F480105

General Info

Members Datasets Scaffolds Average Seq Length
772 552 432 654

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100010780|Ga0070660_1000107801
Length 683
Sequence MRLGVCYYPEHWPEAMWKDDAARMKALGIKQVRIAKFAWSRIEPSPGEFDWGWLDRAVETLAAEGLDVVMCTPTATPPKWLIDRHPDILPVGADGKVRTFGSRRHYDFSSPTYFEASKVICEAVASRYGRHPAVAYWQTDNAYGCHQTVVSYSPAALTRFRAWLQARYGSIDALNRAWGTVFWSMEYRSFDEIDTPIGTVTEAHPSHRLDYRRFASDELQRYNRMQVDIIRRHSPGRPIAHNFMQLFTEFDHYKVADDLDVASWDSYPLGALEEQWYEASVKGRYLRTGHPDFASFNHDLYRGMSKLPFWVMEQQPGPVNWAKWNPAPLPGMVRLWSWEAFAHGAGCVSYFRWRQAPFAQEQMHAGLNTPDNRLDIGGGEAERVADEIRTLAQADVDADGKVQTRVALVFDYEAKWLFEVQPQGADFHYPRFAVEYYSALRALGFDVDIVSTHAPLDGYQLIVVPPLPVVSDDLVKRLEASRAHIVLGPRTGSKTADLQIPSNLPPGPLASLMPVRVWRVESMRPTVTSRVTFSGSVPQGYARHWRDLLEVDMSRDGHESVQIRAAFADGHPAYVKHGAVHYLASLFDDTSTQSLFARIAHEAGLAPTHLGDAVRISRRGALTWVFNYGPETHHVPADVPNDAFVIGAHAIEPQGVAAYRTQETPCIQLAIESKNLNAAPTTT

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
3 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
4 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
5 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
8 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
9 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
10 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
11 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
12 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
13 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
14 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
15 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
16 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
17 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
18 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
19 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
20 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
21 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
22 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
23 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
24 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
25 2519103095 Burkholderia sp. KJ006 Isolate Nodule
26 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
27 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
28 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
29 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
30 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
31 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
32 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
33 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
34 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
35 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
36 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
37 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
38 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
39 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
40 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
41 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
42 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
43 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
44 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
45 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
46 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
47 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
48 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
49 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
50 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
51 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
52 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
53 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
54 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
55 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
56 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
57 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
58 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
59 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
60 2643221557 Ensifer sp. Root558 Isolate Unclassified
61 2643221558 Rhizobium sp. Root149 Isolate Unclassified
62 2643221580 Devosia sp. Root635 Isolate Unclassified
63 2643221591 Devosia sp. Root685 Isolate Unclassified
64 2643221607 Rhizobium sp. Root73 Isolate Unclassified
65 2643221610 Ensifer sp. Root74 Isolate Unclassified
66 2643221618 Ensifer sp. Root231 Isolate Unclassified
67 2643221626 Ensifer sp. Root31 Isolate Unclassified
68 2643221629 Devosia sp. Root105 Isolate Unclassified
69 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
70 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
71 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
72 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
73 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
74 2643221655 Ensifer sp. Root1252 Isolate Unclassified
75 2643221659 Ensifer sp. Root127 Isolate Unclassified
76 2643221662 Devosia sp. Root413D1 Isolate Unclassified
77 2643221668 Ensifer sp. Root423 Isolate Unclassified
78 2643221674 Devosia sp. Root436 Isolate Unclassified
79 2643221675 Ensifer sp. Root1298 Isolate Unclassified
80 2643221680 Ensifer sp. Root1312 Isolate Unclassified
81 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
82 2643221698 Ensifer sp. Root142 Isolate Unclassified
83 2643221712 Ensifer sp. Root258 Isolate Unclassified
84 2643221718 Rhizobium sp. Root268 Isolate Unclassified
85 2643221719 Rhizobium sp. Root274 Isolate Unclassified
86 2643221723 Ensifer sp. Root278 Isolate Unclassified
87 2643221726 Ensifer sp. Root954 Isolate Unclassified
88 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
89 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
90 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
91 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
92 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
93 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
94 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
95 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
96 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
97 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
98 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
99 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
100 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
101 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
102 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
103 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
104 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
105 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
106 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
107 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
108 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
109 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
110 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
111 2818991450 Burkholderia sp. 604 Isolate Unclassified
112 2818991452 Burkholderia cepacia 561 Isolate Unclassified
113 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
114 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
115 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
116 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
117 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
118 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
119 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
120 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
121 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
122 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
123 2844163670 Ensifer sp. 1H6 Isolate Unclassified
124 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
125 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
126 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
127 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
128 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
129 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
130 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
131 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
132 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
133 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
134 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
135 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
136 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
137 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
138 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
139 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
140 2904564687 Burkholderia sp. 571 Isolate Unclassified
141 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
142 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
143 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
144 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
145 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
146 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
147 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
148 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
149 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
150 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
151 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
152 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
153 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
154 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
155 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
156 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
157 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
158 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
159 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
160 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
161 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
162 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
163 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
164 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
165 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
166 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
167 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
168 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
169 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
170 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
171 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
172 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
173 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
174 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
175 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
176 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
177 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
178 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
179 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
180 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
181 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
182 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
183 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
184 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
185 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
186 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
187 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
188 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
189 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
190 2928163908 Burkholderia sp. 567 Isolate Unclassified
191 2928170801 Burkholderia sp. 572 Isolate Unclassified
192 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
193 2928536128 Burkholderia sola 565 Isolate Unclassified
194 2932401849 Devosia sp. 2618 Isolate Rhizosphere
195 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
196 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
197 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
198 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
199 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
200 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
201 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
202 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
203 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
204 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
205 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
206 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
207 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
208 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
209 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
210 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
211 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
212 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
213 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
214 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
215 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
216 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
217 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
218 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
219 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
220 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
221 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
222 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
223 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
224 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
225 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
226 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
227 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
228 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
229 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
230 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
231 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
232 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
233 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
234 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
235 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
236 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
237 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
238 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
239 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
240 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
241 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
242 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
243 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
244 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
245 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
246 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
247 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
248 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
249 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
250 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
251 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
252 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
253 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
254 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
255 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
256 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
257 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
258 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
259 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
260 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
261 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
262 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
263 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
264 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
265 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
266 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
267 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
268 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
269 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
270 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
271 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
272 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
273 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
274 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
275 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
276 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
277 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
278 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
279 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
280 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
281 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
282 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
283 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
284 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
285 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
286 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
287 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
288 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
289 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
290 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
291 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
292 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
293 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
294 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
295 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
296 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
297 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
298 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
299 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
300 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
301 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
302 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
303 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
304 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
305 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
306 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
307 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
308 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
309 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
310 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
311 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
312 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
313 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
314 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
315 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
316 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
317 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
318 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
319 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
320 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
321 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
322 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
323 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
324 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
325 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
326 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
327 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
328 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
329 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
330 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
331 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
332 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
333 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
334 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
335 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
336 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
337 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
338 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
339 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
340 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
341 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
342 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
343 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
344 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
345 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
346 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
347 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
348 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
349 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
350 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
351 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
352 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
353 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
354 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
355 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
356 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
357 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
358 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
359 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
360 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
361 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
362 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
363 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
364 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
365 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
366 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
367 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
368 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
369 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
370 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
371 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
372 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
373 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
374 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
375 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
376 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
377 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
378 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
379 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
380 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
381 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
382 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
383 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
384 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
385 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
386 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
387 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
388 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
389 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
390 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
391 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
392 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
393 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
394 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
404 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
407 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
408 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
409 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
410 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
412 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
413 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
414 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
415 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
416 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
417 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
418 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
419 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
420 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
421 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
422 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
423 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
424 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
425 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
426 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
427 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
428 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
429 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
430 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
431 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
432 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
433 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
434 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
435 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
436 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
437 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
438 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
439 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
440 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
441 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
442 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
443 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
444 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
445 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
446 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
447 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
448 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
449 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
450 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
451 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
452 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
453 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
454 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
455 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
456 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
457 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
458 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
459 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
460 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
461 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
462 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
463 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
464 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
465 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
466 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
467 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
468 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
469 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
470 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
471 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
472 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
473 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
474 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
475 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
476 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
477 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
478 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
479 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
480 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
481 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
482 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
483 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
484 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
485 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
486 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
487 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
488 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
489 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
490 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
491 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
492 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
493 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
494 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
495 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
496 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
497 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
498 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
499 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
500 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
501 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
502 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
503 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
504 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
505 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
506 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
507 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
508 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
509 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
510 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
511 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
512 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
513 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
514 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
515 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
516 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
517 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
518 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
519 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
520 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
521 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
522 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
523 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
524 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
525 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
526 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
527 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
528 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
529 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
530 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
531 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
532 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
533 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
534 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
535 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
536 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
537 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
538 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
539 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
540 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
541 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
542 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
543 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
544 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
545 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
546 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
547 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
548 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
549 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
550 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
551 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
552 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 56.61
Metatranscriptomes 0
Isolates 43.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.56
Nodule 25.39
Rhizoplane 1.68
Rhizosphere 42.88
Stem 0
Stem Tuber 0
Unclassified 17.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000879 3300001979 Bacteria 13281
2 JGI24738J21930_10001967 3300002075 Bacteria 5534
3 JGI25156J39149_1000664 3300002705 Bacteria 18751
4 JGI25156J39149_1000803 3300002705 Bacteria 16066
5 JGI25162J39368_1001301 3300002737 Bacteria 14097
6 JGI25158J39367_1003178 3300002739 Bacteria 2573
7 JGI25159J45721_1000083 3300002987 Bacteria 44911
8 JGI25151J46595_10000370 3300003187 Bacteria 47135
9 JGI25165J46597_1000565 3300003214 Bacteria 33508
10 JGI25165J46597_1001095 3300003214 Bacteria 17289
11 rootH1_10106775 3300003316 Bacteria 2994
12 rootL2_10089094 3300003322 Bacteria 4666
13 rootL2_10115399 3300003322 Bacteria 4906
14 rootH1_10083082 3300003323 Bacteria 8213
15 JGI25160J50197_1000005 3300003354 Bacteria 417280
16 JGI25160J50197_1000202 3300003354 Bacteria 49454
17 JGI25161J50226_1000349 3300003374 Bacteria 24501
18 Ga0055538_1000051 3300003751 Bacteria 129958
19 Ga0055539_1000076 3300003752 Bacteria 129958
20 Ga0055533_1000082 3300003756 Bacteria 129958
21 Ga0055533_1000226 3300003756 Bacteria 37966
22 Ga0055532_1000007 3300003758 Bacteria 429810
23 Ga0055532_1000429 3300003758 Bacteria 20037
24 Ga0055532_1000613 3300003758 Bacteria 14224
25 Ga0055532_1000695 3300003758 Bacteria 12652
26 Ga0055525_1000109 3300003759 Bacteria 129958
27 Ga0055527_1000007 3300003760 Bacteria 429810
28 Ga0055527_1000357 3300003760 Bacteria 21933
29 Ga0055527_1000641 3300003760 Bacteria 10681
30 Ga0055535_1000005 3300003761 Bacteria 429810
31 Ga0055535_1000650 3300003761 Bacteria 27681
32 Ga0055535_1000815 3300003761 Bacteria 22469
33 Ga0055542_1000008 3300003762 Bacteria 429810
34 Ga0055542_1000658 3300003762 Bacteria 28380
35 Ga0055542_1002582 3300003762 Bacteria 5744
36 Ga0055529_1000005 3300003763 Bacteria 429810
37 Ga0055529_1000595 3300003763 Bacteria 28380
38 Ga0055524_1002559 3300003775 Bacteria 9280
39 Ga0055528_1000751 3300003790 Bacteria 22613
40 Ga0055531_10015820 3300003794 Bacteria 3296
41 Ga0055541_1000053 3300003841 Bacteria 129958
42 Ga0055543_1000082 3300004625 Bacteria 83659
43 Ga0065165_1000002 3300005262 Bacteria 444192
44 Ga0065165_1001937 3300005262 Bacteria 19718
45 Ga0070658_10005321 3300005327 Bacteria 10449
46 Ga0070658_10007667 3300005327 Bacteria 8699
47 Ga0070658_10016399 3300005327 Bacteria 5928
48 Ga0070660_100000031 3300005339 Bacteria 86092
49 Ga0070660_100000472 3300005339 Bacteria 26882
50 Ga0070660_100002295 3300005339 Bacteria 13142
51 Ga0070660_100010780 3300005339 Bacteria 6470
52 Ga0070659_100000153 3300005366 Bacteria 52774
53 Ga0070659_100029877 3300005366 Bacteria 4214
54 Ga0070663_100000095 3300005455 Bacteria 40424
55 Ga0070663_100017630 3300005455 Bacteria 4664
56 Ga0068853_100014866 3300005539 Bacteria 6391
57 Ga0070665_100044380 3300005548 Bacteria 4464
58 Ga0068855_100000609 3300005563 Bacteria 43917
59 Ga0068855_100007225 3300005563 Bacteria 13477
60 Ga0068855_100012721 3300005563 Bacteria 10148
61 Ga0068855_100021327 3300005563 Bacteria 7769
62 Ga0068855_100089102 3300005563 Bacteria 3563
63 Ga0068855_100114189 3300005563 Bacteria 3097
64 Ga0068852_100039466 3300005616 Bacteria 3975
65 Ga0070717_10067438 3300006028 Bacteria 2977
66 Ga0075366_10027750 3300006195 Bacteria 3322
67 Ga0075370_10007604 3300006353 Bacteria 5527
68 Ga0105251_10000313 3300009011 Bacteria 48586
69 Ga0105240_10007311 3300009093 Bacteria 16070
70 Ga0105240_10010014 3300009093 Bacteria 13353
71 Ga0105240_10096943 3300009093 Bacteria 3593
72 Ga0105248_10081901 3300009177 Bacteria 3628
73 Ga0105237_10000301 3300009545 Bacteria 68372
74 Ga0105237_10009788 3300009545 Bacteria 10249
75 Ga0105237_10012088 3300009545 Bacteria 9115
76 Ga0105237_10076358 3300009545 Bacteria 3341
77 Ga0105238_10000102 3300009551 Bacteria 94910
78 Ga0105239_10005183 3300010375 Bacteria 15356
79 Ga0105239_10007010 3300010375 Bacteria 12970
80 Ga0105239_10009729 3300010375 Bacteria 10807
81 Ga0105239_10020901 3300010375 Bacteria 7222
82 Ga0105239_10033341 3300010375 Bacteria 5656
83 Ga0157373_10076140 3300013100 Bacteria 2368
84 Ga0157370_10001255 3300013104 Bacteria 31672
85 Ga0157370_10004570 3300013104 Bacteria 15845
86 Ga0157370_10008952 3300013104 Bacteria 10751
87 Ga0157370_10027029 3300013104 Bacteria 5659
88 Ga0157369_10000268 3300013105 Bacteria 70336
89 Ga0157369_10002038 3300013105 Bacteria 24356
90 Ga0157369_10007759 3300013105 Bacteria 12344
91 Ga0157369_10079965 3300013105 Bacteria 3501
92 Ga0157369_10100297 3300013105 Bacteria 3087
93 Ga0171463_1015 3300013249 Bacteria 79910
94 Ga0157374_10000081 3300013296 Bacteria 95406
95 Ga0157374_10000390 3300013296 Bacteria 40131
96 Ga0157372_10010494 3300013307 Bacteria 9862
97 Ga0157372_10011733 3300013307 Bacteria 9331
98 Ga0157375_10013306 3300013308 Bacteria 7317
99 Ga0157376_10100409 3300014969 Bacteria 2527
100 Ga0182006_1000827 3300015261 Bacteria 20753
101 Ga0182007_10003992 3300015262 Bacteria 6807
102 Ga0182007_10013407 3300015262 Bacteria 3126
103 Ga0183363_1068 3300015690 Bacteria 30796
104 Ga0183361_10030 3300016635 Bacteria 55672
105 Ga0213872_10000980 3300021361 Bacteria 19948
106 Ga0213876_10000717 3300021384 Bacteria 23188
107 Ga0209436_100869 3300025208 Bacteria 12075
108 Ga0209784_100083 3300025224 Bacteria 131194
109 Ga0209566_100102 3300025225 Bacteria 131194
110 Ga0209566_100187 3300025225 Bacteria 65446
111 Ga0209674_100020 3300025226 Bacteria 672397
112 Ga0209674_100029 3300025226 Bacteria 466683
113 Ga0209674_100125 3300025226 Bacteria 131194
114 Ga0209672_100012 3300025228 Bacteria 795742
115 Ga0209672_100013 3300025228 Bacteria 740693
116 Ga0209672_100063 3300025228 Bacteria 204903
117 Ga0209672_100132 3300025228 Bacteria 73895
118 Ga0209672_100188 3300025228 Bacteria 50151
119 Ga0209147_100007 3300025229 Bacteria 795684
120 Ga0209147_100013 3300025229 Bacteria 660057
121 Ga0209147_100077 3300025229 Bacteria 205964
122 Ga0209147_100116 3300025229 Bacteria 143881
123 Ga0209563_100120 3300025230 Bacteria 131194
124 Ga0207427_100684 3300025231 Bacteria 16136
125 Ga0209437_100042 3300025233 Bacteria 444095
126 Ga0209258_100014 3300025242 Bacteria 720132
127 Ga0209258_100016 3300025242 Bacteria 668622
128 Ga0209258_100105 3300025242 Bacteria 207862
129 Ga0209677_100076 3300025253 Bacteria 131194
130 Ga0209148_1000020 3300025254 Bacteria 740693
131 Ga0209148_1000107 3300025254 Bacteria 207862
132 Ga0209148_1000277 3300025254 Bacteria 79813
133 Ga0209759_1000008 3300025256 Bacteria 461395
134 Ga0209759_1000022 3300025256 Bacteria 329136
135 Ga0209759_1000052 3300025256 Bacteria 213964
136 Ga0209759_1001570 3300025256 Bacteria 12432
137 Ga0209759_1003227 3300025256 Bacteria 6597
138 Ga0209233_1000054 3300025261 Bacteria 439669
139 Ga0209233_1000055 3300025261 Bacteria 439422
140 Ga0209233_1000639 3300025261 Bacteria 17464
141 Ga0209455_1000017 3300025272 Bacteria 740693
142 Ga0209455_1000100 3300025272 Bacteria 207862
143 Ga0209455_1000590 3300025272 Bacteria 23490
144 Ga0209673_1000137 3300025273 Bacteria 158691
145 Ga0209130_1000010 3300025284 Bacteria 444920
146 Ga0209130_1001193 3300025284 Bacteria 18524
147 Ga0209130_1005609 3300025284 Bacteria 4305
148 Ga0209676_1009203 3300025292 Bacteria 4295
149 Ga0209025_1000061 3300025294 Bacteria 304827
150 Ga0209025_1000687 3300025294 Bacteria 58005
151 Ga0209025_1005692 3300025294 Bacteria 10036
152 Ga0209564_1000025 3300025295 Bacteria 520535
153 Ga0209564_1006152 3300025295 Bacteria 6575
154 Ga0209050_1001316 3300025298 Bacteria 27798
155 Ga0209050_1009184 3300025298 Bacteria 5108
156 Ga0209256_1000320 3300025299 Bacteria 82751
157 Ga0209256_1002250 3300025299 Bacteria 16402
158 Ga0207426_1000036 3300025302 Bacteria 444920
159 Ga0207426_1000037 3300025302 Bacteria 442735
160 Ga0207426_1000092 3300025302 Bacteria 278907
161 Ga0209257_1006722 3300025304 Bacteria 7269
162 Ga0209257_1011965 3300025304 Bacteria 4087
163 Ga0207713_1000401 3300025735 Bacteria 46363
164 Ga0207647_10000452 3300025904 Bacteria 33403
165 Ga0207647_10000738 3300025904 Bacteria 25647
166 Ga0207647_10003349 3300025904 Bacteria 12020
167 Ga0207647_10020962 3300025904 Bacteria 4372
168 Ga0207705_10002181 3300025909 Bacteria 15142
169 Ga0207705_10002965 3300025909 Bacteria 12969
170 Ga0207695_10000527 3300025913 Bacteria 80644
171 Ga0207695_10006928 3300025913 Bacteria 14563
172 Ga0207695_10044637 3300025913 Bacteria 4712
173 Ga0207671_10000227 3300025914 Bacteria 84794
174 Ga0207671_10005525 3300025914 Bacteria 11621
175 Ga0207671_10022301 3300025914 Bacteria 4788
176 Ga0207657_10000138 3300025919 Bacteria 74471
177 Ga0207657_10000472 3300025919 Bacteria 42379
178 Ga0207657_10001423 3300025919 Bacteria 25532
179 Ga0207694_10000176 3300025924 Bacteria 66165
180 Ga0207694_10007126 3300025924 Bacteria 8498
181 Ga0207700_10006451 3300025928 Bacteria 7084
182 Ga0207690_10000076 3300025932 Bacteria 85860
183 Ga0207667_10000146 3300025949 Bacteria 106926
184 Ga0207667_10004857 3300025949 Bacteria 16431
185 Ga0207667_10005456 3300025949 Bacteria 15503
186 Ga0207667_10006456 3300025949 Bacteria 14193
187 Ga0207667_10178104 3300025949 Bacteria 2184
188 Ga0207639_10000957 3300026041 Bacteria 19589
189 Ga0207678_10000275 3300026067 Bacteria 46613
190 Ga0207678_10071357 3300026067 Bacteria 2978
191 Ga0207698_10010852 3300026142 Bacteria 5879
192 Ga0209281_1000190 3300027111 Bacteria 140658
193 Ga0209371_1000113 3300027312 Bacteria 139649
194 Ga0209974_10013261 3300027876 Bacteria 2747
195 Ga0268266_10001947 3300028379 Bacteria 23211
196 Ga0268265_10084518 3300028380 Bacteria 2516
197 Ga0307517_10101078 3300028786 Bacteria 2273
198 Ga0307515_10000109 3300028794 Bacteria 195895
199 Ga0307515_10004774 3300028794 Bacteria 27760
200 Ga0307515_10022393 3300028794 Bacteria 11136
201 Ga0307515_10076778 3300028794 Bacteria 4423
202 Ga0265338_10025831 3300028800 Bacteria 5944
203 Ga0268256_1000184 3300030500 Bacteria 74040
204 Ga0265327_10006474 3300031251 Bacteria 9354
205 Ga0307509_10003968 3300031507 Bacteria 21826
206 Ga0307509_10028198 3300031507 Bacteria 6245
207 Ga0307408_100005877 3300031548 Bacteria 8171
208 Ga0307508_10000237 3300031616 Bacteria 67014
209 Ga0307514_10002227 3300031649 Bacteria 20686
210 Ga0307514_10009179 3300031649 Bacteria 8341
211 Ga0307516_10002137 3300031730 Bacteria 26777
212 Ga0307516_10004137 3300031730 Bacteria 18093
213 Ga0307405_10014270 3300031731 Bacteria 4267
214 Ga0307412_10000082 3300031911 Bacteria 93313
215 Ga0307414_10029744 3300032004 Bacteria 3559
216 Ga0307414_10070087 3300032004 Bacteria 2523
217 Ga0307507_10036334 3300033179 Bacteria 5038
218 Ga0307507_10060091 3300033179 Bacteria 3552
219 Ga0395899_0000097 3300037312 Bacteria 152056
220 Ga0395899_0019465 3300037312 Bacteria 5156
221 Ga0395899_0022276 3300037312 Bacteria 4805
222 Ga0395900_0000015 3300037418 Bacteria 384313
223 Ga0395900_0000225 3300037418 Bacteria 89034
224 Ga0395900_0009244 3300037418 Bacteria 10105
225 Ga0395900_0033419 3300037418 Bacteria 5293
226 Ga0395900_0107229 3300037418 Bacteria 2870
227 Ga0395900_0127306 3300037418 Bacteria 2611
228 Ga0395898_0000346 3300037466 Bacteria 104661
229 Ga0395898_0000708 3300037466 Bacteria 59283
230 Ga0395898_0005220 3300037466 Bacteria 14044
231 Ga0395898_0010074 3300037466 Bacteria 9892
232 Ga0395898_0013119 3300037466 Bacteria 8543
233 Ga0395898_0053822 3300037466 Bacteria 3929
234 Ga0395905_0000115 3300037471 Bacteria 133996
235 Ga0436364_0433038 3300037853 Bacteria 3134
236 Ga0395901_0000034 3300038443 Bacteria 230365
237 Ga0395901_0000752 3300038443 Bacteria 36559
238 Ga0395901_0001478 3300038443 Bacteria 24453
239 Ga0395901_0024098 3300038443 Bacteria 6242
240 Ga0395901_0065040 3300038443 Bacteria 3796
241 Ga0395901_0104493 3300038443 Bacteria 2973
242 Ga0400483_078725 3300039062 Bacteria 3345
243 Ga0400483_084134 3300039062 Bacteria 14235
244 Ga0400483_195385 3300039062 Bacteria 42888
245 Ga0436365_0328255 3300039437 Bacteria 67874
246 Ga0436365_1778650 3300039437 Bacteria 12914
247 Ga0436360_0576424 3300039438 Bacteria 6826
248 Ga0436360_0840185 3300039438 Bacteria 4200
249 Ga0436361_0005872 3300039447 Bacteria 9024
250 Ga0436361_0103401 3300039447 Bacteria 4102
251 Ga0436361_0212599 3300039447 Bacteria 6389
252 Ga0436361_0456824 3300039447 Bacteria 2284
253 Ga0436361_1014207 3300039447 Bacteria 2624
254 Ga0436361_1151561 3300039447 Bacteria 2256
255 Ga0439448_0000050 3300042005 Bacteria 18975
256 Ga0439448_0006717 3300042005 Bacteria 3315
257 Ga0450918_000309 3300042531 Bacteria 10941
258 Ga0466965_0000139 3300044683 Bacteria 20942
259 Ga0466966_0000037 3300044684 Bacteria 97578
260 Ga0466966_0000056 3300044684 Bacteria 81439
261 Ga0466966_0003607 3300044684 Bacteria 10210
262 Ga0466966_0059869 3300044684 Bacteria 2404
263 Ga0466961_0000726 3300044693 Bacteria 20713
264 Ga0466961_0001659 3300044693 Bacteria 13839
265 Ga0466961_0011526 3300044693 Bacteria 5653
266 Ga0466963_0000968 3300044694 Bacteria 14750
267 Ga0466963_0011156 3300044694 Bacteria 5467
268 Ga0466971_0003032 3300044719 Bacteria 7136
269 Ga0466957_0000322 3300044842 Bacteria 23260
270 Ga0466959_0009828 3300045049 Bacteria 6816
271 Ga0451576_0000728 3300045051 Bacteria 66112
272 Ga0451576_0021063 3300045051 Bacteria 7092
273 Ga0466958_0001176 3300045836 Bacteria 12184
274 Ga0466958_0001714 3300045836 Bacteria 10585
275 Ga0466958_0003399 3300045836 Bacteria 8258
276 Ga0466958_0010650 3300045836 Bacteria 5157
277 Ga0466958_0012529 3300045836 Bacteria 4807
278 Ga0495592_0010962 3300046454 Bacteria 6839
279 Ga0495592_0013048 3300046454 Bacteria 6322
280 Ga0495592_0017975 3300046454 Bacteria 5371
281 Ga0495603_0013120 3300046455 Bacteria 5007
282 Ga0495603_0024688 3300046455 Bacteria 3636
283 Ga0495591_009215 3300046458 Bacteria 3944
284 Ga0495629_0000058 3300046459 Bacteria 103431
285 Ga0495629_0005681 3300046459 Bacteria 9315
286 Ga0495629_0007023 3300046459 Bacteria 8295
287 Ga0495638_0000507 3300046460 Bacteria 46001
288 Ga0495638_0014428 3300046460 Bacteria 5339
289 Ga0495651_0024826 3300046462 Bacteria 4663
290 Ga0495653_0026647 3300046463 Bacteria 4632
291 Ga0495653_0028644 3300046463 Bacteria 4452
292 Ga0495653_0029752 3300046463 Bacteria 4355
293 Ga0495650_0009104 3300046471 Bacteria 5693
294 Ga0495650_0026473 3300046471 Bacteria 2697
295 Ga0495650_0030620 3300046471 Bacteria 2434
296 Ga0495580_0002280 3300046472 Bacteria 16750
297 Ga0495580_0020676 3300046472 Bacteria 4868
298 Ga0495580_0024403 3300046472 Bacteria 4426
299 Ga0495580_0035988 3300046472 Bacteria 3557
300 Ga0495582_0004390 3300046473 Bacteria 7932
301 Ga0495582_0005886 3300046473 Bacteria 6834
302 Ga0495582_0060139 3300046473 Bacteria 2096
303 Ga0495605_0006265 3300046474 Bacteria 6858
304 Ga0495605_0019053 3300046474 Bacteria 3673
305 Ga0495662_0023401 3300046476 Bacteria 2983
306 Ga0495662_0035078 3300046476 Bacteria 2421
307 Ga0495664_0002563 3300046477 Bacteria 9769
308 Ga0495664_0003047 3300046477 Bacteria 9072
309 Ga0495596_0007224 3300046500 Bacteria 5023
310 Ga0495596_0020106 3300046500 Bacteria 2735
311 Ga0495583_0002590 3300046506 Bacteria 15152
312 Ga0495583_0025921 3300046506 Bacteria 2918
313 Ga0495608_0047831 3300046511 Bacteria 2842
314 Ga0495610_0000281 3300046512 Bacteria 53046
315 Ga0495618_0013425 3300046514 Bacteria 4983
316 Ga0495618_0048565 3300046514 Bacteria 2679
317 Ga0495628_0018679 3300046516 Bacteria 5737
318 Ga0495628_0074897 3300046516 Bacteria 2636
319 Ga0495630_0028013 3300046517 Bacteria 4186
320 Ga0495630_0049059 3300046517 Bacteria 3159
321 Ga0495648_0016830 3300046524 Bacteria 5255
322 Ga0495666_0014713 3300046526 Bacteria 3893
323 Ga0495666_0037183 3300046526 Bacteria 2368
324 Ga0495652_0003552 3300046529 Bacteria 15318
325 Ga0495652_0020129 3300046529 Bacteria 5933
326 Ga0495640_0019199 3300046533 Bacteria 5049
327 Ga0495640_0047811 3300046533 Bacteria 2959
328 Ga0495586_0004610 3300046535 Bacteria 7370
329 Ga0495587_0000694 3300046536 Bacteria 22576
330 Ga0495587_0019291 3300046536 Bacteria 4222
331 Ga0495622_0000005 3300046557 Bacteria 254434
332 Ga0495633_0043962 3300046558 Bacteria 2118
333 Ga0495634_0017391 3300046642 Bacteria 5130
334 Ga0495625_0001972 3300046660 Bacteria 23159
335 Ga0495635_0001935 3300046663 Bacteria 14070
336 Ga0495661_0005081 3300046665 Bacteria 9388
337 Ga0495661_0009148 3300046665 Bacteria 6807
338 Ga0495599_0004991 3300046678 Bacteria 7892
339 Ga0495623_0002243 3300046679 Bacteria 12871
340 Ga0495623_0005170 3300046679 Bacteria 8560
341 Ga0495623_0021488 3300046679 Bacteria 4166
342 Ga0495646_0003436 3300046680 Bacteria 9851
343 Ga0495646_0004216 3300046680 Bacteria 9041
344 Ga0495646_0007239 3300046680 Bacteria 7050
345 Ga0495646_0008792 3300046680 Bacteria 6413
346 Ga0495646_0021651 3300046680 Bacteria 4060
347 Ga0495646_0038308 3300046680 Bacteria 2960
348 Ga0495613_0013514 3300046689 Bacteria 6062
349 Ga0495624_0009607 3300046690 Bacteria 6697
350 Ga0495670_0015511 3300046691 Bacteria 3744
351 Ga0495649_0005620 3300046694 Bacteria 7927
352 Ga0495589_0004355 3300046794 Bacteria 7551
353 Ga0495600_0047319 3300046809 Bacteria 2805
354 Ga0495581_0002671 3300047315 Bacteria 10147
355 Ga0495581_0003725 3300047315 Bacteria 8780
356 Ga0495604_0004557 3300047317 Bacteria 10979
357 Ga0495604_0009575 3300047317 Bacteria 7662
358 Ga0495604_0023731 3300047317 Bacteria 4894
359 Ga0495604_0049586 3300047317 Bacteria 3261
360 Ga0495674_0005812 3300047319 Bacteria 11830
361 Ga0495674_0014144 3300047319 Bacteria 7475
362 Ga0495674_0063839 3300047319 Bacteria 3202
363 Ga0495672_0000448 3300047320 Bacteria 49007
364 Ga0495672_0008656 3300047320 Bacteria 7479
365 Ga0495672_0034059 3300047320 Bacteria 3151
366 Ga0495676_0002760 3300047321 Bacteria 15769
367 Ga0495676_0047894 3300047321 Bacteria 3451
368 Ga0495680_0011095 3300047322 Bacteria 7998
369 Ga0495680_0049568 3300047322 Bacteria 3289
370 Ga0495683_0004484 3300047323 Bacteria 7916
371 Ga0495683_0005835 3300047323 Bacteria 6774
372 Ga0495683_0012385 3300047323 Bacteria 4477
373 Ga0495683_0014177 3300047323 Bacteria 4153
374 Ga0495687_012742 3300047443 Bacteria 4430
375 Ga0495687_028294 3300047443 Bacteria 2609
376 Ga0495679_000009 3300047446 Bacteria 343637
377 Ga0495679_000441 3300047446 Bacteria 30679
378 Ga0495679_004946 3300047446 Bacteria 6009
379 Ga0495686_0000080 3300047472 Bacteria 201665
380 Ga0495593_0003975 3300047673 Bacteria 8823
381 Ga0495593_0014700 3300047673 Bacteria 4448
382 Ga0495602_0025247 3300048088 Bacteria 5751
383 Ga0495602_0030094 3300048088 Bacteria 5157
384 Ga0495602_0040709 3300048088 Bacteria 4255
385 Ga0495614_0007893 3300048089 Bacteria 4732
386 Ga0495614_0010468 3300048089 Bacteria 4089
387 Ga0495626_0009067 3300048091 Bacteria 5396
388 Ga0496102_0026003 3300048905 Bacteria 5217
389 Ga0496102_0061085 3300048905 Bacteria 3448
390 Ga0496103_0014918 3300048906 Bacteria 4619
391 Ga0496106_0000067 3300048909 Bacteria 83475
392 Ga0496106_0035898 3300048909 Bacteria 3708
393 Ga0496110_0115055 3300048913 Bacteria 2421
394 Ga0496117_0000999 3300048920 Bacteria 43273
395 Ga0496118_0000234 3300048921 Bacteria 97673
396 Ga0496118_0004307 3300048921 Bacteria 17000
397 Ga0496118_0005753 3300048921 Bacteria 13940
398 Ga0496118_0018181 3300048921 Bacteria 6350
399 Ga0496118_0026995 3300048921 Bacteria 4873
400 Ga0496118_0086830 3300048921 Bacteria 2172
401 Ga0496121_0000102 3300048924 Bacteria 195341
402 Ga0496121_0099776 3300048924 Bacteria 2243
403 Ga0496122_0010216 3300048925 Bacteria 9730
404 Ga0496124_0000091 3300048927 Bacteria 189706
405 Ga0496125_0000600 3300048928 Bacteria 61362
406 Ga0496126_0000050 3300048929 Bacteria 316466
407 Ga0496126_0000679 3300048929 Bacteria 62626
408 Ga0496126_0017567 3300048929 Bacteria 7126
409 Ga0496126_0065366 3300048929 Bacteria 3255
410 Ga0495678_009105 3300049459 Bacteria 4951
411 Ga0495682_0025503 3300049460 Bacteria 2199
412 Ga0501033_0008804 3300049570 Bacteria 7802
413 Ga0501034_0002767 3300049571 Bacteria 20564
414 Ga0501034_0033343 3300049571 Bacteria 5226
415 Ga0501038_0100427 3300049574 Bacteria 2411
416 Ga0501047_0025163 3300049581 Bacteria 5719
417 Ga0501035_0032382 3300049822 Bacteria 4756
418 Ga0501035_0079686 3300049822 Bacteria 2892
419 Ga0501035_0085088 3300049822 Bacteria 2788
420 Ga0501044_0006479 3300049823 Bacteria 12931
421 Ga0501044_0066225 3300049823 Bacteria 3684
422 nmdc:mga07m45_6646_c1 3300050496 Bacteria 4991
423 Ga0495601_0003334 3300053077 Bacteria 9191
424 Ga0500618_000076 3300053125 Bacteria 80917
425 Ga0500618_000903 3300053125 Bacteria 15533
426 Ga0500618_004062 3300053125 Bacteria 4798
427 Ga0500559_0000091 3300053136 Bacteria 72157
428 Ga0500604_0001221 3300053151 Bacteria 7163
429 Ga0500634_0000058 3300053161 Bacteria 47751
430 Ga0500636_0000001 3300053177 Bacteria 324086
431 Ga0466962_0002922 3300061719 Bacteria 8145
432 Ga0466962_0004679 3300061719 Bacteria 6571

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2916076590 2916078958 545
2 3300037418 Ga0395900_0107229 Ga0395900_0107229_1166_2842 549
3 iso_pu_bacteria 2551306087 2551697433 558
4 iso_pu_bacteria 2551306089 2551710941 559
5 iso_pu_bacteria 2551306092 2551732592 561
6 3300039447 Ga0436361_0212599 Ga0436361_0212599_4593_6347 565
7 3300048921 Ga0496118_0086830 Ga0496118_0086830_42_1832 572
8 3300031507 Ga0307509_10028198 Ga0307509_100281982 591
9 3300039062 Ga0400483_084134 Ga0400483_084134_5540_7423 592
10 3300039062 Ga0400483_078725 Ga0400483_078725_18_1874 604
11 3300039447 Ga0436361_0456824 Ga0436361_0456824_208_2139 605
12 3300046558 Ga0495633_0043962 Ga0495633_0043962_12_1853 606
13 3300003323 rootH1_10083082 rootH1_100830828 611
14 3300039062 Ga0400483_195385 Ga0400483_195385_38822_40705 613
15 3300013308 Ga0157375_10013306 Ga0157375_100133062 614
16 3300028794 Ga0307515_10022393 Ga0307515_100223939 614
17 3300046691 Ga0495670_0015511 Ga0495670_0015511_1481_3367 614
18 3300048905 Ga0496102_0026003 Ga0496102_0026003_3180_5066 614
19 3300048909 Ga0496106_0035898 Ga0496106_0035898_553_2439 614
20 3300037853 Ga0436364_0433038 Ga0436364_0433038_66_1946 615
21 3300046471 Ga0495650_0009104 Ga0495650_0009104_81_1967 615
22 3300048913 Ga0496110_0115055 Ga0496110_0115055_33_1919 615
23 iso_pu_bacteria 2960652885 2960655765 616
24 3300046660 Ga0495625_0001972 Ga0495625_0001972_4647_6638 618
25 3300031616 Ga0307508_10000237 Ga0307508_100002377 619
26 3300033179 Ga0307507_10036334 Ga0307507_100363342 619
27 3300049570 Ga0501033_0008804 Ga0501033_0008804_4426_6384 621
28 3300049571 Ga0501034_0033343 Ga0501034_0033343_1985_3943 621
29 3300049581 Ga0501047_0025163 Ga0501047_0025163_1848_3806 621
30 3300049822 Ga0501035_0079686 Ga0501035_0079686_886_2844 621
31 3300049823 Ga0501044_0006479 Ga0501044_0006479_1183_3141 621
32 3300046460 Ga0495638_0000507 Ga0495638_0000507_33936_35834 622
33 3300047446 Ga0495679_004946 Ga0495679_004946_2377_4275 622
34 3300053125 Ga0500618_000076 Ga0500618_000076_58384_60282 622
35 3300053136 Ga0500559_0000091 Ga0500559_0000091_67723_69621 622
36 3300006353 Ga0075370_10007604 Ga0075370_100076042 623
37 3300010375 Ga0105239_10020901 Ga0105239_100209011 624
38 3300002737 JGI25162J39368_1001301 JGI25162J39368_10013017 625
39 3300003214 JGI25165J46597_1000565 JGI25165J46597_100056529 625
40 3300025233 Ga0209437_100042 Ga0209437_100042411 625
41 3300025261 Ga0209233_1000054 Ga0209233_1000054250 625
42 3300045051 Ga0451576_0000728 Ga0451576_0000728_31887_33800 625
43 3300037418 Ga0395900_0009244 Ga0395900_0009244_8154_10049 627
44 3300048920 Ga0496117_0000999 Ga0496117_0000999_9621_11513 628
45 3300048921 Ga0496118_0005753 Ga0496118_0005753_3101_4993 628
46 3300048929 Ga0496126_0000050 Ga0496126_0000050_62063_63955 628
47 iso_pu_bacteria 2775506901 2776264058 628
48 3300005455 Ga0070663_100017630 Ga0070663_1000176302 629
49 3300013249 Ga0171463_1015 Ga0171463_101522 629
50 3300015690 Ga0183363_1068 Ga0183363_10684 629
51 3300031251 Ga0265327_10006474 Ga0265327_100064745 630
52 3300046471 Ga0495650_0026473 Ga0495650_0026473_444_2354 630
53 3300047472 Ga0495686_0000080 Ga0495686_0000080_84518_86428 630
54 3300015262 Ga0182007_10013407 Ga0182007_100134072 631
55 3300049822 Ga0501035_0085088 Ga0501035_0085088_510_2465 631
56 iso_pu_bacteria 2510461069 2510839117 631
57 iso_pu_bacteria 8005658619 8005661862 631
58 iso_pu_bacteria 8055431914 8055434625 631
59 3300028794 Ga0307515_10004774 Ga0307515_100047745 632
60 3300031649 Ga0307514_10009179 Ga0307514_100091792 632
61 3300031730 Ga0307516_10002137 Ga0307516_100021378 632
62 iso_pu_bacteria 2513237159 2513997639 632
63 iso_pu_bacteria 2582581283 2585167487 632
64 iso_pu_bacteria 2582581306 2585265715 632
65 iso_pu_bacteria 2582581865 2585388921 632
66 iso_pu_bacteria 2582581866 2585395387 632
67 iso_pu_bacteria 2600254933 2600376063 632
68 iso_pu_bacteria 2643221607 2644050190 632
69 iso_pu_bacteria 2643221636 2644204749 632
70 iso_pu_bacteria 2643221653 2644299869 632
71 iso_pu_bacteria 2643221686 2644483110 632
72 iso_pu_bacteria 2643221719 2644658096 632
73 iso_pu_bacteria 2818991272 2819244655 632
74 iso_pu_bacteria 2818991461 2819683430 632
75 iso_pu_bacteria 2842521101 2842522118 632
76 iso_pu_bacteria 2989776772 2989780090 632
77 iso_pu_bacteria 8005246636 8005249231 632
78 iso_pu_bacteria 8018150411 8018153620 632
79 iso_pu_bacteria 8054460903 8054464395 632
80 3300031649 Ga0307514_10002227 Ga0307514_100022275 633
81 iso_pu_bacteria 2510917022 2511135743 633
82 iso_pu_bacteria 2551306091 2551726920 633
83 iso_pu_bacteria 2582581307 2585274875 633
84 iso_pu_bacteria 2585427531 2585564387 633
85 iso_pu_bacteria 2585427608 2585902416 633
86 iso_pu_bacteria 2585427609 2585907992 633
87 iso_pu_bacteria 2585428125 2587983412 633
88 iso_pu_bacteria 2643221558 2643814071 633
89 3300027876 Ga0209974_10013261 Ga0209974_100132611 634
90 3300028800 Ga0265338_10025831 Ga0265338_100258312 634
91 iso_pu_bacteria 2521172590 2521560988 634
92 iso_pu_bacteria 2643221618 2644106801 634
93 iso_pu_bacteria 2643221626 2644149311 634
94 iso_pu_bacteria 2643221655 2644309873 634
95 iso_pu_bacteria 2643221659 2644337154 634
96 iso_pu_bacteria 2643221698 2644540532 634
97 iso_pu_bacteria 2643221712 2644616324 634
98 3300003187 JGI25151J46595_10000370 JGI25151J46595_1000037046 635
99 3300025284 Ga0209130_1001193 Ga0209130_100119313 635
100 3300025294 Ga0209025_1000061 Ga0209025_10000613 635
101 3300025302 Ga0207426_1000092 Ga0207426_100009242 635
102 3300028794 Ga0307515_10000109 Ga0307515_10000109157 635
103 3300031730 Ga0307516_10004137 Ga0307516_100041373 635
104 3300033179 Ga0307507_10060091 Ga0307507_100600911 635
105 3300048924 Ga0496121_0099776 Ga0496121_0099776_19_1965 635
106 iso_pu_bacteria 2551306090 2551716058 635
107 iso_pu_bacteria 2643221634 2644193746 635
108 iso_pu_bacteria 2842509118 2842513263 635
109 3300013100 Ga0157373_10076140 Ga0157373_100761402 636
110 3300039438 Ga0436360_0840185 Ga0436360_0840185_123_2054 636
111 3300048909 Ga0496106_0000067 Ga0496106_0000067_972_2945 636
112 3300048924 Ga0496121_0000102 Ga0496121_0000102_11359_13332 636
113 3300053125 Ga0500618_004062 Ga0500618_004062_742_2673 636
114 iso_pu_bacteria 2821443989 2821449946 636
115 iso_pu_bacteria 2844533157 2844537231 636
116 3300002739 JGI25158J39367_1003178 JGI25158J39367_10031782 637
117 3300002987 JGI25159J45721_1000083 JGI25159J45721_100008322 637
118 3300003322 rootL2_10115399 rootL2_101153992 637
119 3300003354 JGI25160J50197_1000005 JGI25160J50197_100000564 637
120 3300003374 JGI25161J50226_1000349 JGI25161J50226_100034911 637
121 3300003758 Ga0055532_1000613 Ga0055532_100061314 637
122 3300003761 Ga0055535_1000650 Ga0055535_100065014 637
123 3300003762 Ga0055542_1000658 Ga0055542_100065814 637
124 3300003763 Ga0055529_1000595 Ga0055529_100059514 637
125 3300003775 Ga0055524_1002559 Ga0055524_10025596 637
126 3300003794 Ga0055531_10015820 Ga0055531_100158201 637
127 3300004625 Ga0055543_1000082 Ga0055543_10000828 637
128 3300005262 Ga0065165_1000002 Ga0065165_1000002326 637
129 3300021384 Ga0213876_10000717 Ga0213876_1000071720 637
130 3300025208 Ga0209436_100869 Ga0209436_1008694 637
131 3300025228 Ga0209672_100063 Ga0209672_10006399 637
132 3300025229 Ga0209147_100077 Ga0209147_10007799 637
133 3300025242 Ga0209258_100105 Ga0209258_10010599 637
134 3300025254 Ga0209148_1000107 Ga0209148_100010799 637
135 3300025272 Ga0209455_1000100 Ga0209455_100010099 637
136 3300025284 Ga0209130_1000010 Ga0209130_1000010322 637
137 3300025292 Ga0209676_1009203 Ga0209676_10092032 637
138 3300025294 Ga0209025_1000687 Ga0209025_100068742 637
139 3300025294 Ga0209025_1005692 Ga0209025_10056922 637
140 3300025295 Ga0209564_1000025 Ga0209564_100002529 637
141 3300025298 Ga0209050_1009184 Ga0209050_10091842 637
142 3300025299 Ga0209256_1000320 Ga0209256_100032047 637
143 3300025299 Ga0209256_1002250 Ga0209256_100225018 637
144 3300025302 Ga0207426_1000036 Ga0207426_1000036322 637
145 3300025304 Ga0209257_1006722 Ga0209257_10067227 637
146 3300025304 Ga0209257_1011965 Ga0209257_10119652 637
147 3300027111 Ga0209281_1000190 Ga0209281_100019063 637
148 3300027312 Ga0209371_1000113 Ga0209371_1000113126 637
149 3300030500 Ga0268256_1000184 Ga0268256_100018464 637
150 3300039437 Ga0436365_0328255 Ga0436365_0328255_27426_29396 637
151 3300048925 Ga0496122_0010216 Ga0496122_0010216_1408_3342 637
152 3300053177 Ga0500636_0000001 Ga0500636_0000001_49807_51747 637
153 iso_pu_bacteria 2510065057 2510302787 637
154 iso_pu_bacteria 2511231052 2511497844 637
155 iso_pu_bacteria 2512047086 2512529013 637
156 iso_pu_bacteria 2513237086 2513584307 637
157 iso_pu_bacteria 2513237091 2513616482 637
158 iso_pu_bacteria 2513237140 2513885342 637
159 iso_pu_bacteria 2513237143 2513901949 637
160 iso_pu_bacteria 2515154107 2515612082 637
161 iso_pu_bacteria 2516653046 2516896512 637
162 iso_pu_bacteria 2524023207 2524452031 637
163 iso_pu_bacteria 2534681796 2535516650 637
164 iso_pu_bacteria 2551306084 2551679716 637
165 iso_pu_bacteria 2551306085 2551684161 637
166 iso_pu_bacteria 2551306086 2551693523 637
167 iso_pu_bacteria 2551306093 2551741258 637
168 iso_pu_bacteria 2599185352 2600197338 637
169 iso_pu_bacteria 2643221557 2643809423 637
170 iso_pu_bacteria 2643221610 2644069411 637
171 iso_pu_bacteria 2643221629 2644167475 637
172 iso_pu_bacteria 2643221662 2644347238 637
173 iso_pu_bacteria 2643221668 2644379988 637
174 iso_pu_bacteria 2643221675 2644420564 637
175 iso_pu_bacteria 2643221680 2644454090 637
176 iso_pu_bacteria 2643221723 2644674752 637
177 iso_pu_bacteria 2643221726 2644686137 637
178 iso_pu_bacteria 2838074704 2838075917 637
179 iso_pu_bacteria 2844163670 2844168605 637
180 iso_pu_bacteria 2855825444 2855828660 637
181 iso_pu_bacteria 2855839649 2855843782 637
182 iso_pu_bacteria 2858800743 2858806973 637
183 iso_pu_bacteria 2915986958 2915992474 637
184 iso_pu_bacteria 2915993759 2915996858 637
185 iso_pu_bacteria 2916000859 2916006546 637
186 iso_pu_bacteria 2916007675 2916008953 637
187 iso_pu_bacteria 2916014648 2916016366 637
188 iso_pu_bacteria 2916021584 2916026295 637
189 iso_pu_bacteria 2916028427 2916034886 637
190 iso_pu_bacteria 2916035215 2916036520 637
191 iso_pu_bacteria 2916041962 2916047050 637
192 iso_pu_bacteria 2916048683 2916054573 637
193 iso_pu_bacteria 2916055098 2916056203 637
194 iso_pu_bacteria 2920760137 2920764508 637
195 iso_pu_bacteria 2920822456 2920827998 637
196 iso_pu_bacteria 2921201388 2921206634 637
197 iso_pu_bacteria 2921208531 2921210077 637
198 iso_pu_bacteria 2921237296 2921242706 637
199 iso_pu_bacteria 2921244191 2921248609 637
200 iso_pu_bacteria 2921257292 2921258975 637
201 iso_pu_bacteria 2921263974 2921264803 637
202 iso_pu_bacteria 2921282425 2921288316 637
203 iso_pu_bacteria 2921289301 2921290427 637
204 iso_pu_bacteria 2921296804 2921299283 637
205 iso_pu_bacteria 2924144063 2924147821 637
206 iso_pu_bacteria 2924150972 2924156734 637
207 iso_pu_bacteria 2924158325 2924165444 637
208 iso_pu_bacteria 2924165586 2924168353 637
209 iso_pu_bacteria 2924172951 2924173261 637
210 iso_pu_bacteria 2924179722 2924179941 637
211 iso_pu_bacteria 2924186466 2924192425 637
212 iso_pu_bacteria 2924193448 2924195849 637
213 iso_pu_bacteria 2924200457 2924203155 637
214 iso_pu_bacteria 2924207177 2924208999 637
215 iso_pu_bacteria 2924214083 2924219928 637
216 iso_pu_bacteria 2924221636 2924226321 637
217 iso_pu_bacteria 2924228884 2924231170 637
218 iso_pu_bacteria 2932401849 2932403165 637
219 iso_pu_bacteria 2936996657 2937001487 637
220 iso_pu_bacteria 2937002841 2937009623 637
221 iso_pu_bacteria 2937009748 2937014369 637
222 iso_pu_bacteria 2937016420 2937017711 637
223 iso_pu_bacteria 2937023124 2937024028 637
224 iso_pu_bacteria 2937042894 2937048728 637
225 iso_pu_bacteria 2937049772 2937054825 637
226 iso_pu_bacteria 2937056579 2937061782 637
227 iso_pu_bacteria 2937063883 2937069788 637
228 iso_pu_bacteria 2937071275 2937077316 637
229 iso_pu_bacteria 2937091812 2937092340 637
230 iso_pu_bacteria 2937098957 2937102616 637
231 iso_pu_bacteria 2937106411 2937109504 637
232 iso_pu_bacteria 2937113482 2937118767 637
233 iso_pu_bacteria 2937119839 2937125888 637
234 iso_pu_bacteria 2937126314 2937130985 637
235 iso_pu_bacteria 2941499720 2941503228 637
236 iso_pu_bacteria 2957382221 2957383157 637
237 iso_pu_bacteria 2957388812 2957389672 637
238 iso_pu_bacteria 2957395598 2957401240 637
239 iso_pu_bacteria 2957402308 2957407431 637
240 iso_pu_bacteria 2957408893 2957410646 637
241 iso_pu_bacteria 2957415311 2957421022 637
242 iso_pu_bacteria 2957422303 2957427544 637
243 iso_pu_bacteria 2957430029 2957434698 637
244 iso_pu_bacteria 2957443900 2957445281 637
245 iso_pu_bacteria 2957450854 2957451584 637
246 iso_pu_bacteria 2957457609 2957463981 637
247 iso_pu_bacteria 2957464669 2957464768 637
248 iso_pu_bacteria 2957471148 2957472232 637
249 iso_pu_bacteria 2957478035 2957478412 637
250 iso_pu_bacteria 2957484790 2957489947 637
251 iso_pu_bacteria 2957491536 2957491632 637
252 iso_pu_bacteria 2957498199 2957504592 637
253 iso_pu_bacteria 2957505466 2957507220 637
254 iso_pu_bacteria 2960584000 2960585660 637
255 iso_pu_bacteria 2960597568 2960600169 637
256 iso_pu_bacteria 2960603979 2960607021 637
257 iso_pu_bacteria 2960610863 2960613494 637
258 iso_pu_bacteria 2960617483 2960621159 637
259 iso_pu_bacteria 2960624210 2960626948 637
260 iso_pu_bacteria 2960637947 2960642377 637
261 iso_pu_bacteria 2960645483 2960645582 637
262 iso_pu_bacteria 2960660292 2960661928 637
263 iso_pu_bacteria 2960667422 2960668222 637
264 iso_pu_bacteria 2960674078 2960678129 637
265 iso_pu_bacteria 2960687367 2960692923 637
266 iso_pu_bacteria 2964607997 2964610703 637
267 iso_pu_bacteria 2964615318 2964621714 637
268 iso_pu_bacteria 2964621998 2964624333 637
269 iso_pu_bacteria 2964628898 2964633698 637
270 iso_pu_bacteria 2964636051 2964639549 637
271 iso_pu_bacteria 2964643177 2964647901 637
272 iso_pu_bacteria 2964649959 2964653613 637
273 iso_pu_bacteria 2964656573 2964657946 637
274 iso_pu_bacteria 2964663802 2964665171 637
275 iso_pu_bacteria 2964670856 2964672812 637
276 iso_pu_bacteria 2964678106 2964684085 637
277 iso_pu_bacteria 2964685014 2964689106 637
278 iso_pu_bacteria 2964691889 2964697241 637
279 iso_pu_bacteria 2964698721 2964705407 637
280 iso_pu_bacteria 2964705432 2964711366 637
281 iso_pu_bacteria 2964712639 2964718396 637
282 iso_pu_bacteria 2964719344 2964724001 637
283 iso_pu_bacteria 2967664464 2967665246 637
284 iso_pu_bacteria 2967671571 2967676148 637
285 iso_pu_bacteria 2967678726 2967680797 637
286 iso_pu_bacteria 2967693043 2967697891 637
287 iso_pu_bacteria 2967699805 2967700347 637
288 iso_pu_bacteria 2967706974 2967712981 637
289 iso_pu_bacteria 2967714385 2967720884 637
290 iso_pu_bacteria 2967721400 2967724917 637
291 iso_pu_bacteria 2967735183 2967741818 637
292 iso_pu_bacteria 2967742019 2967748627 637
293 iso_pu_bacteria 2967748971 2967750918 637
294 iso_pu_bacteria 2967755722 2967761747 637
295 iso_pu_bacteria 2967762386 2967763020 637
296 iso_pu_bacteria 2967769361 2967772217 637
297 iso_pu_bacteria 2967775926 2967781687 637
298 iso_pu_bacteria 2970019648 2970023748 637
299 iso_pu_bacteria 2970033650 2970034585 637
300 iso_pu_bacteria 2970040964 2970042876 637
301 iso_pu_bacteria 2970047711 2970052025 637
302 iso_pu_bacteria 2970054988 2970057829 637
303 iso_pu_bacteria 2970061556 2970068021 637
304 iso_pu_bacteria 2970068827 2970069157 637
305 iso_pu_bacteria 2970076120 2970077231 637
306 iso_pu_bacteria 2970082768 2970085010 637
307 iso_pu_bacteria 2970088815 2970094681 637
308 iso_pu_bacteria 2970095765 2970100983 637
309 iso_pu_bacteria 2970102677 2970105714 637
310 iso_pu_bacteria 2970109326 2970110583 637
311 iso_pu_bacteria 2970116247 2970122425 637
312 iso_pu_bacteria 2970129317 2970134862 637
313 iso_pu_bacteria 2970136068 2970140749 637
314 iso_pu_bacteria 2970143518 2970145057 637
315 iso_pu_bacteria 2970149975 2970153119 637
316 iso_pu_bacteria 2970156795 2970157650 637
317 iso_pu_bacteria 2970164137 2970164713 637
318 iso_pu_bacteria 2970170962 2970174379 637
319 iso_pu_bacteria 2970177841 2970182155 637
320 iso_pu_bacteria 2970184632 2970191006 637
321 iso_pu_bacteria 2970191845 2970196750 637
322 iso_pu_bacteria 2977516862 2977520392 637
323 iso_pu_bacteria 2977523885 2977529737 637
324 iso_pu_bacteria 2977537788 2977539100 637
325 iso_pu_bacteria 2977551784 2977555300 637
326 iso_pu_bacteria 2977558990 2977560876 637
327 iso_pu_bacteria 2977565890 2977566886 637
328 iso_pu_bacteria 2977572785 2977574214 637
329 iso_pu_bacteria 2977579622 2977580730 637
330 iso_pu_bacteria 648276728 648739005 637
331 iso_pu_bacteria 8003992118 8003996342 637
332 iso_pu_bacteria 8005542996 8005545309 637
333 3300003760 Ga0055527_1000641 Ga0055527_10006413 638
334 3300005539 Ga0068853_100014866 Ga0068853_1000148665 638
335 3300005548 Ga0070665_100044380 Ga0070665_1000443803 638
336 3300009545 Ga0105237_10000301 Ga0105237_100003012 638
337 3300009545 Ga0105237_10012088 Ga0105237_100120885 638
338 3300009545 Ga0105237_10076358 Ga0105237_100763581 638
339 3300009551 Ga0105238_10000102 Ga0105238_1000010235 638
340 3300010375 Ga0105239_10009729 Ga0105239_100097292 638
341 3300010375 Ga0105239_10033341 Ga0105239_100333412 638
342 3300013105 Ga0157369_10100297 Ga0157369_101002972 638
343 3300015261 Ga0182006_1000827 Ga0182006_100082715 638
344 3300025261 Ga0209233_1000639 Ga0209233_100063918 638
345 3300025914 Ga0207671_10000227 Ga0207671_1000022752 638
346 3300026041 Ga0207639_10000957 Ga0207639_1000095720 638
347 3300026067 Ga0207678_10071357 Ga0207678_100713572 638
348 3300028379 Ga0268266_10001947 Ga0268266_1000194710 638
349 3300028786 Ga0307517_10101078 Ga0307517_101010781 638
350 3300031507 Ga0307509_10003968 Ga0307509_1000396815 638
351 3300032004 Ga0307414_10070087 Ga0307414_100700872 638
352 3300037312 Ga0395899_0019465 Ga0395899_0019465_714_2669 638
353 3300038443 Ga0395901_0024098 Ga0395901_0024098_3613_5568 638
354 3300046471 Ga0495650_0030620 Ga0495650_0030620_24_1940 638
355 3300046517 Ga0495630_0049059 Ga0495630_0049059_15_1931 638
356 3300047443 Ga0495687_028294 Ga0495687_028294_672_2588 638
357 3300048927 Ga0496124_0000091 Ga0496124_0000091_160968_162905 638
358 3300048928 Ga0496125_0000600 Ga0496125_0000600_34497_36458 638
359 3300049460 Ga0495682_0025503 Ga0495682_0025503_260_2176 638
360 3300049571 Ga0501034_0002767 Ga0501034_0002767_10703_12661 638
361 3300049574 Ga0501038_0100427 Ga0501038_0100427_194_2161 638
362 3300049822 Ga0501035_0032382 Ga0501035_0032382_708_2675 638
363 3300049823 Ga0501044_0066225 Ga0501044_0066225_890_2857 638
364 3300053151 Ga0500604_0001221 Ga0500604_0001221_1920_3878 638
365 iso_pu_bacteria 2617270742 2617381307 638
366 iso_pu_bacteria 2643221580 2643910630 638
367 iso_pu_bacteria 2643221591 2643963430 638
368 iso_pu_bacteria 2643221637 2644207447 638
369 iso_pu_bacteria 2643221674 2644410457 638
370 iso_pu_bacteria 2643221718 2644651095 638
371 iso_pu_bacteria 2775507266 2778174550 638
372 iso_pu_bacteria 2842482326 2842485586 638
373 3300003790 Ga0055528_1000751 Ga0055528_10007512 639
374 3300005327 Ga0070658_10016399 Ga0070658_100163992 639
375 3300005339 Ga0070660_100000031 Ga0070660_10000003152 639
376 3300005366 Ga0070659_100000153 Ga0070659_10000015319 639
377 3300005563 Ga0068855_100089102 Ga0068855_1000891022 639
378 3300005616 Ga0068852_100039466 Ga0068852_1000394662 639
379 3300009093 Ga0105240_10096943 Ga0105240_100969432 639
380 3300025273 Ga0209673_1000137 Ga0209673_100013714 639
381 3300025904 Ga0207647_10003349 Ga0207647_100033494 639
382 3300025913 Ga0207695_10044637 Ga0207695_100446373 639
383 3300025914 Ga0207671_10022301 Ga0207671_100223012 639
384 3300025919 Ga0207657_10000138 Ga0207657_1000013816 639
385 3300025924 Ga0207694_10007126 Ga0207694_100071262 639
386 3300025932 Ga0207690_10000076 Ga0207690_1000007653 639
387 3300026142 Ga0207698_10010852 Ga0207698_100108522 639
388 3300042531 Ga0450918_000309 Ga0450918_000309_5790_7775 639
389 3300053125 Ga0500618_000903 Ga0500618_000903_5420_7396 639
390 3300053161 Ga0500634_0000058 Ga0500634_0000058_38138_40096 639
391 3300013105 Ga0157369_10002038 Ga0157369_1000203811 640
392 3300028794 Ga0307515_10076778 Ga0307515_100767784 640
393 3300037312 Ga0395899_0000097 Ga0395899_0000097_118366_120321 640
394 3300037312 Ga0395899_0022276 Ga0395899_0022276_2821_4776 640
395 3300037418 Ga0395900_0000015 Ga0395900_0000015_377098_379047 640
396 3300037418 Ga0395900_0000225 Ga0395900_0000225_55344_57299 640
397 3300037466 Ga0395898_0000346 Ga0395898_0000346_99201_101150 640
398 3300037466 Ga0395898_0000708 Ga0395898_0000708_24989_26944 640
399 3300038443 Ga0395901_0065040 Ga0395901_0065040_1246_3195 640
400 3300039447 Ga0436361_0005872 Ga0436361_0005872_2322_4253 640
401 3300044693 Ga0466961_0000726 Ga0466961_0000726_4492_6447 640
402 3300045836 Ga0466958_0001176 Ga0466958_0001176_3295_5250 640
403 3300045836 Ga0466958_0003399 Ga0466958_0003399_4952_6904 640
404 3300003758 Ga0055532_1000429 Ga0055532_10004298 641
405 3300003760 Ga0055527_1000357 Ga0055527_100035715 641
406 3300003761 Ga0055535_1000815 Ga0055535_100081515 641
407 3300003762 Ga0055542_1002582 Ga0055542_10025822 641
408 3300014969 Ga0157376_10100409 Ga0157376_101004091 641
409 3300025228 Ga0209672_100012 Ga0209672_100012512 641
410 3300025229 Ga0209147_100007 Ga0209147_100007258 641
411 3300025242 Ga0209258_100014 Ga0209258_100014444 641
412 3300025254 Ga0209148_1000277 Ga0209148_100027756 641
413 3300025272 Ga0209455_1000590 Ga0209455_100059015 641
414 3300039447 Ga0436361_1014207 Ga0436361_1014207_201_2183 641
415 3300010375 Ga0105239_10007010 Ga0105239_100070102 642
416 3300028380 Ga0268265_10084518 Ga0268265_100845181 642
417 3300039438 Ga0436360_0576424 Ga0436360_0576424_4175_6160 642
418 3300039447 Ga0436361_1151561 Ga0436361_1151561_247_2232 642
419 3300042005 Ga0439448_0006717 Ga0439448_0006717_74_2032 642
420 3300045051 Ga0451576_0021063 Ga0451576_0021063_3140_5092 642
421 3300046472 Ga0495580_0020676 Ga0495580_0020676_73_2010 642
422 iso_pu_bacteria 2585428058 2587735625 642
423 iso_pu_bacteria 2842454564 2842456217 642
424 3300025256 Ga0209759_1001570 Ga0209759_10015705 643
425 3300037418 Ga0395900_0000015 Ga0395900_0000015_338381_340345 643
426 3300044684 Ga0466966_0000056 Ga0466966_0000056_2863_4827 643
427 3300044693 Ga0466961_0001659 Ga0466961_0001659_5892_7856 643
428 3300045836 Ga0466958_0012529 Ga0466958_0012529_689_2653 643
429 3300047319 Ga0495674_0014144 Ga0495674_0014144_242_2182 644
430 3300047320 Ga0495672_0008656 Ga0495672_0008656_344_2284 644
431 iso_pu_bacteria 2600255067 2600811501 644
432 iso_pu_bacteria 2904434214 2904437071 644
433 3300013105 Ga0157369_10000268 Ga0157369_1000026822 645
434 3300025298 Ga0209050_1001316 Ga0209050_10013164 645
435 3300031731 Ga0307405_10014270 Ga0307405_100142703 645
436 3300037312 Ga0395899_0000097 Ga0395899_0000097_104832_106796 645
437 3300037418 Ga0395900_0000225 Ga0395900_0000225_41810_43774 645
438 3300037466 Ga0395898_0000346 Ga0395898_0000346_19829_21793 645
439 3300037466 Ga0395898_0000708 Ga0395898_0000708_11455_13419 645
440 3300037471 Ga0395905_0000115 Ga0395905_0000115_21309_23246 645
441 3300046516 Ga0495628_0074897 Ga0495628_0074897_458_2413 645
442 3300047320 Ga0495672_0034059 Ga0495672_0034059_602_2539 645
443 3300048088 Ga0495602_0025247 Ga0495602_0025247_305_2242 645
444 3300048929 Ga0496126_0017567 Ga0496126_0017567_2880_4883 645
445 iso_pu_bacteria 2585428062 2587757109 645
446 iso_pu_bacteria 2643221644 2644246413 645
447 3300006195 Ga0075366_10027750 Ga0075366_100277502 646
448 3300009011 Ga0105251_10000313 Ga0105251_1000031330 646
449 3300013105 Ga0157369_10079965 Ga0157369_100799652 646
450 3300015262 Ga0182007_10003992 Ga0182007_100039923 646
451 3300044683 Ga0466965_0000139 Ga0466965_0000139_3404_5350 646
452 3300044693 Ga0466961_0011526 Ga0466961_0011526_3405_5351 646
453 3300044694 Ga0466963_0000968 Ga0466963_0000968_1969_3915 646
454 3300044719 Ga0466971_0003032 Ga0466971_0003032_3910_5856 646
455 3300044842 Ga0466957_0000322 Ga0466957_0000322_5701_7647 646
456 3300045049 Ga0466959_0009828 Ga0466959_0009828_1195_3141 646
457 3300045836 Ga0466958_0001714 Ga0466958_0001714_8604_10550 646
458 3300046454 Ga0495592_0010962 Ga0495592_0010962_2583_4523 646
459 3300046454 Ga0495592_0017975 Ga0495592_0017975_708_2648 646
460 3300046455 Ga0495603_0013120 Ga0495603_0013120_1594_3534 646
461 3300046458 Ga0495591_009215 Ga0495591_009215_611_2551 646
462 3300046459 Ga0495629_0000058 Ga0495629_0000058_40617_42557 646
463 3300046459 Ga0495629_0005681 Ga0495629_0005681_6494_8434 646
464 3300046459 Ga0495629_0007023 Ga0495629_0007023_870_2810 646
465 3300046460 Ga0495638_0014428 Ga0495638_0014428_352_2292 646
466 3300046462 Ga0495651_0024826 Ga0495651_0024826_1867_3807 646
467 3300046463 Ga0495653_0026647 Ga0495653_0026647_1083_3023 646
468 3300046463 Ga0495653_0029752 Ga0495653_0029752_411_2351 646
469 3300046472 Ga0495580_0002280 Ga0495580_0002280_13402_15342 646
470 3300046472 Ga0495580_0024403 Ga0495580_0024403_1359_3299 646
471 3300046473 Ga0495582_0004390 Ga0495582_0004390_660_2600 646
472 3300046473 Ga0495582_0005886 Ga0495582_0005886_4277_6217 646
473 3300046473 Ga0495582_0060139 Ga0495582_0060139_143_2083 646
474 3300046474 Ga0495605_0006265 Ga0495605_0006265_637_2577 646
475 3300046474 Ga0495605_0019053 Ga0495605_0019053_1305_3245 646
476 3300046476 Ga0495662_0023401 Ga0495662_0023401_352_2292 646
477 3300046476 Ga0495662_0035078 Ga0495662_0035078_184_2124 646
478 3300046477 Ga0495664_0002563 Ga0495664_0002563_7326_9266 646
479 3300046477 Ga0495664_0003047 Ga0495664_0003047_2577_4517 646
480 3300046500 Ga0495596_0007224 Ga0495596_0007224_570_2510 646
481 3300046500 Ga0495596_0020106 Ga0495596_0020106_83_2023 646
482 3300046506 Ga0495583_0025921 Ga0495583_0025921_811_2751 646
483 3300046511 Ga0495608_0047831 Ga0495608_0047831_187_2127 646
484 3300046512 Ga0495610_0000281 Ga0495610_0000281_32516_34456 646
485 3300046514 Ga0495618_0013425 Ga0495618_0013425_267_2207 646
486 3300046517 Ga0495630_0028013 Ga0495630_0028013_1722_3662 646
487 3300046524 Ga0495648_0016830 Ga0495648_0016830_1686_3626 646
488 3300046526 Ga0495666_0014713 Ga0495666_0014713_434_2374 646
489 3300046526 Ga0495666_0037183 Ga0495666_0037183_156_2096 646
490 3300046529 Ga0495652_0020129 Ga0495652_0020129_434_2374 646
491 3300046533 Ga0495640_0019199 Ga0495640_0019199_2444_4384 646
492 3300046533 Ga0495640_0047811 Ga0495640_0047811_703_2643 646
493 3300046535 Ga0495586_0004610 Ga0495586_0004610_1622_3562 646
494 3300046536 Ga0495587_0000694 Ga0495587_0000694_279_2219 646
495 3300046536 Ga0495587_0019291 Ga0495587_0019291_705_2645 646
496 3300046557 Ga0495622_0000005 Ga0495622_0000005_221264_223204 646
497 3300046642 Ga0495634_0017391 Ga0495634_0017391_703_2643 646
498 3300046663 Ga0495635_0001935 Ga0495635_0001935_6290_8230 646
499 3300046665 Ga0495661_0005081 Ga0495661_0005081_5642_7582 646
500 3300046665 Ga0495661_0009148 Ga0495661_0009148_2351_4291 646
501 3300046679 Ga0495623_0002243 Ga0495623_0002243_10292_12232 646
502 3300046679 Ga0495623_0021488 Ga0495623_0021488_1943_3883 646
503 3300046680 Ga0495646_0007239 Ga0495646_0007239_2114_4054 646
504 3300046680 Ga0495646_0008792 Ga0495646_0008792_665_2605 646
505 3300046680 Ga0495646_0021651 Ga0495646_0021651_1391_3331 646
506 3300046680 Ga0495646_0038308 Ga0495646_0038308_703_2643 646
507 3300046689 Ga0495613_0013514 Ga0495613_0013514_1594_3534 646
508 3300046794 Ga0495589_0004355 Ga0495589_0004355_1321_3261 646
509 3300046809 Ga0495600_0047319 Ga0495600_0047319_283_2223 646
510 3300047315 Ga0495581_0002671 Ga0495581_0002671_1455_3395 646
511 3300047315 Ga0495581_0003725 Ga0495581_0003725_6205_8145 646
512 3300047317 Ga0495604_0004557 Ga0495604_0004557_889_2835 646
513 3300047317 Ga0495604_0023731 Ga0495604_0023731_2526_4466 646
514 3300047317 Ga0495604_0049586 Ga0495604_0049586_258_2198 646
515 3300047319 Ga0495674_0005812 Ga0495674_0005812_8552_10492 646
516 3300047319 Ga0495674_0063839 Ga0495674_0063839_704_2644 646
517 3300047321 Ga0495676_0002760 Ga0495676_0002760_2067_4007 646
518 3300047321 Ga0495676_0047894 Ga0495676_0047894_708_2648 646
519 3300047322 Ga0495680_0011095 Ga0495680_0011095_5123_7063 646
520 3300047322 Ga0495680_0049568 Ga0495680_0049568_724_2664 646
521 3300047323 Ga0495683_0005835 Ga0495683_0005835_2287_4227 646
522 3300047323 Ga0495683_0014177 Ga0495683_0014177_636_2576 646
523 3300047443 Ga0495687_012742 Ga0495687_012742_2282_4222 646
524 3300047446 Ga0495679_000009 Ga0495679_000009_84344_86284 646
525 3300047446 Ga0495679_000441 Ga0495679_000441_15582_17522 646
526 3300047673 Ga0495593_0003975 Ga0495593_0003975_6039_7979 646
527 3300047673 Ga0495593_0014700 Ga0495593_0014700_1083_3023 646
528 3300048088 Ga0495602_0040709 Ga0495602_0040709_1397_3343 646
529 3300048089 Ga0495614_0007893 Ga0495614_0007893_860_2800 646
530 3300048089 Ga0495614_0010468 Ga0495614_0010468_1602_3542 646
531 3300048091 Ga0495626_0009067 Ga0495626_0009067_988_2928 646
532 3300048905 Ga0496102_0061085 Ga0496102_0061085_646_2586 646
533 3300048921 Ga0496118_0004307 Ga0496118_0004307_11485_13425 646
534 3300048921 Ga0496118_0018181 Ga0496118_0018181_2879_4822 646
535 3300048921 Ga0496118_0026995 Ga0496118_0026995_2154_4094 646
536 3300048929 Ga0496126_0065366 Ga0496126_0065366_667_2607 646
537 3300049459 Ga0495678_009105 Ga0495678_009105_770_2710 646
538 3300050496 nmdc:mga07m45_6646_c1 nmdc:mga07m45_6646_c1_2065_4065 646
539 3300061719 Ga0466962_0004679 Ga0466962_0004679_1813_3759 646
540 3300032004 Ga0307414_10029744 Ga0307414_100297442 647
541 3300006028 Ga0070717_10067438 Ga0070717_100674382 648
542 3300025928 Ga0207700_10006451 Ga0207700_100064511 648
543 3300039437 Ga0436365_1778650 Ga0436365_1778650_3157_5169 648
544 3300003322 rootL2_10089094 rootL2_100890942 649
545 3300005327 Ga0070658_10007667 Ga0070658_100076677 649
546 3300005339 Ga0070660_100002295 Ga0070660_10000229514 649
547 3300013104 Ga0157370_10008952 Ga0157370_100089528 649
548 3300013296 Ga0157374_10000081 Ga0157374_1000008115 649
549 3300013307 Ga0157372_10011733 Ga0157372_1001173311 649
550 3300025295 Ga0209564_1006152 Ga0209564_10061522 649
551 3300025904 Ga0207647_10000738 Ga0207647_1000073814 649
552 3300025919 Ga0207657_10001423 Ga0207657_100014237 649
553 3300025949 Ga0207667_10178104 Ga0207667_101781041 649
554 3300039447 Ga0436361_0103401 Ga0436361_0103401_1078_3030 649
555 3300005366 Ga0070659_100029877 Ga0070659_1000298772 650
556 3300005563 Ga0068855_100012721 Ga0068855_1000127218 650
557 3300013104 Ga0157370_10001255 Ga0157370_1000125525 650
558 3300025228 Ga0209672_100188 Ga0209672_10018837 650
559 3300025909 Ga0207705_10002965 Ga0207705_100029654 650
560 3300037466 Ga0395898_0013119 Ga0395898_0013119_663_2624 650
561 3300046455 Ga0495603_0024688 Ga0495603_0024688_1170_3167 650
562 3300046472 Ga0495580_0035988 Ga0495580_0035988_1365_3362 650
563 3300046506 Ga0495583_0002590 Ga0495583_0002590_12509_14506 650
564 3300047323 Ga0495683_0012385 Ga0495683_0012385_2115_4112 650
565 3300045836 Ga0466958_0010650 Ga0466958_0010650_761_2770 651
566 iso_pu_bacteria 2551306416 2553006115 651
567 iso_pu_bacteria 2765235838 2765567742 651
568 iso_pu_bacteria 2818991449 2819617372 651
569 iso_pu_bacteria 2839094727 2839099694 651
570 iso_pu_bacteria 2856287931 2856288730 651
571 iso_pu_bacteria 2857357740 2857362113 651
572 iso_pu_bacteria 2904439833 2904442383 651
573 iso_pu_bacteria 2904530477 2904533654 651
574 iso_pu_bacteria 2904584206 2904586609 651
575 iso_pu_bacteria 2904589729 2904591577 651
576 iso_pu_bacteria 2904601388 2904602284 651
577 iso_pu_bacteria 2919046199 2919050638 651
578 iso_pu_bacteria 2919079590 2919083391 651
579 iso_pu_bacteria 2921643360 2921644638 651
580 iso_pu_bacteria 2928130867 2928133664 651
581 3300046454 Ga0495592_0013048 Ga0495592_0013048_2991_4958 652
582 3300046463 Ga0495653_0028644 Ga0495653_0028644_2376_4343 652
583 3300046516 Ga0495628_0018679 Ga0495628_0018679_1593_3647 652
584 3300046529 Ga0495652_0003552 Ga0495652_0003552_3377_5344 652
585 3300046678 Ga0495599_0004991 Ga0495599_0004991_4005_5972 652
586 3300046679 Ga0495623_0005170 Ga0495623_0005170_5268_7322 652
587 3300046680 Ga0495646_0003436 Ga0495646_0003436_6328_8295 652
588 3300046680 Ga0495646_0004216 Ga0495646_0004216_5166_7133 652
589 3300046690 Ga0495624_0009607 Ga0495624_0009607_1353_3320 652
590 3300047317 Ga0495604_0009575 Ga0495604_0009575_3373_5340 652
591 3300047320 Ga0495672_0000448 Ga0495672_0000448_27704_29677 652
592 3300048088 Ga0495602_0030094 Ga0495602_0030094_1133_3100 652
593 3300053077 Ga0495601_0003334 Ga0495601_0003334_4493_6460 652
594 iso_pu_bacteria 2519103095 2519460770 652
595 iso_pu_bacteria 2582581311 2585293663 652
596 iso_pu_bacteria 2816332253 2817259367 652
597 iso_pu_bacteria 2816332256 2817280221 652
598 iso_pu_bacteria 2816332286 2817456449 652
599 iso_pu_bacteria 8020807995 8020811994 652
600 iso_pu_bacteria 8040167225 8040168186 652
601 iso_pu_bacteria 8040173305 8040176027 652
602 3300005563 Ga0068855_100000609 Ga0068855_10000060925 653
603 3300005563 Ga0068855_100114189 Ga0068855_1001141892 653
604 3300025914 Ga0207671_10005525 Ga0207671_100055252 653
605 3300025924 Ga0207694_10000176 Ga0207694_1000017629 653
606 3300025949 Ga0207667_10000146 Ga0207667_1000014643 653
607 3300025949 Ga0207667_10006456 Ga0207667_1000645612 653
608 3300009177 Ga0105248_10081901 Ga0105248_100819012 654
609 iso_pu_bacteria 2510917013 2511090395 654
610 iso_pu_bacteria 2513237082 2513553710 654
611 iso_pu_bacteria 2513237083 2513560387 654
612 iso_pu_bacteria 2515154123 2515691137 654
613 iso_pu_bacteria 2515154189 2516017381 654
614 iso_pu_bacteria 2599185240 2599746231 654
615 iso_pu_bacteria 2599185355 2600207935 654
616 iso_pu_bacteria 2675903129 2676743822 654
617 iso_pu_bacteria 2870068957 2870074069 654
618 iso_pu_bacteria 8020945358 8020949969 654
619 iso_pu_bacteria 8039098773 8039103234 654
620 3300003751 Ga0055538_1000051 Ga0055538_100005121 655
621 3300003752 Ga0055539_1000076 Ga0055539_100007621 655
622 3300003756 Ga0055533_1000082 Ga0055533_100008221 655
623 3300003759 Ga0055525_1000109 Ga0055525_100010921 655
624 3300003841 Ga0055541_1000053 Ga0055541_100005321 655
625 3300005327 Ga0070658_10005321 Ga0070658_100053215 655
626 3300005339 Ga0070660_100010780 Ga0070660_1000107801 655
627 3300005563 Ga0068855_100007225 Ga0068855_1000072259 655
628 3300013104 Ga0157370_10027029 Ga0157370_100270294 655
629 3300021361 Ga0213872_10000980 Ga0213872_1000098013 655
630 3300025224 Ga0209784_100083 Ga0209784_10008323 655
631 3300025225 Ga0209566_100102 Ga0209566_10010223 655
632 3300025226 Ga0209674_100125 Ga0209674_10012523 655
633 3300025230 Ga0209563_100120 Ga0209563_10012023 655
634 3300025253 Ga0209677_100076 Ga0209677_10007623 655
635 3300025909 Ga0207705_10002181 Ga0207705_1000218110 655
636 3300025949 Ga0207667_10005456 Ga0207667_1000545612 655
637 3300037418 Ga0395900_0033419 Ga0395900_0033419_2136_4130 655
638 3300037418 Ga0395900_0127306 Ga0395900_0127306_450_2450 655
639 3300037466 Ga0395898_0005220 Ga0395898_0005220_7412_9406 655
640 3300037466 Ga0395898_0010074 Ga0395898_0010074_7270_9270 655
641 3300038443 Ga0395901_0000034 Ga0395901_0000034_52152_54146 655
642 3300038443 Ga0395901_0000752 Ga0395901_0000752_17157_19151 655
643 3300038443 Ga0395901_0001478 Ga0395901_0001478_5752_7752 655
644 3300044684 Ga0466966_0000037 Ga0466966_0000037_88145_90184 655
645 3300044684 Ga0466966_0003607 Ga0466966_0003607_3146_5140 655
646 3300044694 Ga0466963_0011156 Ga0466963_0011156_2723_4717 655
647 3300061719 Ga0466962_0002922 Ga0466962_0002922_3373_5367 655
648 iso_pu_bacteria 2510065045 2510248882 655
649 iso_pu_bacteria 2512047030 2512348965 655
650 iso_pu_bacteria 2515154122 2515680390 655
651 iso_pu_bacteria 2718217991 2719642695 655
652 iso_pu_bacteria 2885270888 2885278578 655
653 iso_pu_bacteria 2902682994 2902687865 655
654 iso_pu_bacteria 2513237166 2514046399 656
655 iso_pu_bacteria 2562617112 2563062030 656
656 iso_pu_bacteria 2599185239 2599736375 656
657 iso_pu_bacteria 2711768613 2713478132 656
658 iso_pu_bacteria 2791355137 2792839584 656
659 iso_pu_bacteria 2808606384 2808973091 656
660 iso_pu_bacteria 2808606390 2809008081 656
661 iso_pu_bacteria 2808606391 2809014884 656
662 iso_pu_bacteria 2818991452 2819634192 656
663 iso_pu_bacteria 2863421361 2863423998 656
664 iso_pu_bacteria 2900634093 2900638337 656
665 iso_pu_bacteria 2904564687 2904570307 656
666 iso_pu_bacteria 2904571731 2904577450 656
667 iso_pu_bacteria 2904615490 2904618755 656
668 iso_pu_bacteria 2928157003 2928160945 656
669 iso_pu_bacteria 2928163908 2928170393 656
670 iso_pu_bacteria 2928170801 2928171210 656
671 iso_pu_bacteria 2928536128 2928536435 656
672 iso_pu_bacteria 2981990288 2981991399 656
673 iso_pu_bacteria 641736154 642420506 656
674 iso_pu_bacteria 642555112 642594143 656
675 iso_pu_bacteria 642555113 642615675 656
676 iso_pu_bacteria 8018845410 8018849316 656
677 iso_pu_bacteria 8020938398 8020938430 656
678 iso_pu_bacteria 8020953355 8020957173 656
679 iso_pu_bacteria 8021120328 8021123345 656
680 iso_pu_bacteria 2508501125 2509130477 657
681 iso_pu_bacteria 2513237151 2513958527 657
682 iso_pu_bacteria 2526164713 2527077468 657
683 iso_pu_bacteria 2600255067 2600810648 657
684 iso_pu_bacteria 2738541296 2738822576 657
685 iso_pu_bacteria 2738541298 2738834783 657
686 iso_pu_bacteria 2738541306 2738876262 657
687 iso_pu_bacteria 2738543002 2739188206 657
688 iso_pu_bacteria 2738543008 2739222859 657
689 iso_pu_bacteria 2744054900 2746085141 657
690 iso_pu_bacteria 2744054901 2746095046 657
691 iso_pu_bacteria 2751185846 2753568651 657
692 iso_pu_bacteria 2818991450 2819618941 657
693 iso_pu_bacteria 2842324504 2842329573 657
694 iso_pu_bacteria 2842348783 2842354328 657
695 iso_pu_bacteria 2904483920 2904488931 657
696 iso_pu_bacteria 2919527303 2919529540 657
697 iso_pu_bacteria 2928108538 2928113980 657
698 iso_pu_bacteria 2928135762 2928141356 657
699 iso_pu_bacteria 2928503688 2928509466 657
700 iso_pu_bacteria 2945934425 2945940123 657
701 iso_pu_bacteria 2990703756 2990707245 657
702 iso_pu_bacteria 641736151 642424201 657
703 iso_pu_bacteria 8055266321 8055269246 657
704 iso_pu_bacteria 8055301274 8055303564 657
705 3300009093 Ga0105240_10010014 Ga0105240_100100142 658
706 3300025913 Ga0207695_10000527 Ga0207695_1000052750 658
707 3300044684 Ga0466966_0059869 Ga0466966_0059869_40_2022 658
708 iso_pu_bacteria 2501025502 2501084962 658
709 iso_pu_bacteria 2883087390 2883087455 658
710 iso_pu_bacteria 8003955200 8003958012 658
711 3300002705 JGI25156J39149_1000803 JGI25156J39149_100080313 660
712 3300003354 JGI25160J50197_1000202 JGI25160J50197_100020235 660
713 3300003758 Ga0055532_1000695 Ga0055532_10006952 660
714 3300005262 Ga0065165_1001937 Ga0065165_10019374 660
715 3300005455 Ga0070663_100000095 Ga0070663_1000000954 660
716 3300016635 Ga0183361_10030 Ga0183361_1003049 660
717 3300025225 Ga0209566_100187 Ga0209566_1001877 660
718 3300025229 Ga0209147_100116 Ga0209147_10011642 660
719 3300025256 Ga0209759_1000052 Ga0209759_100005223 660
720 3300025284 Ga0209130_1005609 Ga0209130_10056093 660
721 3300025302 Ga0207426_1000037 Ga0207426_1000037310 660
722 3300026067 Ga0207678_10000275 Ga0207678_1000027510 660
723 3300048929 Ga0496126_0000679 Ga0496126_0000679_6686_8680 660
724 3300001979 JGI24740J21852_10000879 JGI24740J21852_100008795 661
725 3300002075 JGI24738J21930_10001967 JGI24738J21930_100019673 661
726 3300002705 JGI25156J39149_1000664 JGI25156J39149_10006648 661
727 3300003214 JGI25165J46597_1001095 JGI25165J46597_10010958 661
728 3300003316 rootH1_10106775 rootH1_101067752 661
729 3300003756 Ga0055533_1000226 Ga0055533_10002262 661
730 3300003758 Ga0055532_1000007 Ga0055532_1000007264 661
731 3300003760 Ga0055527_1000007 Ga0055527_1000007142 661
732 3300003761 Ga0055535_1000005 Ga0055535_1000005264 661
733 3300003762 Ga0055542_1000008 Ga0055542_1000008264 661
734 3300003763 Ga0055529_1000005 Ga0055529_1000005264 661
735 3300005339 Ga0070660_100000472 Ga0070660_10000047219 661
736 3300005563 Ga0068855_100021327 Ga0068855_1000213273 661
737 3300009093 Ga0105240_10007311 Ga0105240_100073119 661
738 3300009545 Ga0105237_10009788 Ga0105237_100097882 661
739 3300010375 Ga0105239_10005183 Ga0105239_100051835 661
740 3300013104 Ga0157370_10004570 Ga0157370_100045708 661
741 3300013105 Ga0157369_10007759 Ga0157369_100077593 661
742 3300013296 Ga0157374_10000390 Ga0157374_1000039012 661
743 3300013307 Ga0157372_10010494 Ga0157372_100104943 661
744 3300025226 Ga0209674_100020 Ga0209674_100020285 661
745 3300025226 Ga0209674_100029 Ga0209674_100029103 661
746 3300025228 Ga0209672_100013 Ga0209672_100013399 661
747 3300025228 Ga0209672_100132 Ga0209672_10013251 661
748 3300025229 Ga0209147_100013 Ga0209147_100013275 661
749 3300025231 Ga0207427_100684 Ga0207427_1006843 661
750 3300025242 Ga0209258_100016 Ga0209258_100016399 661
751 3300025254 Ga0209148_1000020 Ga0209148_1000020399 661
752 3300025256 Ga0209759_1000008 Ga0209759_1000008264 661
753 3300025256 Ga0209759_1000022 Ga0209759_1000022173 661
754 3300025256 Ga0209759_1003227 Ga0209759_10032272 661
755 3300025261 Ga0209233_1000055 Ga0209233_1000055138 661
756 3300025272 Ga0209455_1000017 Ga0209455_1000017399 661
757 3300025735 Ga0207713_1000401 Ga0207713_100040114 661
758 3300025904 Ga0207647_10000452 Ga0207647_1000045220 661
759 3300025904 Ga0207647_10020962 Ga0207647_100209622 661
760 3300025913 Ga0207695_10006928 Ga0207695_100069289 661
761 3300025919 Ga0207657_10000472 Ga0207657_1000047239 661
762 3300025949 Ga0207667_10004857 Ga0207667_100048572 661
763 3300031548 Ga0307408_100005877 Ga0307408_1000058774 661
764 3300031911 Ga0307412_10000082 Ga0307412_1000008226 661
765 3300037466 Ga0395898_0053822 Ga0395898_0053822_521_2512 661
766 3300038443 Ga0395901_0104493 Ga0395901_0104493_660_2651 661
767 3300042005 Ga0439448_0000050 Ga0439448_0000050_15438_17429 661
768 3300046514 Ga0495618_0048565 Ga0495618_0048565_584_2569 661
769 3300046694 Ga0495649_0005620 Ga0495649_0005620_3337_5322 661
770 3300047323 Ga0495683_0004484 Ga0495683_0004484_4978_6963 661
771 3300048906 Ga0496103_0014918 Ga0496103_0014918_1950_3935 661
772 3300048921 Ga0496118_0000234 Ga0496118_0000234_13107_15092 661

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02449

Glyco_hydro_42

Beta-galactosidase

6

391

0.96

PF08532

Glyco_hydro_42M

Beta-galactosidase trimerisation domain

404

606

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kwg-assembly1.cif.gz_A crystal structure of thermus thermophilus a4 beta-galactosidase 0.9769 3 660
1kwg-assembly1.cif.gz_A crystal structure of thermus thermophilus a4 beta-galactosidase 0.9739 3 660
6y2k-assembly1.cif.gz_A crystal structure of beta-galactosidase from the psychrophilic marinomonas ef1 0.966 1 661
6y2k-assembly1.cif.gz_A crystal structure of beta-galactosidase from the psychrophilic marinomonas ef1 0.9645 1 661
6lvw-assembly1.cif.gz_A polyextremophilic beta-galactosidase from the antarctic haloarchaeon halorubrum lacusprofundi 0.942 1 660
ID Description Score Start End Superfamily
1kwkA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9885 3 391 3.20.20.80
1kwkA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9736 3 391 3.20.20.80
1kwkA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9539 401 610 3.40.50.880
1kwkA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9493 401 610 3.40.50.880
3ttyF01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9293 1 391 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A848Z841-F1-model_v4 Beta-galactosidase 1.006 3 70 GO:0004565
GO:0005975
GO:0009341
AF-A0A430R3N2-F1-model_v4 Beta-galactosidase 0.9996 3 90 GO:0004565
GO:0005975
GO:0009341
AF-A0A3D2F6L5-F1-model_v4 Beta-galactosidase 0.9996 1 76 GO:0004565
GO:0005975
GO:0009341
AF-A0A7C1NRD1-F1-model_v4 Beta-galactosidase 0.9946 3 132 GO:0004565
GO:0005975
GO:0009341
AF-A0A365VP43-F1-model_v4 deleted 0.9933 113 274

Feature Viewer

pLDDT pTM Quality
94.26 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map