI25152J39213_10079472 418
574 3300002774 JGI25150J39212_1000074 JGI25150J39212_100007410 418
575 3300002987 JGI25159J45721_1000077 JGI25159J45721_100007710 418
576 3300003187 JGI25151J46595_10000414 JGI25151J46595_1000041410 418
577 3300003187 JGI25151J46595_10000492 JGI25151J46595_1000049219 418
578 3300003187 JGI25151J46595_10003675 JGI25151J46595_100036752 418
579 3300003214 JGI25165J46597_1000282 JGI25165J46597_100028271 418
580 3300003214 JGI25165J46597_1000356 JGI25165J46597_100035647 418
581 3300003215 JGI25153J46596_10004715 JGI25153J46596_100047152 418
582 3300003215 JGI25153J46596_10008900 JGI25153J46596_100089006 418
583 3300003322 rootL2_10005277 rootL2_1000527720 418
584 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001595 418
585 3300003354 JGI25160J50197_1000381 JGI25160J50197_10003816 418
586 3300003354 JGI25160J50197_1010718 JGI25160J50197_10107182 418
587 3300003374 JGI25161J50226_1000001 JGI25161J50226_1000001160 418
588 3300003374 JGI25161J50226_1004937 JGI25161J50226_10049372 418
589 3300003771 Ga0055526_1003424 Ga0055526_10034242 418
590 3300003771 Ga0055526_1003987 Ga0055526_10039879 418
591 3300003771 Ga0055526_1007821 Ga0055526_10078216 418
592 3300003771 Ga0055526_1013623 Ga0055526_10136232 418
593 3300003775 Ga0055524_1002257 Ga0055524_10022579 418
594 3300003775 Ga0055524_1006795 Ga0055524_10067955 418
595 3300003790 Ga0055528_1002824 Ga0055528_10028249 418
596 3300003790 Ga0055528_1003222 Ga0055528_10032224 418
597 3300003790 Ga0055528_1003301 Ga0055528_10033012 418
598 3300003792 Ga0055540_1000293 Ga0055540_10002932 418
599 3300004625 Ga0055543_1000003 Ga0055543_1000003176 418
600 3300005262 Ga0065165_1000469 Ga0065165_100046910 418
601 3300005262 Ga0065165_1012170 Ga0065165_10121702 418
602 3300005355 Ga0070671_100044019 Ga0070671_1000440191 418
603 3300005548 Ga0070665_100067542 Ga0070665_1000675422 418
604 3300005578 Ga0068854_100028798 Ga0068854_1000287982 418
605 3300005616 Ga0068852_100075608 Ga0068852_1000756082 418
606 3300006038 Ga0075365_10000682 Ga0075365_100006829 418
607 3300006038 Ga0075365_10007870 Ga0075365_100078707 418
608 3300006177 Ga0075362_10005136 Ga0075362_100051362 418
609 3300006186 Ga0075369_10006118 Ga0075369_100061183 418
610 3300006195 Ga0075366_10074272 Ga0075366_100742722 418
611 3300006353 Ga0075370_10006226 Ga0075370_100062262 418
612 3300006353 Ga0075370_10014728 Ga0075370_100147282 418
613 3300009011 Ga0105251_10021203 Ga0105251_100212034 418
614 3300009093 Ga0105240_10001458 Ga0105240_1000145822 418
615 3300009177 Ga0105248_10074822 Ga0105248_100748221 418
616 3300009545 Ga0105237_10002043 Ga0105237_1000204310 418
617 3300009765 Ga0123341_1000007 Ga0123341_100000731 418
618 3300009765 Ga0123341_1051853 Ga0123341_10518531 418
619 3300010375 Ga0105239_10000972 Ga0105239_1000097217 418
620 3300013104 Ga0157370_10000960 Ga0157370_1000096019 418
621 3300015262 Ga0182007_10001170 Ga0182007_1000117010 418
622 3300025206 Ga0209435_100054 Ga0209435_10005416 418
623 3300025233 Ga0209437_100051 Ga0209437_100051271 418
624 3300025233 Ga0209437_100098 Ga0209437_100098114 418
625 3300025245 Ga0207425_1000075 Ga0207425_100007511 418
626 3300025245 Ga0207425_1009285 Ga0207425_10092852 418
627 3300025246 Ga0209646_1000170 Ga0209646_100017016 418
628 3300025246 Ga0209646_1002615 Ga0209646_10026153 418
629 3300025250 Ga0209026_1000193 Ga0209026_100019316 418
630 3300025253 Ga0209677_100166 Ga0209677_1001662 418
631 3300025254 Ga0209148_1004642 Ga0209148_10046423 418
632 3300025256 Ga0209759_1000222 Ga0209759_100022216 418
633 3300025256 Ga0209759_1012489 Ga0209759_10124891 418
634 3300025258 Ga0209129_1000156 Ga0209129_100015687 418
635 3300025258 Ga0209129_1006025 Ga0209129_10060252 418
636 3300025258 Ga0209129_1009095 Ga0209129_10090952 418
637 3300025261 Ga0209233_1000095 Ga0209233_1000095231 418
638 3300025261 Ga0209233_1000113 Ga0209233_100011372 418
639 3300025261 Ga0209233_1000148 Ga0209233_1000148141 418
640 3300025273 Ga0209673_1000010 Ga0209673_1000010267 418
641 3300025273 Ga0209673_1000117 Ga0209673_100011726 418
642 3300025273 Ga0209673_1000151 Ga0209673_1000151121 418
643 3300025273 Ga0209673_1002135 Ga0209673_100213516 418
644 3300025273 Ga0209673_1002627 Ga0209673_10026276 418
645 3300025284 Ga0209130_1000003 Ga0209130_1000003182 418
646 3300025294 Ga0209025_1000070 Ga0209025_1000070190 418
647 3300025294 Ga0209025_1000571 Ga0209025_100057148 418
648 3300025294 Ga0209025_1000675 Ga0209025_100067585 418
649 3300025294 Ga0209025_1023349 Ga0209025_10233492 418
650 3300025295 Ga0209564_1000386 Ga0209564_100038626 418
651 3300025295 Ga0209564_1000424 Ga0209564_100042422 418
652 3300025295 Ga0209564_1008694 Ga0209564_10086942 418
653 3300025297 Ga0209758_1000094 Ga0209758_100009445 418
654 3300025297 Ga0209758_1000405 Ga0209758_100040555 418
655 3300025298 Ga0209050_1006026 Ga0209050_10060267 418
656 3300025299 Ga0209256_1000717 Ga0209256_100071715 418
657 3300025299 Ga0209256_1000729 Ga0209256_100072932 418
658 3300025299 Ga0209256_1001535 Ga0209256_100153538 418
659 3300025299 Ga0209256_1002359 Ga0209256_100235916 418
660 3300025299 Ga0209256_1025604 Ga0209256_10256041 418
661 3300025302 Ga0207426_1000011 Ga0207426_1000011594 418
662 3300025302 Ga0207426_1000394 Ga0207426_100039450 418
663 3300025302 Ga0207426_1000449 Ga0207426_100044948 418
664 3300025303 Ga0209051_1000097 Ga0209051_1000097112 418
665 3300025303 Ga0209051_1005145 Ga0209051_10051451 418
666 3300025303 Ga0209051_1016685 Ga0209051_10166853 418
667 3300025304 Ga0209257_1029914 Ga0209257_10299142 418
668 3300025913 Ga0207695_10001420 Ga0207695_1000142017 418
669 3300025914 Ga0207671_10000934 Ga0207671_1000093426 418
670 3300025931 Ga0207644_10101728 Ga0207644_101017282 418
671 3300025972 Ga0207668_10234654 Ga0207668_102346542 418
672 3300025981 Ga0207640_10055945 Ga0207640_100559452 418
673 3300025986 Ga0207658_10134406 Ga0207658_101344062 418
674 3300026142 Ga0207698_10135474 Ga0207698_101354742 418
675 3300028379 Ga0268266_10164495 Ga0268266_101644952 418
676 3300028794 Ga0307515_10068957 Ga0307515_100689572 418
677 3300031456 Ga0307513_10274508 Ga0307513_102745081 418
678 3300031731 Ga0307405_10034674 Ga0307405_100346742 418
679 3300031911 Ga0307412_10001389 Ga0307412_100013894 418
680 3300041413 Ga0439465_0010599 Ga0439465_0010599_1071_2330 418
681 3300041441 Ga0451787_174959 Ga0451787_174959_128_1387 418
682 3300041451 Ga0451791_0940235 Ga0451791_0940235_249_1508 418
683 3300041458 Ga0451798_0157085 Ga0451798_0157085_2079_3338 418
684 3300041916 Ga0452271_16094 Ga0452271_16094_73_1332 418
685 3300044694 Ga0466963_0079241 Ga0466963_0079241_271_1539 418
686 3300044765 Ga0466970_0000524 Ga0466970_0000524_6901_8169 418
687 3300045049 Ga0466959_0184281 Ga0466959_0184281_63_1331 418
688 3300045836 Ga0466958_0007809 Ga0466958_0007809_3925_5193 418
689 3300046460 Ga0495638_0009521 Ga0495638_0009521_1142_2398 418
690 3300046460 Ga0495638_0085393 Ga0495638_0085393_115_1374 418
691 3300046471 Ga0495650_0026130 Ga0495650_0026130_1401_2660 418
692 3300046506 Ga0495583_0012484 Ga0495583_0012484_2714_3970 418
693 3300046507 Ga0495606_0013657 Ga0495606_0013657_3716_4978 418
694 3300046507 Ga0495606_0014724 Ga0495606_0014724_2220_3479 418
695 3300046507 Ga0495606_0039914 Ga0495606_0039914_107_1390 418
696 3300046507 Ga0495606_0052813 Ga0495606_0052813_758_2017 418
697 3300046512 Ga0495610_0007444 Ga0495610_0007444_875_2134 418
698 3300046512 Ga0495610_0009592 Ga0495610_0009592_1341_2600 418
699 3300046519 Ga0495632_0047750 Ga0495632_0047750_500_1759 418
700 3300046522 Ga0495643_0022665 Ga0495643_0022665_873_2132 418
701 3300046542 Ga0495597_0008991 Ga0495597_0008991_599_1858 418
702 3300046558 Ga0495633_0014942 Ga0495633_0014942_1981_3240 418
703 3300046660 Ga0495625_0012841 Ga0495625_0012841_4534_5790 418
704 3300046660 Ga0495625_0034115 Ga0495625_0034115_1411_2670 418
705 3300046665 Ga0495661_0032140 Ga0495661_0032140_750_2009 418
706 3300046810 Ga0495660_0018465 Ga0495660_0018465_1621_2880 418
707 3300047472 Ga0495686_0000565 Ga0495686_0000565_18702_19964 418
708 3300047472 Ga0495686_0013713 Ga0495686_0013713_936_2195 418
709 3300048903 Ga0496100_0001864 Ga0496100_0001864_1494_2750 418
710 3300048904 Ga0496101_0174580 Ga0496101_0174580_214_1473 418
711 3300048905 Ga0496102_0001618 Ga0496102_0001618_17084_18340 418
712 3300048905 Ga0496102_0240620 Ga0496102_0240620_436_1695 418
713 3300048906 Ga0496103_0002410 Ga0496103_0002410_8864_10120 418
714 3300048906 Ga0496103_0031517 Ga0496103_0031517_1838_3097 418
715 3300048907 Ga0496104_0119323 Ga0496104_0119323_666_1925 418
716 3300048908 Ga0496105_0023367 Ga0496105_0023367_3355_4614 418
717 3300048909 Ga0496106_0214203 Ga0496106_0214203_83_1342 418
718 3300048913 Ga0496110_0013800 Ga0496110_0013800_160_1419 418
719 3300048914 Ga0496111_0030288 Ga0496111_0030288_234_1493 418
720 3300048917 Ga0496114_0074563 Ga0496114_0074563_1355_2614 418
721 3300048917 Ga0496114_0106751 Ga0496114_0106751_541_1800 418
722 3300048919 Ga0496116_0005080 Ga0496116_0005080_5616_6872 418
723 3300048919 Ga0496116_0006547 Ga0496116_0006547_2203_3462 418
724 3300048919 Ga0496116_0012183 Ga0496116_0012183_4783_6042 418
725 3300048919 Ga0496116_0020114 Ga0496116_0020114_2720_3979 418
726 3300048919 Ga0496116_0057113 Ga0496116_0057113_179_1438 418
727 3300048920 Ga0496117_0002281 Ga0496117_0002281_16489_17745 418
728 3300048920 Ga0496117_0025738 Ga0496117_0025738_2710_3969 418
729 3300048920 Ga0496117_0045011 Ga0496117_0045011_1081_2340 418
730 3300048921 Ga0496118_0002480 Ga0496118_0002480_16489_17745 418
731 3300048921 Ga0496118_0016824 Ga0496118_0016824_1311_2570 418
732 3300048921 Ga0496118_0030218 Ga0496118_0030218_2949_4208 418
733 3300048922 Ga0496119_0005992 Ga0496119_0005992_4481_5737 418
734 3300048922 Ga0496119_0020173 Ga0496119_0020173_1197_2453 418
735 3300048923 Ga0496120_0004100 Ga0496120_0004100_8683_9939 418
736 3300048923 Ga0496120_0018905 Ga0496120_0018905_16_1299 418
737 3300048923 Ga0496120_0102394 Ga0496120_0102394_214_1473 418
738 3300048924 Ga0496121_0002956 Ga0496121_0002956_16489_17745 418
739 3300048924 Ga0496121_0009810 Ga0496121_0009810_21_1277 418
740 3300048925 Ga0496122_0007100 Ga0496122_0007100_8675_9931 418
741 3300048925 Ga0496122_0016006 Ga0496122_0016006_287_1546 418
742 3300048925 Ga0496122_0020411 Ga0496122_0020411_4467_5723 418
743 3300048925 Ga0496122_0112068 Ga0496122_0112068_156_1415 418
744 3300048926 Ga0496123_0002543 Ga0496123_0002543_18385_19641 418
745 3300048926 Ga0496123_0018763 Ga0496123_0018763_736_1995 418
746 3300048926 Ga0496123_0074759 Ga0496123_0074759_414_1673 418
747 3300048927 Ga0496124_0010588 Ga0496124_0010588_4944_6203 418
748 3300048927 Ga0496124_0019805 Ga0496124_0019805_405_1661 418
749 3300048927 Ga0496124_0020478 Ga0496124_0020478_4666_5925 418
750 3300048927 Ga0496124_0085557 Ga0496124_0085557_1055_2311 418
751 3300048928 Ga0496125_0003436 Ga0496125_0003436_16442_17698 418
752 3300048928 Ga0496125_0017278 Ga0496125_0017278_590_1849 418
753 3300048928 Ga0496125_0133394 Ga0496125_0133394_146_1402 418
754 3300048929 Ga0496126_0130443 Ga0496126_0130443_745_2004 418
755 3300049572 Ga0501036_0083391 Ga0501036_0083391_823_2082 418
756 3300049574 Ga0501038_0105609 Ga0501038_0105609_260_1519 418
757 3300049575 Ga0501039_0052769 Ga0501039_0052769_933_2192 418
758 3300049823 Ga0501044_0080837 Ga0501044_0080837_1061_2320 418
759 3300050489 nmdc:mga03683_66373_c1 nmdc:mga03683_66373_c1_116_1375 418
760 3300050492 nmdc:mga0yw44_25378_c1 nmdc:mga0yw44_25378_c1_246_1505 418
761 3300050496 nmdc:mga07m45_22225_c1 nmdc:mga07m45_22225_c1_369_1628 418
762 3300050516 nmdc:mga0sz30_8436_c1 nmdc:mga0sz30_8436_c1_234_1493 418
763 3300053105 Ga0500557_008160 Ga0500557_008160_950_2206 418
764 3300053109 Ga0500569_002736 Ga0500569_002736_2088_3347 418
765 3300053125 Ga0500618_003741 Ga0500618_003741_923_2191 418
766 3300053125 Ga0500618_014564 Ga0500618_014564_650_1918 418
767 3300053125 Ga0500618_016019 Ga0500618_016019_393_1649 418
768 3300053134 Ga0500658_0003760 Ga0500658_0003760_743_2002 418
769 3300053140 Ga0500573_0031271 Ga0500573_0031271_286_1545 418
770 3300053153 Ga0500616_0004971 Ga0500616_0004971_7830_9086 418
771 3300053153 Ga0500616_0013143 Ga0500616_0013143_882_2141 418
772 3300053156 Ga0500622_0015802 Ga0500622_0015802_149_1408 418

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07221

GlcNAc_2-epim

N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase)

75

429

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ag4-assembly1.cif.gz_F crystal structure of active site mutant of sq isomerase (yihs-h248a) from salmonella enterica in complex with sulfofructose (sf) 0.9511 11 414
2zbl-assembly1.cif.gz_C functional annotation of salmonella enterica yihs-encoded protein 0.9499 18 415
7ag4-assembly1.cif.gz_E-2 crystal structure of active site mutant of sq isomerase (yihs-h248a) from salmonella enterica in complex with sulfofructose (sf) 0.949 13 414
3gt5-assembly1.cif.gz_A crystal structure of an n-acetylglucosamine 2-epimerase family protein from xylella fastidiosa 0.9447 21 400
2zbl-assembly1.cif.gz_B functional annotation of salmonella enterica yihs-encoded protein 0.9443 13 417
ID Description Score Start End Superfamily
2afaE00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.9367 13 414 1.50.10.10
5x32B00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.9333 16 400 1.50.10.10
5x32B00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.9171 16 400 1.50.10.10
2afaE00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.9161 13 414 1.50.10.10
3wkiA00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.8709 16 400 1.50.10.10
ID Description Score Start End GO Terms
AF-A0A2M9PAY0-F1-model_v4 Mannose-6-phosphate isomerase 0.9988 58 414 GO:0005975
GO:0016853
AF-A0A839XIY0-F1-model_v4 deleted 0.9946 131 418
AF-A0A2L1D1B1-F1-model_v4 deleted 0.9945 1 418
AF-A0A2W2AKZ6-F1-model_v4 AGE family epimerase/isomerase 0.9941 11 411 GO:0005975
GO:0016853
AF-A0A4Q3YJW3-F1-model_v4 AGE family epimerase/isomerase 0.9936 229 418 GO:0005975
GO:0016853

Feature Viewer

pLDDT pTM Quality
95.13 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map