F480119
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 772 | 241 | 771 | 441 |
Family's Representative Sequence
| Representative Sequence | 3300025945|Ga0207679_10005163|Ga0207679_100051634 |
| Length | 492 |
| Sequence | LKPKAAIPFFYVIAFCLKHMRQTKVFSGFFKLQIALPSSTIPHMKKIVLLLCMSAVLVACKQNDYKKIVHDPALFSNTVHELNQVVMGNNFSPIVGSRNYLYASVAAYEVIAAGYPEQYNSLAGQLNGLKVIPKPASNTAIDFEFAALLAYCKLGEAVTFPEGSMKDYVDSIKMMAKDHGMPSDIFENSVRYSDTVSSVVMAWSKKDNYAQTRSATKYTVTDFEGRWIPTPPAYTSAMEPHWSEIRTLVMDSANQFPAPPPYQYNMKDSNSAYCKEVMKIKTAVENLSDEQKHIADFWDDNPFKLNVSGHIMYATKKFSPPGHWESIVGIAAKKANADFATTVYAYAKTSIALFDAFIQCWNAKYTYNSARPETVINKTLDMEWRPYLQTPPFPEYTCGHSTCSSAAAEALTSVFGDNFSYTDTTELEFGIKSRSYKSFRHAADENNWARFYGGIHFHRSCIVSTELGRKVGELVVSKLKMKKNELTATVTN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 103 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 159 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 160 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 161 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 162 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 163 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 164 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 165 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 166 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 167 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 168 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 169 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 171 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 172 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 173 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 174 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 175 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 176 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 177 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 178 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 179 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 180 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 181 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 182 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 183 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 184 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 185 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 186 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 187 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 188 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 189 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 211 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 230 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 235 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 236 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 237 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 238 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 239 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 240 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 241 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.42 |
| Nodule | 0 |
| Rhizoplane | 0.26 |
| Rhizosphere | 94.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10000975 | 3300002459 | Bacteria | 6294 |
| 2 | JGI25406J46586_10022917 | 3300003203 | Bacteria | 2477 |
| 3 | rootH1_10045334 | 3300003316 | Bacteria | 10678 |
| 4 | rootH1_10147241 | 3300003316 | Bacteria | 2066 |
| 5 | rootH1_10147241 | 3300003323 | Bacteria | 1721 |
| 6 | rootH2_10001891 | 3300003320 | Bacteria | 464318 |
| 7 | rootH2_10053878 | 3300003320 | Bacteria | 12446 |
| 8 | rootH2_10206634 | 3300003320 | Bacteria | 2902 |
| 9 | rootH2_10218880 | 3300003320 | Unclassified | 4487 |
| 10 | rootL2_10037862 | 3300003322 | Bacteria | 5180 |
| 11 | rootL2_10039747 | 3300003322 | Bacteria | 3431 |
| 12 | rootL2_10067458 | 3300003322 | Bacteria | 3923 |
| 13 | rootH1_10016444 | 3300003323 | Bacteria | 2383 |
| 14 | rootH1_10031468 | 3300003323 | Bacteria | 2927 |
| 15 | rootH1_10278369 | 3300003323 | Bacteria | 1923 |
| 16 | Ga0065714_10070154 | 3300005288 | Bacteria | 3955 |
| 17 | Ga0065712_10011412 | 3300005290 | Bacteria | 2614 |
| 18 | Ga0065712_10014996 | 3300005290 | Bacteria | 2784 |
| 19 | Ga0065712_10090253 | 3300005290 | Unclassified | 2429 |
| 20 | Ga0065715_10158521 | 3300005293 | Unclassified | 1652 |
| 21 | Ga0065707_10006808 | 3300005295 | Bacteria | 2677 |
| 22 | Ga0070658_10000027 | 3300005327 | Bacteria | 164254 |
| 23 | Ga0070658_10001676 | 3300005327 | Bacteria | 18699 |
| 24 | Ga0070658_10020971 | 3300005327 | Bacteria | 5235 |
| 25 | Ga0070658_10026391 | 3300005327 | Bacteria | 4659 |
| 26 | Ga0070658_10183672 | 3300005327 | Archaea | 1760 |
| 27 | Ga0070676_10004075 | 3300005328 | Bacteria | 7682 |
| 28 | Ga0070676_10028857 | 3300005328 | Unclassified | 3153 |
| 29 | Ga0070676_10051846 | 3300005328 | Bacteria | 2410 |
| 30 | Ga0070683_100004423 | 3300005329 | Bacteria | 11587 |
| 31 | Ga0070683_100013392 | 3300005329 | Bacteria | 7152 |
| 32 | Ga0070683_100047781 | 3300005329 | Bacteria | 3955 |
| 33 | Ga0070690_100017469 | 3300005330 | Bacteria | 4314 |
| 34 | Ga0070690_100025347 | 3300005330 | Bacteria | 3652 |
| 35 | Ga0070690_100083218 | 3300005330 | Bacteria | 2096 |
| 36 | Ga0070670_100024231 | 3300005331 | Bacteria | 5220 |
| 37 | Ga0070670_100039614 | 3300005331 | Bacteria | 4052 |
| 38 | Ga0070670_100067995 | 3300005331 | Unclassified | 3057 |
| 39 | Ga0070670_100074745 | 3300005331 | Unclassified | 2911 |
| 40 | Ga0070670_100128486 | 3300005331 | Bacteria | 2187 |
| 41 | Ga0068869_100001574 | 3300005334 | Bacteria | 13563 |
| 42 | Ga0068869_100012466 | 3300005334 | Bacteria | 5619 |
| 43 | Ga0068869_100014525 | 3300005334 | Bacteria | 5262 |
| 44 | Ga0068869_100015579 | 3300005334 | Bacteria | 5105 |
| 45 | Ga0068869_100046810 | 3300005334 | Bacteria | 3120 |
| 46 | Ga0068869_100073718 | 3300005334 | Bacteria | 2532 |
| 47 | Ga0070666_10000050 | 3300005335 | Bacteria | 100280 |
| 48 | Ga0070666_10005046 | 3300005335 | Bacteria | 8074 |
| 49 | Ga0070666_10041186 | 3300005335 | Bacteria | 3085 |
| 50 | Ga0070666_10054122 | 3300005335 | Bacteria | 2707 |
| 51 | Ga0070666_10077082 | 3300005335 | Bacteria | 2275 |
| 52 | Ga0070666_10106974 | 3300005335 | Unclassified | 1932 |
| 53 | Ga0070680_100000819 | 3300005336 | Bacteria | 21946 |
| 54 | Ga0070680_100041824 | 3300005336 | Unclassified | 3716 |
| 55 | Ga0070682_100020371 | 3300005337 | Bacteria | 3901 |
| 56 | Ga0068868_100000112 | 3300005338 | Bacteria | 50817 |
| 57 | Ga0068868_100005340 | 3300005338 | Bacteria | 9020 |
| 58 | Ga0068868_100034697 | 3300005338 | Bacteria | 3896 |
| 59 | Ga0068868_100054875 | 3300005338 | Bacteria | 3142 |
| 60 | Ga0068868_100075038 | 3300005338 | Bacteria | 2702 |
| 61 | Ga0070660_100020983 | 3300005339 | Bacteria | 4809 |
| 62 | Ga0070660_100070028 | 3300005339 | Bacteria | 2736 |
| 63 | Ga0070691_10018505 | 3300005341 | Bacteria | 3212 |
| 64 | Ga0070687_100029446 | 3300005343 | Bacteria | 2674 |
| 65 | Ga0070687_100058780 | 3300005343 | Bacteria | 2022 |
| 66 | Ga0070661_100024118 | 3300005344 | Bacteria | 4363 |
| 67 | Ga0070661_100053610 | 3300005344 | Bacteria | 2952 |
| 68 | Ga0070668_100000110 | 3300005347 | Bacteria | 50766 |
| 69 | Ga0070668_100074075 | 3300005347 | Bacteria | 2655 |
| 70 | Ga0070669_100051338 | 3300005353 | Bacteria | 3014 |
| 71 | Ga0070669_100139037 | 3300005353 | Bacteria | 1871 |
| 72 | Ga0070675_100051952 | 3300005354 | Bacteria | 3369 |
| 73 | Ga0070675_100096490 | 3300005354 | Unclassified | 2484 |
| 74 | Ga0070675_100126483 | 3300005354 | Unclassified | 2175 |
| 75 | Ga0070675_100151212 | 3300005354 | Bacteria | 1991 |
| 76 | Ga0070675_100165213 | 3300005354 | Unclassified | 1906 |
| 77 | Ga0070671_100011381 | 3300005355 | Bacteria | 7152 |
| 78 | Ga0070671_100016026 | 3300005355 | Bacteria | 6056 |
| 79 | Ga0070671_100083476 | 3300005355 | Bacteria | 2671 |
| 80 | Ga0070671_100106419 | 3300005355 | Unclassified | 2355 |
| 81 | Ga0070671_100145952 | 3300005355 | Bacteria | 1997 |
| 82 | Ga0070671_100164925 | 3300005355 | Bacteria | 1873 |
| 83 | Ga0070674_100018171 | 3300005356 | Bacteria | 4440 |
| 84 | Ga0070674_100034724 | 3300005356 | Unclassified | 3371 |
| 85 | Ga0070673_100000305 | 3300005364 | Bacteria | 25760 |
| 86 | Ga0070673_100000400 | 3300005364 | Bacteria | 22985 |
| 87 | Ga0070673_100046985 | 3300005364 | Bacteria | 3356 |
| 88 | Ga0070673_100056895 | 3300005364 | Bacteria | 3087 |
| 89 | Ga0070688_100059224 | 3300005365 | Bacteria | 2414 |
| 90 | Ga0070688_100082487 | 3300005365 | Bacteria | 2084 |
| 91 | Ga0070659_100176527 | 3300005366 | Bacteria | 1752 |
| 92 | Ga0070667_100013900 | 3300005367 | Bacteria | 6655 |
| 93 | Ga0070667_100016746 | 3300005367 | Bacteria | 6066 |
| 94 | Ga0070667_100043490 | 3300005367 | Bacteria | 3770 |
| 95 | Ga0070667_100053128 | 3300005367 | Bacteria | 3419 |
| 96 | Ga0070667_100091034 | 3300005367 | Unclassified | 2622 |
| 97 | Ga0070667_100149431 | 3300005367 | Bacteria | 2051 |
| 98 | Ga0070701_10048654 | 3300005438 | Unclassified | 2189 |
| 99 | Ga0070700_100074008 | 3300005441 | Unclassified | 2182 |
| 100 | Ga0070663_100015831 | 3300005455 | Bacteria | 4879 |
| 101 | Ga0070678_100007009 | 3300005456 | Bacteria | 6659 |
| 102 | Ga0070678_100013581 | 3300005456 | Bacteria | 5113 |
| 103 | Ga0070678_100023647 | 3300005456 | Bacteria | 4099 |
| 104 | Ga0070678_100103501 | 3300005456 | Bacteria | 2212 |
| 105 | Ga0070662_100000045 | 3300005457 | Bacteria | 67900 |
| 106 | Ga0070662_100027999 | 3300005457 | Bacteria | 3919 |
| 107 | Ga0070662_100042465 | 3300005457 | Bacteria | 3247 |
| 108 | Ga0070681_10015844 | 3300005458 | Bacteria | 7515 |
| 109 | Ga0070681_10030115 | 3300005458 | Bacteria | 5445 |
| 110 | Ga0070681_10038082 | 3300005458 | Bacteria | 4822 |
| 111 | Ga0070681_10047701 | 3300005458 | Bacteria | 4282 |
| 112 | Ga0070681_10176847 | 3300005458 | Bacteria | 2056 |
| 113 | Ga0068867_100000519 | 3300005459 | Bacteria | 25675 |
| 114 | Ga0068867_100000620 | 3300005459 | Bacteria | 23485 |
| 115 | Ga0068867_100045251 | 3300005459 | Unclassified | 3227 |
| 116 | Ga0068867_100048127 | 3300005459 | Bacteria | 3136 |
| 117 | Ga0068867_100053273 | 3300005459 | Bacteria | 2988 |
| 118 | Ga0068867_100065844 | 3300005459 | Bacteria | 2698 |
| 119 | Ga0068867_100069205 | 3300005459 | Bacteria | 2636 |
| 120 | Ga0068867_100213403 | 3300005459 | Bacteria | 1551 |
| 121 | Ga0070698_100000261 | 3300005471 | Bacteria | 53090 |
| 122 | Ga0070698_100002003 | 3300005471 | Bacteria | 22611 |
| 123 | Ga0070698_100003063 | 3300005471 | Bacteria | 18436 |
| 124 | Ga0070679_100012671 | 3300005530 | Bacteria | 8065 |
| 125 | Ga0070679_100093594 | 3300005530 | Unclassified | 2992 |
| 126 | Ga0070679_100136714 | 3300005530 | Bacteria | 2432 |
| 127 | Ga0070679_100142523 | 3300005530 | Bacteria | 2375 |
| 128 | Ga0070684_100025867 | 3300005535 | Bacteria | 4938 |
| 129 | Ga0070684_100037004 | 3300005535 | Bacteria | 4184 |
| 130 | Ga0070684_100139871 | 3300005535 | Bacteria | 2188 |
| 131 | Ga0068853_100001722 | 3300005539 | Bacteria | 16023 |
| 132 | Ga0068853_100003764 | 3300005539 | Bacteria | 11637 |
| 133 | Ga0068853_100012711 | 3300005539 | Bacteria | 6855 |
| 134 | Ga0068853_100023333 | 3300005539 | Bacteria | 5178 |
| 135 | Ga0068853_100072551 | 3300005539 | Unclassified | 3000 |
| 136 | Ga0068853_100120197 | 3300005539 | Unclassified | 2342 |
| 137 | Ga0070672_100000020 | 3300005543 | Bacteria | 69277 |
| 138 | Ga0070672_100051207 | 3300005543 | Bacteria | 3219 |
| 139 | Ga0070672_100151274 | 3300005543 | Bacteria | 1920 |
| 140 | Ga0070686_100014929 | 3300005544 | Bacteria | 4486 |
| 141 | Ga0070686_100054756 | 3300005544 | Unclassified | 2553 |
| 142 | Ga0070693_100032663 | 3300005547 | Bacteria | 2864 |
| 143 | Ga0070693_100046893 | 3300005547 | Bacteria | 2456 |
| 144 | Ga0070665_100000014 | 3300005548 | Bacteria | 484881 |
| 145 | Ga0070665_100000020 | 3300005548 | Bacteria | 389687 |
| 146 | Ga0070665_100000318 | 3300005548 | Bacteria | 74326 |
| 147 | Ga0070704_100149514 | 3300005549 | Bacteria | 1834 |
| 148 | Ga0068855_100000033 | 3300005563 | Bacteria | 167299 |
| 149 | Ga0068855_100000556 | 3300005563 | Bacteria | 45792 |
| 150 | Ga0068855_100001120 | 3300005563 | Bacteria | 33311 |
| 151 | Ga0068855_100019483 | 3300005563 | Bacteria | 8153 |
| 152 | Ga0068855_100040797 | 3300005563 | Bacteria | 5506 |
| 153 | Ga0068855_100064607 | 3300005563 | Bacteria | 4268 |
| 154 | Ga0068855_100078973 | 3300005563 | Bacteria | 3817 |
| 155 | Ga0068855_100110113 | 3300005563 | Bacteria | 3162 |
| 156 | Ga0068855_100132637 | 3300005563 | Bacteria | 2844 |
| 157 | Ga0068855_100156418 | 3300005563 | Bacteria | 2589 |
| 158 | Ga0070664_100029202 | 3300005564 | Bacteria | 4596 |
| 159 | Ga0070664_100058975 | 3300005564 | Bacteria | 3265 |
| 160 | Ga0070664_100072834 | 3300005564 | Bacteria | 2947 |
| 161 | Ga0070664_100141641 | 3300005564 | Bacteria | 2118 |
| 162 | Ga0070664_100237927 | 3300005564 | Bacteria | 1634 |
| 163 | Ga0068857_100003443 | 3300005577 | Bacteria | 13201 |
| 164 | Ga0068857_100033135 | 3300005577 | Bacteria | 4568 |
| 165 | Ga0068857_100035129 | 3300005577 | Unclassified | 4437 |
| 166 | Ga0068857_100105948 | 3300005577 | Bacteria | 2525 |
| 167 | Ga0068857_100112444 | 3300005577 | Unclassified | 2448 |
| 168 | Ga0068857_100260931 | 3300005577 | Bacteria | 1590 |
| 169 | Ga0068854_100006457 | 3300005578 | Bacteria | 7461 |
| 170 | Ga0068854_100034123 | 3300005578 | Bacteria | 3552 |
| 171 | Ga0068854_100049388 | 3300005578 | Bacteria | 3005 |
| 172 | Ga0068856_100000359 | 3300005614 | Bacteria | 49880 |
| 173 | Ga0068856_100013339 | 3300005614 | Bacteria | 7956 |
| 174 | Ga0068856_100025925 | 3300005614 | Bacteria | 5717 |
| 175 | Ga0068856_100027095 | 3300005614 | Bacteria | 5590 |
| 176 | Ga0068856_100081991 | 3300005614 | Bacteria | 3200 |
| 177 | Ga0068856_100124977 | 3300005614 | Unclassified | 2575 |
| 178 | Ga0068856_100133076 | 3300005614 | Unclassified | 2492 |
| 179 | Ga0068856_100165564 | 3300005614 | Bacteria | 2222 |
| 180 | Ga0068852_100001345 | 3300005616 | Bacteria | 16491 |
| 181 | Ga0068852_100005907 | 3300005616 | Bacteria | 8803 |
| 182 | Ga0068852_100009804 | 3300005616 | Bacteria | 7122 |
| 183 | Ga0068852_100010585 | 3300005616 | Bacteria | 6901 |
| 184 | Ga0068852_100020291 | 3300005616 | Bacteria | 5283 |
| 185 | Ga0068852_100033541 | 3300005616 | Bacteria | 4264 |
| 186 | Ga0068852_100075882 | 3300005616 | Bacteria | 2967 |
| 187 | Ga0068852_100151192 | 3300005616 | Bacteria | 2159 |
| 188 | Ga0068852_100180968 | 3300005616 | Bacteria | 1982 |
| 189 | Ga0068852_100188113 | 3300005616 | Bacteria | 1946 |
| 190 | Ga0068859_100000025 | 3300005617 | Bacteria | 191679 |
| 191 | Ga0068859_100082667 | 3300005617 | Bacteria | 3254 |
| 192 | Ga0068864_100000392 | 3300005618 | Bacteria | 38124 |
| 193 | Ga0068864_100027917 | 3300005618 | Bacteria | 4769 |
| 194 | Ga0068864_100030555 | 3300005618 | Bacteria | 4567 |
| 195 | Ga0068864_100096577 | 3300005618 | Bacteria | 2615 |
| 196 | Ga0068861_100007156 | 3300005719 | Bacteria | 7638 |
| 197 | Ga0068861_100009832 | 3300005719 | Bacteria | 6616 |
| 198 | Ga0068861_100040128 | 3300005719 | Bacteria | 3498 |
| 199 | Ga0068861_100133175 | 3300005719 | Bacteria | 2020 |
| 200 | Ga0068861_100147026 | 3300005719 | Bacteria | 1929 |
| 201 | Ga0068851_10006000 | 3300005834 | Bacteria | 5534 |
| 202 | Ga0068851_10057597 | 3300005834 | Bacteria | 1984 |
| 203 | Ga0068863_100002244 | 3300005841 | Bacteria | 19182 |
| 204 | Ga0068863_100007966 | 3300005841 | Bacteria | 10355 |
| 205 | Ga0068863_100011055 | 3300005841 | Bacteria | 8756 |
| 206 | Ga0068863_100016345 | 3300005841 | Bacteria | 7119 |
| 207 | Ga0068863_100062044 | 3300005841 | Bacteria | 3535 |
| 208 | Ga0068863_100199281 | 3300005841 | Bacteria | 1925 |
| 209 | Ga0068858_100000342 | 3300005842 | Bacteria | 49465 |
| 210 | Ga0068858_100061184 | 3300005842 | Bacteria | 3481 |
| 211 | Ga0068858_100197746 | 3300005842 | Unclassified | 1900 |
| 212 | Ga0068860_100000061 | 3300005843 | Bacteria | 192548 |
| 213 | Ga0068860_100001898 | 3300005843 | Bacteria | 22184 |
| 214 | Ga0068860_100002976 | 3300005843 | Bacteria | 17499 |
| 215 | Ga0068860_100003705 | 3300005843 | Bacteria | 15722 |
| 216 | Ga0068860_100004130 | 3300005843 | Bacteria | 14878 |
| 217 | Ga0068860_100007522 | 3300005843 | Bacteria | 10900 |
| 218 | Ga0068860_100008934 | 3300005843 | Bacteria | 9983 |
| 219 | Ga0068860_100021106 | 3300005843 | Bacteria | 6307 |
| 220 | Ga0068860_100045244 | 3300005843 | Bacteria | 4197 |
| 221 | Ga0068860_100067376 | 3300005843 | Bacteria | 3402 |
| 222 | Ga0068860_100130323 | 3300005843 | Bacteria | 2413 |
| 223 | Ga0068862_100014299 | 3300005844 | Bacteria | 6584 |
| 224 | Ga0068862_100114698 | 3300005844 | Bacteria | 2368 |
| 225 | Ga0068862_100168814 | 3300005844 | Bacteria | 1958 |
| 226 | Ga0068862_100183604 | 3300005844 | Bacteria | 1879 |
| 227 | Ga0081540_1025198 | 3300005983 | Unclassified | 3430 |
| 228 | Ga0081539_10003031 | 3300005985 | Bacteria | 21772 |
| 229 | Ga0081539_10011072 | 3300005985 | Bacteria | 7209 |
| 230 | Ga0075366_10000467 | 3300006195 | Bacteria | 18777 |
| 231 | Ga0075366_10024404 | 3300006195 | Unclassified | 3527 |
| 232 | Ga0097621_100003375 | 3300006237 | Bacteria | 10990 |
| 233 | Ga0097621_100004382 | 3300006237 | Bacteria | 9821 |
| 234 | Ga0097621_100005541 | 3300006237 | Bacteria | 8896 |
| 235 | Ga0097621_100008467 | 3300006237 | Bacteria | 7411 |
| 236 | Ga0097621_100017205 | 3300006237 | Bacteria | 5487 |
| 237 | Ga0097621_100030561 | 3300006237 | Bacteria | 4265 |
| 238 | Ga0097621_100051433 | 3300006237 | Bacteria | 3353 |
| 239 | Ga0097621_100068666 | 3300006237 | Bacteria | 2924 |
| 240 | Ga0068871_100000100 | 3300006358 | Bacteria | 51253 |
| 241 | Ga0068871_100001044 | 3300006358 | Bacteria | 18562 |
| 242 | Ga0068871_100002056 | 3300006358 | Bacteria | 13645 |
| 243 | Ga0068871_100005284 | 3300006358 | Bacteria | 9040 |
| 244 | Ga0068871_100010670 | 3300006358 | Bacteria | 6717 |
| 245 | Ga0068871_100014817 | 3300006358 | Bacteria | 5822 |
| 246 | Ga0068871_100078597 | 3300006358 | Bacteria | 2728 |
| 247 | Ga0068871_100086753 | 3300006358 | Unclassified | 2601 |
| 248 | Ga0075428_100028386 | 3300006844 | Bacteria | 6190 |
| 249 | Ga0075428_100078646 | 3300006844 | Bacteria | 3600 |
| 250 | Ga0075430_100002220 | 3300006846 | Bacteria | 16102 |
| 251 | Ga0075431_100000819 | 3300006847 | Bacteria | 27158 |
| 252 | Ga0075431_100097112 | 3300006847 | Bacteria | 3042 |
| 253 | Ga0075429_100023162 | 3300006880 | Bacteria | 5386 |
| 254 | Ga0075429_100112600 | 3300006880 | Unclassified | 2378 |
| 255 | Ga0075429_100131873 | 3300006880 | Unclassified | 2186 |
| 256 | Ga0068865_100000174 | 3300006881 | Bacteria | 35630 |
| 257 | Ga0068865_100004637 | 3300006881 | Bacteria | 8300 |
| 258 | Ga0068865_100012493 | 3300006881 | Bacteria | 5346 |
| 259 | Ga0097620_100000025 | 3300006931 | Bacteria | 191679 |
| 260 | Ga0097620_100082662 | 3300006931 | Bacteria | 3254 |
| 261 | Ga0105240_10000396 | 3300009093 | Bacteria | 81252 |
| 262 | Ga0105240_10000674 | 3300009093 | Bacteria | 62689 |
| 263 | Ga0105240_10000998 | 3300009093 | Bacteria | 50528 |
| 264 | Ga0105240_10001351 | 3300009093 | Bacteria | 42091 |
| 265 | Ga0105240_10004944 | 3300009093 | Bacteria | 20039 |
| 266 | Ga0105240_10009161 | 3300009093 | Bacteria | 14043 |
| 267 | Ga0105240_10013501 | 3300009093 | Bacteria | 11218 |
| 268 | Ga0105240_10014211 | 3300009093 | Bacteria | 10874 |
| 269 | Ga0105240_10020572 | 3300009093 | Bacteria | 8796 |
| 270 | Ga0105240_10022499 | 3300009093 | Bacteria | 8354 |
| 271 | Ga0105240_10029462 | 3300009093 | Bacteria | 7150 |
| 272 | Ga0105240_10061084 | 3300009093 | Unclassified | 4696 |
| 273 | Ga0105240_10182316 | 3300009093 | Bacteria | 2477 |
| 274 | Ga0105240_10188537 | 3300009093 | Bacteria | 2427 |
| 275 | Ga0105247_10001380 | 3300009101 | Bacteria | 17607 |
| 276 | Ga0105247_10015255 | 3300009101 | Unclassified | 4605 |
| 277 | Ga0114129_10067485 | 3300009147 | Bacteria | 4988 |
| 278 | Ga0114129_10104783 | 3300009147 | Bacteria | 3909 |
| 279 | Ga0114129_10300708 | 3300009147 | Unclassified | 2139 |
| 280 | Ga0105243_10021225 | 3300009148 | Bacteria | 4928 |
| 281 | Ga0105243_10082364 | 3300009148 | Unclassified | 2630 |
| 282 | Ga0105243_10148018 | 3300009148 | Bacteria | 2011 |
| 283 | Ga0105243_10235633 | 3300009148 | Bacteria | 1626 |
| 284 | Ga0105241_10000299 | 3300009174 | Bacteria | 37072 |
| 285 | Ga0105241_10000688 | 3300009174 | Bacteria | 25457 |
| 286 | Ga0105241_10000761 | 3300009174 | Bacteria | 24490 |
| 287 | Ga0105241_10000796 | 3300009174 | Bacteria | 23959 |
| 288 | Ga0105241_10001899 | 3300009174 | Bacteria | 15819 |
| 289 | Ga0105241_10007361 | 3300009174 | Bacteria | 8098 |
| 290 | Ga0105241_10237770 | 3300009174 | Bacteria | 1538 |
| 291 | Ga0105242_10016013 | 3300009176 | Bacteria | 5825 |
| 292 | Ga0105242_10020621 | 3300009176 | Bacteria | 5170 |
| 293 | Ga0105248_10011596 | 3300009177 | Bacteria | 9709 |
| 294 | Ga0105248_10136473 | 3300009177 | Bacteria | 2767 |
| 295 | Ga0105237_10001169 | 3300009545 | Bacteria | 35074 |
| 296 | Ga0105237_10001507 | 3300009545 | Bacteria | 30622 |
| 297 | Ga0105237_10003761 | 3300009545 | Bacteria | 17860 |
| 298 | Ga0105237_10006919 | 3300009545 | Bacteria | 12508 |
| 299 | Ga0105237_10010656 | 3300009545 | Bacteria | 9768 |
| 300 | Ga0105237_10020484 | 3300009545 | Bacteria | 6814 |
| 301 | Ga0105237_10036510 | 3300009545 | Bacteria | 4973 |
| 302 | Ga0105237_10048101 | 3300009545 | Unclassified | 4287 |
| 303 | Ga0105237_10086948 | 3300009545 | Unclassified | 3116 |
| 304 | Ga0105237_10108178 | 3300009545 | Unclassified | 2772 |
| 305 | Ga0105237_10116674 | 3300009545 | Bacteria | 2663 |
| 306 | Ga0105238_10000790 | 3300009551 | Bacteria | 32827 |
| 307 | Ga0105238_10007423 | 3300009551 | Bacteria | 10980 |
| 308 | Ga0105238_10014765 | 3300009551 | Bacteria | 7898 |
| 309 | Ga0105238_10105735 | 3300009551 | Unclassified | 2796 |
| 310 | Ga0105249_10001054 | 3300009553 | Bacteria | 24439 |
| 311 | Ga0105249_10008648 | 3300009553 | Bacteria | 8872 |
| 312 | Ga0105249_10023271 | 3300009553 | Bacteria | 5557 |
| 313 | Ga0105249_10035127 | 3300009553 | Bacteria | 4544 |
| 314 | Ga0105249_10055078 | 3300009553 | Bacteria | 3637 |
| 315 | Ga0105249_10068632 | 3300009553 | Bacteria | 3270 |
| 316 | Ga0105249_10109333 | 3300009553 | Unclassified | 2611 |
| 317 | Ga0105239_10001545 | 3300010375 | Bacteria | 30416 |
| 318 | Ga0105239_10005789 | 3300010375 | Bacteria | 14420 |
| 319 | Ga0105239_10009377 | 3300010375 | Bacteria | 11043 |
| 320 | Ga0105239_10011830 | 3300010375 | Bacteria | 9737 |
| 321 | Ga0105239_10025660 | 3300010375 | Bacteria | 6489 |
| 322 | Ga0105239_10027242 | 3300010375 | Bacteria | 6292 |
| 323 | Ga0105239_10047136 | 3300010375 | Bacteria | 4723 |
| 324 | Ga0105239_10063809 | 3300010375 | Bacteria | 4044 |
| 325 | Ga0105239_10090349 | 3300010375 | Unclassified | 3379 |
| 326 | Ga0105239_10096610 | 3300010375 | Unclassified | 3264 |
| 327 | Ga0105239_10136292 | 3300010375 | Unclassified | 2733 |
| 328 | Ga0105239_10157831 | 3300010375 | Bacteria | 2534 |
| 329 | Ga0105246_10063544 | 3300011119 | Unclassified | 2575 |
| 330 | Ga0157373_10003779 | 3300013100 | Bacteria | 11453 |
| 331 | Ga0157373_10033350 | 3300013100 | Bacteria | 3705 |
| 332 | Ga0157373_10034969 | 3300013100 | Bacteria | 3609 |
| 333 | Ga0157371_10005572 | 3300013102 | Bacteria | 10583 |
| 334 | Ga0157371_10010957 | 3300013102 | Bacteria | 7028 |
| 335 | Ga0157371_10020816 | 3300013102 | Bacteria | 4825 |
| 336 | Ga0157371_10027048 | 3300013102 | Bacteria | 4163 |
| 337 | Ga0157371_10050290 | 3300013102 | Bacteria | 2961 |
| 338 | Ga0157371_10067188 | 3300013102 | Bacteria | 2538 |
| 339 | Ga0157371_10148904 | 3300013102 | Bacteria | 1669 |
| 340 | Ga0157370_10000673 | 3300013104 | Bacteria | 42574 |
| 341 | Ga0157370_10008553 | 3300013104 | Bacteria | 11033 |
| 342 | Ga0157370_10029690 | 3300013104 | Bacteria | 5363 |
| 343 | Ga0157370_10042465 | 3300013104 | Bacteria | 4382 |
| 344 | Ga0157370_10236500 | 3300013104 | Unclassified | 1691 |
| 345 | Ga0157369_10008359 | 3300013105 | Bacteria | 11869 |
| 346 | Ga0157369_10041129 | 3300013105 | Bacteria | 5045 |
| 347 | Ga0157369_10043119 | 3300013105 | Bacteria | 4919 |
| 348 | Ga0157369_10080716 | 3300013105 | Bacteria | 3482 |
| 349 | Ga0157369_10207788 | 3300013105 | Unclassified | 2053 |
| 350 | Ga0157369_10209501 | 3300013105 | Bacteria | 2043 |
| 351 | Ga0157369_10245748 | 3300013105 | Bacteria | 1868 |
| 352 | Ga0157374_10000202 | 3300013296 | Bacteria | 54739 |
| 353 | Ga0157374_10002159 | 3300013296 | Bacteria | 16586 |
| 354 | Ga0157374_10005314 | 3300013296 | Bacteria | 10816 |
| 355 | Ga0157374_10006821 | 3300013296 | Bacteria | 9713 |
| 356 | Ga0157374_10013923 | 3300013296 | Bacteria | 7030 |
| 357 | Ga0157374_10034609 | 3300013296 | Bacteria | 4616 |
| 358 | Ga0157374_10038133 | 3300013296 | Bacteria | 4416 |
| 359 | Ga0157378_10005161 | 3300013297 | Bacteria | 11466 |
| 360 | Ga0157378_10015277 | 3300013297 | Bacteria | 6724 |
| 361 | Ga0157378_10017150 | 3300013297 | Bacteria | 6348 |
| 362 | Ga0157378_10019086 | 3300013297 | Bacteria | 6024 |
| 363 | Ga0157378_10021365 | 3300013297 | Bacteria | 5691 |
| 364 | Ga0157378_10029790 | 3300013297 | Bacteria | 4820 |
| 365 | Ga0157378_10046894 | 3300013297 | Bacteria | 3841 |
| 366 | Ga0157378_10057412 | 3300013297 | Bacteria | 3469 |
| 367 | Ga0157378_10073638 | 3300013297 | Bacteria | 3071 |
| 368 | Ga0157378_10100881 | 3300013297 | Unclassified | 2636 |
| 369 | Ga0157378_10155381 | 3300013297 | Bacteria | 2135 |
| 370 | Ga0157378_10334359 | 3300013297 | Bacteria | 1475 |
| 371 | Ga0163162_10000032 | 3300013306 | Bacteria | 156609 |
| 372 | Ga0163162_10000201 | 3300013306 | Bacteria | 55260 |
| 373 | Ga0163162_10000544 | 3300013306 | Bacteria | 34854 |
| 374 | Ga0163162_10000549 | 3300013306 | Bacteria | 34654 |
| 375 | Ga0163162_10002245 | 3300013306 | Bacteria | 18145 |
| 376 | Ga0163162_10002374 | 3300013306 | Bacteria | 17700 |
| 377 | Ga0163162_10003819 | 3300013306 | Bacteria | 14443 |
| 378 | Ga0163162_10009583 | 3300013306 | Bacteria | 9422 |
| 379 | Ga0163162_10016297 | 3300013306 | Bacteria | 7265 |
| 380 | Ga0163162_10072909 | 3300013306 | Bacteria | 3489 |
| 381 | Ga0163162_10092742 | 3300013306 | Bacteria | 3104 |
| 382 | Ga0163162_10123550 | 3300013306 | Bacteria | 2694 |
| 383 | Ga0163162_10362508 | 3300013306 | Bacteria | 1582 |
| 384 | Ga0157372_10000020 | 3300013307 | Bacteria | 208056 |
| 385 | Ga0157372_10000894 | 3300013307 | Bacteria | 32388 |
| 386 | Ga0157372_10003748 | 3300013307 | Bacteria | 16318 |
| 387 | Ga0157372_10005808 | 3300013307 | Bacteria | 13145 |
| 388 | Ga0157372_10006101 | 3300013307 | Bacteria | 12803 |
| 389 | Ga0157372_10006151 | 3300013307 | Bacteria | 12758 |
| 390 | Ga0157372_10036860 | 3300013307 | Bacteria | 5393 |
| 391 | Ga0157372_10040159 | 3300013307 | Bacteria | 5166 |
| 392 | Ga0157372_10059279 | 3300013307 | Bacteria | 4281 |
| 393 | Ga0157372_10072620 | 3300013307 | Bacteria | 3878 |
| 394 | Ga0157372_10078720 | 3300013307 | Bacteria | 3725 |
| 395 | Ga0157372_10140157 | 3300013307 | Bacteria | 2785 |
| 396 | Ga0157372_10144383 | 3300013307 | Bacteria | 2744 |
| 397 | Ga0157372_10179157 | 3300013307 | Bacteria | 2453 |
| 398 | Ga0157372_10347321 | 3300013307 | Unclassified | 1728 |
| 399 | Ga0157372_10351160 | 3300013307 | Bacteria | 1718 |
| 400 | Ga0157375_10000821 | 3300013308 | Bacteria | 27183 |
| 401 | Ga0157375_10003434 | 3300013308 | Bacteria | 13738 |
| 402 | Ga0157375_10003913 | 3300013308 | Bacteria | 12917 |
| 403 | Ga0157375_10028292 | 3300013308 | Bacteria | 5251 |
| 404 | Ga0157375_10051002 | 3300013308 | Bacteria | 4061 |
| 405 | Ga0157375_10056180 | 3300013308 | Bacteria | 3885 |
| 406 | Ga0157375_10161244 | 3300013308 | Unclassified | 2384 |
| 407 | Ga0163163_10000079 | 3300014325 | Bacteria | 106874 |
| 408 | Ga0163163_10000471 | 3300014325 | Bacteria | 36731 |
| 409 | Ga0163163_10227766 | 3300014325 | Bacteria | 1913 |
| 410 | Ga0157380_10010345 | 3300014326 | Bacteria | 6709 |
| 411 | Ga0157380_10085268 | 3300014326 | Bacteria | 2592 |
| 412 | Ga0157380_10117169 | 3300014326 | Bacteria | 2249 |
| 413 | Ga0157377_10005020 | 3300014745 | Bacteria | 6176 |
| 414 | Ga0157377_10009617 | 3300014745 | Bacteria | 4753 |
| 415 | Ga0157377_10021089 | 3300014745 | Bacteria | 3422 |
| 416 | Ga0157377_10021291 | 3300014745 | Bacteria | 3409 |
| 417 | Ga0157379_10000115 | 3300014968 | Bacteria | 55499 |
| 418 | Ga0157379_10007087 | 3300014968 | Bacteria | 9692 |
| 419 | Ga0157379_10008675 | 3300014968 | Bacteria | 8853 |
| 420 | Ga0157379_10033631 | 3300014968 | Unclassified | 4572 |
| 421 | Ga0157379_10054904 | 3300014968 | Bacteria | 3559 |
| 422 | Ga0157379_10065388 | 3300014968 | Bacteria | 3250 |
| 423 | Ga0157379_10140503 | 3300014968 | Bacteria | 2177 |
| 424 | Ga0157376_10001273 | 3300014969 | Bacteria | 16559 |
| 425 | Ga0157376_10002338 | 3300014969 | Bacteria | 12798 |
| 426 | Ga0157376_10003237 | 3300014969 | Bacteria | 11207 |
| 427 | Ga0157376_10004628 | 3300014969 | Bacteria | 9584 |
| 428 | Ga0157376_10013495 | 3300014969 | Bacteria | 6097 |
| 429 | Ga0157376_10027053 | 3300014969 | Bacteria | 4541 |
| 430 | Ga0157376_10092472 | 3300014969 | Unclassified | 2622 |
| 431 | Ga0157376_10110770 | 3300014969 | Bacteria | 2416 |
| 432 | Ga0157376_10120433 | 3300014969 | Bacteria | 2325 |
| 433 | Ga0157376_10129796 | 3300014969 | Bacteria | 2247 |
| 434 | Ga0163161_10002103 | 3300017792 | Bacteria | 14420 |
| 435 | Ga0163161_10036617 | 3300017792 | Bacteria | 3514 |
| 436 | Ga0209026_1005939 | 3300025250 | Bacteria | 3128 |
| 437 | Ga0207697_10020282 | 3300025315 | Bacteria | 2721 |
| 438 | Ga0207697_10023474 | 3300025315 | Bacteria | 2525 |
| 439 | Ga0207682_10020942 | 3300025893 | Unclassified | 2571 |
| 440 | Ga0207642_10002442 | 3300025899 | Bacteria | 5784 |
| 441 | Ga0207680_10011428 | 3300025903 | Bacteria | 4487 |
| 442 | Ga0207680_10090071 | 3300025903 | Unclassified | 1949 |
| 443 | Ga0207680_10122908 | 3300025903 | Bacteria | 1700 |
| 444 | Ga0207647_10000321 | 3300025904 | Bacteria | 39699 |
| 445 | Ga0207647_10000511 | 3300025904 | Bacteria | 30935 |
| 446 | Ga0207647_10064336 | 3300025904 | Bacteria | 2229 |
| 447 | Ga0207645_10000874 | 3300025907 | Bacteria | 25051 |
| 448 | Ga0207645_10001491 | 3300025907 | Bacteria | 19131 |
| 449 | Ga0207645_10008058 | 3300025907 | Bacteria | 7391 |
| 450 | Ga0207645_10065610 | 3300025907 | Bacteria | 2320 |
| 451 | Ga0207643_10014097 | 3300025908 | Bacteria | 4339 |
| 452 | Ga0207705_10000053 | 3300025909 | Bacteria | 162124 |
| 453 | Ga0207705_10003949 | 3300025909 | Bacteria | 11276 |
| 454 | Ga0207705_10021770 | 3300025909 | Bacteria | 4575 |
| 455 | Ga0207705_10097985 | 3300025909 | Bacteria | 2154 |
| 456 | Ga0207654_10000585 | 3300025911 | Bacteria | 20568 |
| 457 | Ga0207654_10001259 | 3300025911 | Bacteria | 13484 |
| 458 | Ga0207654_10012775 | 3300025911 | Bacteria | 4309 |
| 459 | Ga0207654_10030053 | 3300025911 | Unclassified | 2979 |
| 460 | Ga0207654_10042012 | 3300025911 | Bacteria | 2585 |
| 461 | Ga0207707_10017719 | 3300025912 | Bacteria | 6213 |
| 462 | Ga0207707_10024725 | 3300025912 | Bacteria | 5255 |
| 463 | Ga0207707_10182078 | 3300025912 | Bacteria | 1834 |
| 464 | Ga0207707_10194744 | 3300025912 | Unclassified | 1768 |
| 465 | Ga0207695_10000023 | 3300025913 | Bacteria | 657903 |
| 466 | Ga0207695_10000031 | 3300025913 | Bacteria | 526801 |
| 467 | Ga0207695_10000110 | 3300025913 | Bacteria | 250079 |
| 468 | Ga0207695_10001232 | 3300025913 | Bacteria | 43800 |
| 469 | Ga0207695_10001344 | 3300025913 | Bacteria | 41706 |
| 470 | Ga0207695_10001456 | 3300025913 | Bacteria | 39626 |
| 471 | Ga0207695_10008031 | 3300025913 | Bacteria | 13283 |
| 472 | Ga0207695_10009725 | 3300025913 | Bacteria | 11836 |
| 473 | Ga0207695_10021005 | 3300025913 | Bacteria | 7457 |
| 474 | Ga0207695_10022580 | 3300025913 | Bacteria | 7137 |
| 475 | Ga0207695_10022991 | 3300025913 | Bacteria | 7060 |
| 476 | Ga0207695_10057802 | 3300025913 | Unclassified | 4028 |
| 477 | Ga0207695_10061337 | 3300025913 | Unclassified | 3886 |
| 478 | Ga0207695_10139961 | 3300025913 | Bacteria | 2369 |
| 479 | Ga0207695_10166590 | 3300025913 | Bacteria | 2131 |
| 480 | Ga0207695_10190792 | 3300025913 | Bacteria | 1967 |
| 481 | Ga0207671_10000974 | 3300025914 | Bacteria | 35495 |
| 482 | Ga0207671_10001755 | 3300025914 | Bacteria | 24384 |
| 483 | Ga0207671_10001885 | 3300025914 | Bacteria | 23302 |
| 484 | Ga0207671_10002532 | 3300025914 | Bacteria | 19474 |
| 485 | Ga0207671_10004604 | 3300025914 | Bacteria | 13095 |
| 486 | Ga0207671_10004864 | 3300025914 | Bacteria | 12640 |
| 487 | Ga0207671_10006852 | 3300025914 | Bacteria | 10054 |
| 488 | Ga0207671_10008980 | 3300025914 | Bacteria | 8409 |
| 489 | Ga0207671_10009040 | 3300025914 | Bacteria | 8380 |
| 490 | Ga0207671_10011481 | 3300025914 | Bacteria | 7203 |
| 491 | Ga0207671_10039592 | 3300025914 | Bacteria | 3490 |
| 492 | Ga0207671_10050802 | 3300025914 | Unclassified | 3070 |
| 493 | Ga0207671_10065202 | 3300025914 | Unclassified | 2708 |
| 494 | Ga0207660_10008655 | 3300025917 | Bacteria | 6582 |
| 495 | Ga0207660_10023754 | 3300025917 | Bacteria | 4143 |
| 496 | Ga0207660_10029454 | 3300025917 | Unclassified | 3766 |
| 497 | Ga0207662_10099105 | 3300025918 | Unclassified | 1804 |
| 498 | Ga0207657_10019335 | 3300025919 | Bacteria | 6473 |
| 499 | Ga0207657_10048929 | 3300025919 | Unclassified | 3688 |
| 500 | Ga0207652_10000451 | 3300025921 | Bacteria | 42282 |
| 501 | Ga0207652_10007289 | 3300025921 | Bacteria | 8909 |
| 502 | Ga0207652_10017039 | 3300025921 | Bacteria | 5943 |
| 503 | Ga0207652_10155768 | 3300025921 | Bacteria | 2047 |
| 504 | Ga0207681_10088551 | 3300025923 | Bacteria | 2205 |
| 505 | Ga0207694_10004366 | 3300025924 | Bacteria | 11044 |
| 506 | Ga0207694_10013429 | 3300025924 | Bacteria | 6169 |
| 507 | Ga0207694_10082221 | 3300025924 | Bacteria | 2531 |
| 508 | Ga0207650_10006464 | 3300025925 | Bacteria | 7982 |
| 509 | Ga0207650_10028226 | 3300025925 | Bacteria | 4021 |
| 510 | Ga0207659_10010129 | 3300025926 | Bacteria | 5910 |
| 511 | Ga0207659_10016624 | 3300025926 | Bacteria | 4793 |
| 512 | Ga0207659_10095290 | 3300025926 | Unclassified | 2232 |
| 513 | Ga0207659_10102738 | 3300025926 | Bacteria | 2158 |
| 514 | Ga0207659_10112018 | 3300025926 | Bacteria | 2076 |
| 515 | Ga0207659_10208994 | 3300025926 | Bacteria | 1563 |
| 516 | Ga0207644_10031264 | 3300025931 | Bacteria | 3708 |
| 517 | Ga0207690_10154461 | 3300025932 | Bacteria | 1704 |
| 518 | Ga0207706_10000120 | 3300025933 | Bacteria | 84222 |
| 519 | Ga0207706_10003224 | 3300025933 | Bacteria | 15663 |
| 520 | Ga0207706_10008325 | 3300025933 | Bacteria | 9564 |
| 521 | Ga0207706_10033612 | 3300025933 | Bacteria | 4563 |
| 522 | Ga0207706_10047228 | 3300025933 | Bacteria | 3810 |
| 523 | Ga0207686_10003837 | 3300025934 | Bacteria | 8061 |
| 524 | Ga0207686_10007373 | 3300025934 | Bacteria | 5921 |
| 525 | Ga0207709_10044636 | 3300025935 | Bacteria | 2679 |
| 526 | Ga0207669_10002105 | 3300025937 | Bacteria | 8438 |
| 527 | Ga0207669_10027965 | 3300025937 | Unclassified | 3096 |
| 528 | Ga0207704_10000099 | 3300025938 | Bacteria | 48088 |
| 529 | Ga0207704_10006041 | 3300025938 | Bacteria | 5614 |
| 530 | Ga0207704_10014507 | 3300025938 | Bacteria | 3980 |
| 531 | Ga0207691_10000322 | 3300025940 | Bacteria | 47690 |
| 532 | Ga0207691_10009018 | 3300025940 | Bacteria | 9565 |
| 533 | Ga0207691_10058709 | 3300025940 | Bacteria | 3499 |
| 534 | Ga0207691_10068359 | 3300025940 | Bacteria | 3209 |
| 535 | Ga0207691_10118175 | 3300025940 | Bacteria | 2352 |
| 536 | Ga0207711_10033453 | 3300025941 | Bacteria | 4350 |
| 537 | Ga0207711_10122791 | 3300025941 | Unclassified | 2320 |
| 538 | Ga0207689_10002462 | 3300025942 | Bacteria | 17250 |
| 539 | Ga0207689_10007633 | 3300025942 | Bacteria | 9470 |
| 540 | Ga0207689_10013593 | 3300025942 | Bacteria | 6944 |
| 541 | Ga0207689_10025756 | 3300025942 | Bacteria | 4928 |
| 542 | Ga0207689_10074796 | 3300025942 | Bacteria | 2783 |
| 543 | Ga0207661_10015706 | 3300025944 | Bacteria | 5578 |
| 544 | Ga0207661_10018857 | 3300025944 | Bacteria | 5133 |
| 545 | Ga0207679_10005163 | 3300025945 | Bacteria | 8177 |
| 546 | Ga0207679_10039157 | 3300025945 | Bacteria | 3383 |
| 547 | Ga0207679_10068693 | 3300025945 | Bacteria | 2663 |
| 548 | Ga0207667_10000046 | 3300025949 | Bacteria | 245420 |
| 549 | Ga0207667_10000098 | 3300025949 | Bacteria | 140051 |
| 550 | Ga0207667_10000926 | 3300025949 | Bacteria | 37457 |
| 551 | Ga0207667_10001699 | 3300025949 | Bacteria | 27690 |
| 552 | Ga0207667_10002398 | 3300025949 | Bacteria | 23465 |
| 553 | Ga0207667_10012033 | 3300025949 | Bacteria | 10011 |
| 554 | Ga0207667_10013584 | 3300025949 | Bacteria | 9309 |
| 555 | Ga0207667_10032551 | 3300025949 | Bacteria | 5617 |
| 556 | Ga0207667_10090304 | 3300025949 | Bacteria | 3166 |
| 557 | Ga0207667_10127196 | 3300025949 | Unclassified | 2625 |
| 558 | Ga0207667_10181280 | 3300025949 | Bacteria | 2163 |
| 559 | Ga0207667_10181850 | 3300025949 | Bacteria | 2159 |
| 560 | Ga0207651_10005272 | 3300025960 | Bacteria | 6614 |
| 561 | Ga0207651_10007887 | 3300025960 | Bacteria | 5703 |
| 562 | Ga0207651_10110153 | 3300025960 | Bacteria | 2065 |
| 563 | Ga0207712_10017000 | 3300025961 | Bacteria | 4719 |
| 564 | Ga0207712_10019169 | 3300025961 | Bacteria | 4464 |
| 565 | Ga0207712_10043360 | 3300025961 | Bacteria | 3103 |
| 566 | Ga0207712_10050898 | 3300025961 | Bacteria | 2894 |
| 567 | Ga0207668_10019504 | 3300025972 | Bacteria | 4289 |
| 568 | Ga0207668_10149718 | 3300025972 | Bacteria | 1805 |
| 569 | Ga0207668_10167018 | 3300025972 | Unclassified | 1722 |
| 570 | Ga0207640_10016538 | 3300025981 | Bacteria | 4293 |
| 571 | Ga0207658_10002779 | 3300025986 | Bacteria | 12608 |
| 572 | Ga0207658_10027385 | 3300025986 | Bacteria | 4003 |
| 573 | Ga0207658_10046209 | 3300025986 | Bacteria | 3178 |
| 574 | Ga0207658_10078649 | 3300025986 | Bacteria | 2521 |
| 575 | Ga0207658_10114287 | 3300025986 | Bacteria | 2140 |
| 576 | Ga0207677_10012452 | 3300026023 | Bacteria | 4890 |
| 577 | Ga0207677_10018271 | 3300026023 | Unclassified | 4205 |
| 578 | Ga0207677_10071755 | 3300026023 | Bacteria | 2445 |
| 579 | Ga0207677_10087736 | 3300026023 | Bacteria | 2253 |
| 580 | Ga0207677_10211589 | 3300026023 | Bacteria | 1549 |
| 581 | Ga0207703_10000814 | 3300026035 | Bacteria | 30775 |
| 582 | Ga0207703_10001555 | 3300026035 | Bacteria | 20808 |
| 583 | Ga0207703_10203038 | 3300026035 | Bacteria | 1762 |
| 584 | Ga0207639_10006392 | 3300026041 | Bacteria | 8004 |
| 585 | Ga0207639_10015544 | 3300026041 | Bacteria | 5372 |
| 586 | Ga0207639_10023150 | 3300026041 | Unclassified | 4482 |
| 587 | Ga0207639_10097544 | 3300026041 | Bacteria | 2367 |
| 588 | Ga0207639_10105225 | 3300026041 | Unclassified | 2289 |
| 589 | Ga0207639_10123606 | 3300026041 | Bacteria | 2130 |
| 590 | Ga0207678_10238804 | 3300026067 | Bacteria | 1556 |
| 591 | Ga0207708_10126058 | 3300026075 | Unclassified | 1998 |
| 592 | Ga0207702_10000161 | 3300026078 | Bacteria | 79598 |
| 593 | Ga0207702_10103612 | 3300026078 | Unclassified | 2517 |
| 594 | Ga0207702_10135432 | 3300026078 | Bacteria | 2222 |
| 595 | Ga0207641_10000191 | 3300026088 | Bacteria | 84147 |
| 596 | Ga0207641_10000822 | 3300026088 | Bacteria | 32995 |
| 597 | Ga0207641_10005620 | 3300026088 | Bacteria | 10681 |
| 598 | Ga0207641_10023041 | 3300026088 | Bacteria | 5130 |
| 599 | Ga0207641_10033664 | 3300026088 | Bacteria | 4257 |
| 600 | Ga0207641_10034437 | 3300026088 | Bacteria | 4213 |
| 601 | Ga0207648_10001459 | 3300026089 | Bacteria | 26009 |
| 602 | Ga0207648_10002849 | 3300026089 | Bacteria | 18310 |
| 603 | Ga0207648_10005953 | 3300026089 | Bacteria | 12201 |
| 604 | Ga0207648_10006750 | 3300026089 | Bacteria | 11382 |
| 605 | Ga0207648_10013507 | 3300026089 | Bacteria | 7595 |
| 606 | Ga0207648_10027226 | 3300026089 | Bacteria | 5078 |
| 607 | Ga0207648_10027988 | 3300026089 | Bacteria | 5001 |
| 608 | Ga0207648_10093493 | 3300026089 | Bacteria | 2629 |
| 609 | Ga0207648_10142762 | 3300026089 | Bacteria | 2111 |
| 610 | Ga0207676_10004453 | 3300026095 | Bacteria | 9907 |
| 611 | Ga0207676_10021098 | 3300026095 | Bacteria | 4776 |
| 612 | Ga0207676_10069843 | 3300026095 | Bacteria | 2814 |
| 613 | Ga0207676_10076651 | 3300026095 | Bacteria | 2702 |
| 614 | Ga0207676_10105876 | 3300026095 | Unclassified | 2342 |
| 615 | Ga0207674_10007910 | 3300026116 | Bacteria | 12348 |
| 616 | Ga0207674_10017658 | 3300026116 | Bacteria | 7779 |
| 617 | Ga0207674_10034726 | 3300026116 | Bacteria | 5268 |
| 618 | Ga0207674_10128270 | 3300026116 | Unclassified | 2501 |
| 619 | Ga0207675_100000809 | 3300026118 | Bacteria | 31123 |
| 620 | Ga0207675_100003900 | 3300026118 | Bacteria | 14503 |
| 621 | Ga0207675_100146569 | 3300026118 | Bacteria | 2245 |
| 622 | Ga0207675_100187304 | 3300026118 | Bacteria | 1984 |
| 623 | Ga0207683_10015784 | 3300026121 | Bacteria | 6428 |
| 624 | Ga0207683_10016479 | 3300026121 | Bacteria | 6290 |
| 625 | Ga0207683_10020939 | 3300026121 | Bacteria | 5597 |
| 626 | Ga0207698_10017035 | 3300026142 | Bacteria | 4919 |
| 627 | Ga0207698_10025762 | 3300026142 | Unclassified | 4150 |
| 628 | Ga0207698_10031547 | 3300026142 | Bacteria | 3826 |
| 629 | Ga0207698_10041491 | 3300026142 | Bacteria | 3429 |
| 630 | Ga0207698_10061255 | 3300026142 | Bacteria | 2932 |
| 631 | Ga0207698_10095525 | 3300026142 | Bacteria | 2447 |
| 632 | Ga0207698_10095838 | 3300026142 | Bacteria | 2444 |
| 633 | Ga0207698_10124249 | 3300026142 | Bacteria | 2191 |
| 634 | Ga0207428_10021810 | 3300027907 | Bacteria | 5418 |
| 635 | Ga0268266_10000018 | 3300028379 | Bacteria | 569141 |
| 636 | Ga0268266_10000068 | 3300028379 | Bacteria | 241100 |
| 637 | Ga0268266_10014466 | 3300028379 | Bacteria | 6783 |
| 638 | Ga0268265_10026320 | 3300028380 | Bacteria | 4138 |
| 639 | Ga0268265_10135862 | 3300028380 | Bacteria | 2051 |
| 640 | Ga0268264_10000079 | 3300028381 | Bacteria | 249516 |
| 641 | Ga0268264_10001681 | 3300028381 | Bacteria | 20386 |
| 642 | Ga0268264_10003159 | 3300028381 | Bacteria | 14267 |
| 643 | Ga0268264_10008273 | 3300028381 | Bacteria | 8642 |
| 644 | Ga0268264_10008652 | 3300028381 | Bacteria | 8457 |
| 645 | Ga0268264_10022622 | 3300028381 | Bacteria | 5130 |
| 646 | Ga0268264_10081343 | 3300028381 | Bacteria | 2768 |
| 647 | Ga0307517_10004683 | 3300028786 | Bacteria | 20955 |
| 648 | Ga0307517_10067908 | 3300028786 | Bacteria | 3256 |
| 649 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 650 | Ga0307515_10000162 | 3300028794 | Bacteria | 163720 |
| 651 | Ga0307511_10000382 | 3300030521 | Bacteria | 47277 |
| 652 | Ga0307511_10000554 | 3300030521 | Bacteria | 40123 |
| 653 | Ga0265340_10047318 | 3300031247 | Bacteria | 2095 |
| 654 | Ga0265327_10000316 | 3300031251 | Bacteria | 92271 |
| 655 | Ga0265327_10000404 | 3300031251 | Bacteria | 80704 |
| 656 | Ga0265327_10008285 | 3300031251 | Bacteria | 7783 |
| 657 | Ga0307513_10048179 | 3300031456 | Unclassified | 4627 |
| 658 | Ga0307509_10042194 | 3300031507 | Bacteria | 4946 |
| 659 | Ga0307509_10060375 | 3300031507 | Bacteria | 4008 |
| 660 | Ga0307508_10000636 | 3300031616 | Bacteria | 42249 |
| 661 | Ga0307508_10057994 | 3300031616 | Bacteria | 3426 |
| 662 | Ga0307516_10001823 | 3300031730 | Bacteria | 29270 |
| 663 | Ga0307516_10163925 | 3300031730 | Bacteria | 1970 |
| 664 | Ga0307414_10103493 | 3300032004 | Bacteria | 2148 |
| 665 | Ga0307510_10002326 | 3300033180 | Bacteria | 21483 |
| 666 | Ga0307510_10010841 | 3300033180 | Bacteria | 10834 |
| 667 | Ga0373937_0056284 | 3300036401 | Bacteria | 3612 |
| 668 | Ga0395899_0000245 | 3300037312 | Bacteria | 72304 |
| 669 | Ga0395899_0000629 | 3300037312 | Bacteria | 36706 |
| 670 | Ga0395899_0027913 | 3300037312 | Unclassified | 4251 |
| 671 | Ga0395900_0000480 | 3300037418 | Bacteria | 56578 |
| 672 | Ga0395900_0040897 | 3300037418 | Bacteria | 4778 |
| 673 | Ga0395898_0006652 | 3300037466 | Bacteria | 12328 |
| 674 | Ga0395898_0090721 | 3300037466 | Bacteria | 2940 |
| 675 | Ga0395898_0331414 | 3300037466 | Bacteria | 1451 |
| 676 | Ga0395905_0000738 | 3300037471 | Bacteria | 43061 |
| 677 | Ga0395901_0029084 | 3300038443 | Bacteria | 5686 |
| 678 | Ga0395901_0083858 | 3300038443 | Bacteria | 3331 |
| 679 | Ga0436365_1668618 | 3300039437 | Bacteria | 3341 |
| 680 | Ga0436361_0573832 | 3300039447 | Bacteria | 5377 |
| 681 | Ga0439439_0024979 | 3300041406 | Bacteria | 1502 |
| 682 | Ga0439433_0023867 | 3300041999 | Bacteria | 1377 |
| 683 | Ga0439442_011242 | 3300042002 | Bacteria | 1820 |
| 684 | Ga0439448_0029004 | 3300042005 | Bacteria | 1750 |
| 685 | Ga0439457_008790 | 3300042014 | Bacteria | 2370 |
| 686 | Ga0451577_0074560 | 3300042876 | Bacteria | 3026 |
| 687 | Ga0466972_0000123 | 3300044658 | Bacteria | 65577 |
| 688 | Ga0466972_0006738 | 3300044658 | Bacteria | 5766 |
| 689 | Ga0466972_0011566 | 3300044658 | Bacteria | 4431 |
| 690 | Ga0466961_0070898 | 3300044693 | Unclassified | 2212 |
| 691 | Ga0453684_0289305 | 3300044712 | Bacteria | 1866 |
| 692 | Ga0466968_0031915 | 3300044735 | Unclassified | 2188 |
| 693 | Ga0466970_0032022 | 3300044765 | Unclassified | 2778 |
| 694 | Ga0466959_0029318 | 3300045049 | Bacteria | 4077 |
| 695 | Ga0495638_0011155 | 3300046460 | Bacteria | 6206 |
| 696 | Ga0495638_0079173 | 3300046460 | Unclassified | 1999 |
| 697 | Ga0495638_0123592 | 3300046460 | Bacteria | 1527 |
| 698 | Ga0495650_0000003 | 3300046471 | Bacteria | 900730 |
| 699 | Ga0495650_0020244 | 3300046471 | Bacteria | 3249 |
| 700 | Ga0495650_0039532 | 3300046471 | Bacteria | 2035 |
| 701 | Ga0495585_0001096 | 3300046492 | Bacteria | 22298 |
| 702 | Ga0495583_0036359 | 3300046506 | Bacteria | 2344 |
| 703 | Ga0495606_0001265 | 3300046507 | Bacteria | 35151 |
| 704 | Ga0495606_0005740 | 3300046507 | Bacteria | 11737 |
| 705 | Ga0495606_0041576 | 3300046507 | Bacteria | 3082 |
| 706 | Ga0495610_0000952 | 3300046512 | Bacteria | 26811 |
| 707 | Ga0495616_0000819 | 3300046513 | Bacteria | 22682 |
| 708 | Ga0495616_0008664 | 3300046513 | Bacteria | 6003 |
| 709 | Ga0495631_0013203 | 3300046518 | Bacteria | 4015 |
| 710 | Ga0495648_0005768 | 3300046524 | Bacteria | 10214 |
| 711 | Ga0495611_0000209 | 3300046648 | Bacteria | 41348 |
| 712 | Ga0495625_0000005 | 3300046660 | Bacteria | 596135 |
| 713 | Ga0495625_0003156 | 3300046660 | Bacteria | 16788 |
| 714 | Ga0495625_0028893 | 3300046660 | Bacteria | 4152 |
| 715 | Ga0495635_0075810 | 3300046663 | Bacteria | 2304 |
| 716 | Ga0495635_0166643 | 3300046663 | Bacteria | 1499 |
| 717 | Ga0495661_0003610 | 3300046665 | Bacteria | 11392 |
| 718 | Ga0495661_0010067 | 3300046665 | Bacteria | 6467 |
| 719 | Ga0495670_0063520 | 3300046691 | Bacteria | 1859 |
| 720 | Ga0495649_0000003 | 3300046694 | Bacteria | 880817 |
| 721 | Ga0495600_0119597 | 3300046809 | Bacteria | 1714 |
| 722 | Ga0495672_0020619 | 3300047320 | Bacteria | 4313 |
| 723 | Ga0495683_0018182 | 3300047323 | Bacteria | 3636 |
| 724 | Ga0495687_000564 | 3300047443 | Bacteria | 43681 |
| 725 | Ga0495687_001156 | 3300047443 | Bacteria | 25557 |
| 726 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 727 | Ga0495686_0000111 | 3300047472 | Bacteria | 168708 |
| 728 | Ga0495686_0000154 | 3300047472 | Bacteria | 131970 |
| 729 | Ga0495686_0011013 | 3300047472 | Bacteria | 6397 |
| 730 | Ga0496100_0081775 | 3300048903 | Bacteria | 2183 |
| 731 | Ga0496110_0144274 | 3300048913 | Bacteria | 2153 |
| 732 | Ga0495678_063545 | 3300049459 | Unclassified | 1378 |
| 733 | Ga0501031_0009047 | 3300049568 | Bacteria | 6480 |
| 734 | Ga0501032_0032184 | 3300049569 | Unclassified | 3593 |
| 735 | Ga0501032_0138492 | 3300049569 | Unclassified | 1603 |
| 736 | Ga0501033_0050505 | 3300049570 | Unclassified | 3085 |
| 737 | Ga0501034_0000004 | 3300049571 | Bacteria | 382255 |
| 738 | Ga0501034_0226073 | 3300049571 | Unclassified | 1822 |
| 739 | Ga0501036_0109130 | 3300049572 | Unclassified | 2338 |
| 740 | Ga0501037_0022847 | 3300049573 | Bacteria | 4624 |
| 741 | Ga0501038_0088487 | 3300049574 | Unclassified | 2599 |
| 742 | Ga0501039_0022502 | 3300049575 | Bacteria | 4838 |
| 743 | Ga0501043_0018799 | 3300049579 | Bacteria | 5423 |
| 744 | Ga0501046_0226331 | 3300049580 | Unclassified | 1383 |
| 745 | Ga0501047_0200722 | 3300049581 | Unclassified | 1855 |
| 746 | Ga0501067_0099461 | 3300049583 | Unclassified | 1615 |
| 747 | Ga0501069_0024826 | 3300049585 | Unclassified | 3272 |
| 748 | Ga0501070_0024601 | 3300049586 | Bacteria | 5049 |
| 749 | Ga0501073_0017835 | 3300049589 | Bacteria | 5137 |
| 750 | Ga0501073_0125427 | 3300049589 | Unclassified | 1780 |
| 751 | Ga0501035_0005500 | 3300049822 | Bacteria | 11969 |
| 752 | Ga0501035_0110662 | 3300049822 | Unclassified | 2407 |
| 753 | Ga0501044_0077955 | 3300049823 | Unclassified | 3359 |
| 754 | nmdc:mga0k408_14037_c1 | 3300050493 | Bacteria | 4404 |
| 755 | nmdc:mga0k408_6554_c1 | 3300050493 | Bacteria | 6202 |
| 756 | nmdc:mga09592_295790_c1 | 3300050508 | Unclassified | 1404 |
| 757 | nmdc:mga09592_63121_c1 | 3300050508 | Unclassified | 3134 |
| 758 | nmdc:mga09592_8127_c1 | 3300050508 | Bacteria | 8532 |
| 759 | nmdc:mga0qj67_5578_c1 | 3300050509 | Bacteria | 9197 |
| 760 | nmdc:mga06r32_11498_c1 | 3300050510 | Bacteria | 7973 |
| 761 | nmdc:mga06r32_288102_c1 | 3300050510 | Bacteria | 1629 |
| 762 | nmdc:mga06r32_88425_c1 | 3300050510 | Bacteria | 3024 |
| 763 | nmdc:mga08y16_8912_c1 | 3300050511 | Bacteria | 10534 |
| 764 | Ga0500583_0006433 | 3300053092 | Bacteria | 4043 |
| 765 | Ga0500618_000001 | 3300053125 | Bacteria | 538477 |
| 766 | Ga0500568_0001404 | 3300053139 | Bacteria | 15626 |
| 767 | Ga0500616_0012667 | 3300053153 | Bacteria | 4930 |
| 768 | Ga0500622_0000398 | 3300053156 | Bacteria | 41643 |
| 769 | Ga0500624_000199 | 3300053157 | Bacteria | 23714 |
| 770 | Ga0500611_000001 | 3300053727 | Bacteria | 385744 |
| 771 | Ga0501084_0005233 | 3300054114 | Bacteria | 10617 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044712 | Ga0453684_0289305 | Ga0453684_0289305_699_1844 | 370 |
| 2 | 3300049583 | Ga0501067_0099461 | Ga0501067_0099461_433_1605 | 374 |
| 3 | 3300013105 | Ga0157369_10207788 | Ga0157369_102077882 | 380 |
| 4 | 3300046471 | Ga0495650_0039532 | Ga0495650_0039532_776_1972 | 389 |
| 5 | 3300049585 | Ga0501069_0024826 | Ga0501069_0024826_23_1246 | 391 |
| 6 | 3300013297 | Ga0157378_10005161 | Ga0157378_100051615 | 394 |
| 7 | 3300014745 | Ga0157377_10005020 | Ga0157377_100050205 | 394 |
| 8 | 3300046663 | Ga0495635_0166643 | Ga0495635_0166643_94_1299 | 394 |
| 9 | 3300005327 | Ga0070658_10000027 | Ga0070658_1000002731 | 395 |
| 10 | 3300005563 | Ga0068855_100040797 | Ga0068855_1000407976 | 395 |
| 11 | 3300005844 | Ga0068862_100014299 | Ga0068862_1000142995 | 395 |
| 12 | 3300025909 | Ga0207705_10000053 | Ga0207705_1000005331 | 395 |
| 13 | 3300025917 | Ga0207660_10023754 | Ga0207660_100237543 | 395 |
| 14 | 3300025949 | Ga0207667_10032551 | Ga0207667_100325512 | 395 |
| 15 | 3300013307 | Ga0157372_10003748 | Ga0157372_100037484 | 403 |
| 16 | 3300049580 | Ga0501046_0226331 | Ga0501046_0226331_105_1361 | 409 |
| 17 | 3300009545 | Ga0105237_10006919 | Ga0105237_100069197 | 412 |
| 18 | 3300025914 | Ga0207671_10004864 | Ga0207671_100048647 | 412 |
| 19 | 3300048903 | Ga0496100_0081775 | Ga0496100_0081775_888_2153 | 413 |
| 20 | 3300005616 | Ga0068852_100033541 | Ga0068852_1000335412 | 414 |
| 21 | 3300013104 | Ga0157370_10008553 | Ga0157370_100085534 | 414 |
| 22 | 3300013307 | Ga0157372_10040159 | Ga0157372_100401595 | 414 |
| 23 | 3300025904 | Ga0207647_10064336 | Ga0207647_100643362 | 414 |
| 24 | 3300026041 | Ga0207639_10123606 | Ga0207639_101236062 | 414 |
| 25 | 3300026142 | Ga0207698_10041491 | Ga0207698_100414911 | 414 |
| 26 | 3300046663 | Ga0495635_0075810 | Ga0495635_0075810_1028_2284 | 414 |
| 27 | 3300037466 | Ga0395898_0331414 | Ga0395898_0331414_139_1392 | 415 |
| 28 | 3300044693 | Ga0466961_0070898 | Ga0466961_0070898_682_2040 | 418 |
| 29 | 3300044765 | Ga0466970_0032022 | Ga0466970_0032022_984_2342 | 418 |
| 30 | 3300045049 | Ga0466959_0029318 | Ga0466959_0029318_554_1912 | 418 |
| 31 | 3300049568 | Ga0501031_0009047 | Ga0501031_0009047_893_2218 | 419 |
| 32 | 3300049569 | Ga0501032_0138492 | Ga0501032_0138492_234_1559 | 419 |
| 33 | 3300049572 | Ga0501036_0109130 | Ga0501036_0109130_745_2070 | 419 |
| 34 | 3300049574 | Ga0501038_0088487 | Ga0501038_0088487_663_1988 | 419 |
| 35 | 3300049575 | Ga0501039_0022502 | Ga0501039_0022502_1118_2443 | 419 |
| 36 | 3300049579 | Ga0501043_0018799 | Ga0501043_0018799_1273_2598 | 419 |
| 37 | 3300049589 | Ga0501073_0125427 | Ga0501073_0125427_434_1759 | 419 |
| 38 | 3300049822 | Ga0501035_0110662 | Ga0501035_0110662_163_1488 | 419 |
| 39 | 3300049823 | Ga0501044_0077955 | Ga0501044_0077955_502_1827 | 419 |
| 40 | 3300031730 | Ga0307516_10001823 | Ga0307516_1000182321 | 420 |
| 41 | 3300005458 | Ga0070681_10038082 | Ga0070681_100380821 | 421 |
| 42 | 3300025912 | Ga0207707_10182078 | Ga0207707_101820782 | 421 |
| 43 | 3300005458 | Ga0070681_10015844 | Ga0070681_100158441 | 422 |
| 44 | 3300025912 | Ga0207707_10194744 | Ga0207707_101947441 | 422 |
| 45 | 3300047472 | Ga0495686_0000004 | Ga0495686_0000004_758072_759397 | 422 |
| 46 | 3300005329 | Ga0070683_100013392 | Ga0070683_1000133923 | 423 |
| 47 | 3300005535 | Ga0070684_100025867 | Ga0070684_1000258672 | 423 |
| 48 | 3300005539 | Ga0068853_100120197 | Ga0068853_1001201972 | 423 |
| 49 | 3300005563 | Ga0068855_100000556 | Ga0068855_10000055625 | 423 |
| 50 | 3300005563 | Ga0068855_100156418 | Ga0068855_1001564182 | 423 |
| 51 | 3300005577 | Ga0068857_100035129 | Ga0068857_1000351293 | 423 |
| 52 | 3300005614 | Ga0068856_100133076 | Ga0068856_1001330762 | 423 |
| 53 | 3300009093 | Ga0105240_10009161 | Ga0105240_100091612 | 423 |
| 54 | 3300009093 | Ga0105240_10014211 | Ga0105240_100142118 | 423 |
| 55 | 3300009545 | Ga0105237_10003761 | Ga0105237_1000376110 | 423 |
| 56 | 3300009545 | Ga0105237_10020484 | Ga0105237_100204843 | 423 |
| 57 | 3300010375 | Ga0105239_10090349 | Ga0105239_100903493 | 423 |
| 58 | 3300013104 | Ga0157370_10029690 | Ga0157370_100296903 | 423 |
| 59 | 3300025913 | Ga0207695_10000110 | Ga0207695_100001106 | 423 |
| 60 | 3300025944 | Ga0207661_10018857 | Ga0207661_100188573 | 423 |
| 61 | 3300025949 | Ga0207667_10000098 | Ga0207667_1000009816 | 423 |
| 62 | 3300025949 | Ga0207667_10000926 | Ga0207667_100009263 | 423 |
| 63 | 3300026078 | Ga0207702_10103612 | Ga0207702_101036122 | 423 |
| 64 | 3300026116 | Ga0207674_10007910 | Ga0207674_100079106 | 423 |
| 65 | 3300028786 | Ga0307517_10067908 | Ga0307517_100679083 | 423 |
| 66 | 3300031251 | Ga0265327_10008285 | Ga0265327_100082855 | 423 |
| 67 | 3300044658 | Ga0466972_0011566 | Ga0466972_0011566_1588_2997 | 423 |
| 68 | 3300005356 | Ga0070674_100034724 | Ga0070674_1000347242 | 424 |
| 69 | 3300005563 | Ga0068855_100064607 | Ga0068855_1000646072 | 424 |
| 70 | 3300005577 | Ga0068857_100003443 | Ga0068857_1000034434 | 424 |
| 71 | 3300005578 | Ga0068854_100006457 | Ga0068854_1000064574 | 424 |
| 72 | 3300005616 | Ga0068852_100005907 | Ga0068852_1000059074 | 424 |
| 73 | 3300005843 | Ga0068860_100001898 | Ga0068860_1000018982 | 424 |
| 74 | 3300005843 | Ga0068860_100130323 | Ga0068860_1001303233 | 424 |
| 75 | 3300009093 | Ga0105240_10004944 | Ga0105240_100049447 | 424 |
| 76 | 3300009093 | Ga0105240_10020572 | Ga0105240_100205724 | 424 |
| 77 | 3300009545 | Ga0105237_10001507 | Ga0105237_1000150719 | 424 |
| 78 | 3300009551 | Ga0105238_10007423 | Ga0105238_100074237 | 424 |
| 79 | 3300010375 | Ga0105239_10157831 | Ga0105239_101578312 | 424 |
| 80 | 3300013104 | Ga0157370_10042465 | Ga0157370_100424653 | 424 |
| 81 | 3300013105 | Ga0157369_10080716 | Ga0157369_100807162 | 424 |
| 82 | 3300013307 | Ga0157372_10000894 | Ga0157372_100008946 | 424 |
| 83 | 3300025913 | Ga0207695_10008031 | Ga0207695_100080312 | 424 |
| 84 | 3300025913 | Ga0207695_10166590 | Ga0207695_101665902 | 424 |
| 85 | 3300025913 | Ga0207695_10190792 | Ga0207695_101907922 | 424 |
| 86 | 3300025924 | Ga0207694_10013429 | Ga0207694_100134293 | 424 |
| 87 | 3300025942 | Ga0207689_10025756 | Ga0207689_100257564 | 424 |
| 88 | 3300025949 | Ga0207667_10002398 | Ga0207667_100023984 | 424 |
| 89 | 3300025981 | Ga0207640_10016538 | Ga0207640_100165383 | 424 |
| 90 | 3300026118 | Ga0207675_100003900 | Ga0207675_1000039005 | 424 |
| 91 | 3300026142 | Ga0207698_10031547 | Ga0207698_100315473 | 424 |
| 92 | 3300028381 | Ga0268264_10008273 | Ga0268264_100082733 | 424 |
| 93 | 3300031251 | Ga0265327_10000316 | Ga0265327_1000031660 | 424 |
| 94 | 3300005336 | Ga0070680_100000819 | Ga0070680_10000081911 | 425 |
| 95 | 3300005337 | Ga0070682_100020371 | Ga0070682_1000203714 | 425 |
| 96 | 3300005341 | Ga0070691_10018505 | Ga0070691_100185052 | 425 |
| 97 | 3300005458 | Ga0070681_10176847 | Ga0070681_101768471 | 425 |
| 98 | 3300005530 | Ga0070679_100142523 | Ga0070679_1001425232 | 425 |
| 99 | 3300005539 | Ga0068853_100012711 | Ga0068853_1000127115 | 425 |
| 100 | 3300005547 | Ga0070693_100032663 | Ga0070693_1000326632 | 425 |
| 101 | 3300009093 | Ga0105240_10013501 | Ga0105240_1001350110 | 425 |
| 102 | 3300009174 | Ga0105241_10000299 | Ga0105241_100002991 | 425 |
| 103 | 3300025911 | Ga0207654_10012775 | Ga0207654_100127754 | 425 |
| 104 | 3300025913 | Ga0207695_10022580 | Ga0207695_100225802 | 425 |
| 105 | 3300025917 | Ga0207660_10029454 | Ga0207660_100294541 | 425 |
| 106 | 3300025921 | Ga0207652_10007289 | Ga0207652_100072891 | 425 |
| 107 | 3300025949 | Ga0207667_10181280 | Ga0207667_101812803 | 425 |
| 108 | 3300026041 | Ga0207639_10023150 | Ga0207639_100231504 | 425 |
| 109 | 3300049571 | Ga0501034_0226073 | Ga0501034_0226073_232_1590 | 425 |
| 110 | 3300049586 | Ga0501070_0024601 | Ga0501070_0024601_3127_4485 | 425 |
| 111 | 3300049589 | Ga0501073_0017835 | Ga0501073_0017835_145_1503 | 425 |
| 112 | 3300054114 | Ga0501084_0005233 | Ga0501084_0005233_1402_2760 | 425 |
| 113 | 3300005548 | Ga0070665_100000014 | Ga0070665_100000014288 | 426 |
| 114 | 3300005844 | Ga0068862_100168814 | Ga0068862_1001688142 | 426 |
| 115 | 3300005983 | Ga0081540_1025198 | Ga0081540_10251983 | 426 |
| 116 | 3300009545 | Ga0105237_10108178 | Ga0105237_101081782 | 426 |
| 117 | 3300013307 | Ga0157372_10140157 | Ga0157372_101401573 | 426 |
| 118 | 3300025914 | Ga0207671_10065202 | Ga0207671_100652022 | 426 |
| 119 | 3300028379 | Ga0268266_10000068 | Ga0268266_10000068146 | 426 |
| 120 | 3300005293 | Ga0065715_10158521 | Ga0065715_101585212 | 427 |
| 121 | 3300005338 | Ga0068868_100075038 | Ga0068868_1000750382 | 427 |
| 122 | 3300005457 | Ga0070662_100000045 | Ga0070662_10000004512 | 427 |
| 123 | 3300006880 | Ga0075429_100131873 | Ga0075429_1001318732 | 427 |
| 124 | 3300009147 | Ga0114129_10067485 | Ga0114129_100674852 | 427 |
| 125 | 3300009174 | Ga0105241_10000796 | Ga0105241_1000079611 | 427 |
| 126 | 3300013100 | Ga0157373_10033350 | Ga0157373_100333502 | 427 |
| 127 | 3300013102 | Ga0157371_10148904 | Ga0157371_101489042 | 427 |
| 128 | 3300013296 | Ga0157374_10005314 | Ga0157374_100053142 | 427 |
| 129 | 3300013307 | Ga0157372_10072620 | Ga0157372_100726202 | 427 |
| 130 | 3300013308 | Ga0157375_10003434 | Ga0157375_100034346 | 427 |
| 131 | 3300014745 | Ga0157377_10005020 | Ga0157377_100050203 | 427 |
| 132 | 3300014745 | Ga0157377_10021089 | Ga0157377_100210892 | 427 |
| 133 | 3300025904 | Ga0207647_10000511 | Ga0207647_100005113 | 427 |
| 134 | 3300025911 | Ga0207654_10000585 | Ga0207654_100005859 | 427 |
| 135 | 3300025933 | Ga0207706_10000120 | Ga0207706_1000012054 | 427 |
| 136 | 3300026116 | Ga0207674_10034726 | Ga0207674_100347262 | 427 |
| 137 | 3300031247 | Ga0265340_10047318 | Ga0265340_100473182 | 427 |
| 138 | 3300050508 | nmdc:mga09592_63121_c1 | nmdc:mga09592_63121_c1_1069_2406 | 427 |
| 139 | 3300005290 | Ga0065712_10011412 | Ga0065712_100114122 | 428 |
| 140 | 3300005295 | Ga0065707_10006808 | Ga0065707_100068083 | 428 |
| 141 | 3300005328 | Ga0070676_10028857 | Ga0070676_100288571 | 428 |
| 142 | 3300005353 | Ga0070669_100139037 | Ga0070669_1001390372 | 428 |
| 143 | 3300005365 | Ga0070688_100082487 | Ga0070688_1000824872 | 428 |
| 144 | 3300005543 | Ga0070672_100151274 | Ga0070672_1001512742 | 428 |
| 145 | 3300005549 | Ga0070704_100149514 | Ga0070704_1001495142 | 428 |
| 146 | 3300005577 | Ga0068857_100105948 | Ga0068857_1001059482 | 428 |
| 147 | 3300005614 | Ga0068856_100025925 | Ga0068856_1000259252 | 428 |
| 148 | 3300005617 | Ga0068859_100082667 | Ga0068859_1000826672 | 428 |
| 149 | 3300005844 | Ga0068862_100114698 | Ga0068862_1001146982 | 428 |
| 150 | 3300006931 | Ga0097620_100082662 | Ga0097620_1000826622 | 428 |
| 151 | 3300009093 | Ga0105240_10000998 | Ga0105240_1000099821 | 428 |
| 152 | 3300009174 | Ga0105241_10001899 | Ga0105241_100018995 | 428 |
| 153 | 3300009551 | Ga0105238_10000790 | Ga0105238_1000079011 | 428 |
| 154 | 3300010375 | Ga0105239_10025660 | Ga0105239_100256605 | 428 |
| 155 | 3300013306 | Ga0163162_10002374 | Ga0163162_1000237413 | 428 |
| 156 | 3300013308 | Ga0157375_10003913 | Ga0157375_1000391310 | 428 |
| 157 | 3300025315 | Ga0207697_10020282 | Ga0207697_100202822 | 428 |
| 158 | 3300025911 | Ga0207654_10030053 | Ga0207654_100300532 | 428 |
| 159 | 3300025913 | Ga0207695_10001344 | Ga0207695_1000134421 | 428 |
| 160 | 3300025914 | Ga0207671_10009040 | Ga0207671_100090406 | 428 |
| 161 | 3300025923 | Ga0207681_10088551 | Ga0207681_100885512 | 428 |
| 162 | 3300025924 | Ga0207694_10004366 | Ga0207694_100043665 | 428 |
| 163 | 3300025940 | Ga0207691_10118175 | Ga0207691_101181753 | 428 |
| 164 | 3300025972 | Ga0207668_10149718 | Ga0207668_101497182 | 428 |
| 165 | 3300027907 | Ga0207428_10021810 | Ga0207428_100218105 | 428 |
| 166 | 3300028380 | Ga0268265_10135862 | Ga0268265_101358622 | 428 |
| 167 | 3300047443 | Ga0495687_001156 | Ga0495687_001156_15038_16363 | 428 |
| 168 | 3300005335 | Ga0070666_10106974 | Ga0070666_101069741 | 429 |
| 169 | 3300005539 | Ga0068853_100072551 | Ga0068853_1000725512 | 429 |
| 170 | 3300005616 | Ga0068852_100188113 | Ga0068852_1001881132 | 429 |
| 171 | 3300025903 | Ga0207680_10090071 | Ga0207680_100900711 | 429 |
| 172 | 3300026041 | Ga0207639_10105225 | Ga0207639_101052252 | 429 |
| 173 | 3300006195 | Ga0075366_10024404 | Ga0075366_100244042 | 430 |
| 174 | 3300009553 | Ga0105249_10068632 | Ga0105249_100686322 | 430 |
| 175 | 3300025961 | Ga0207712_10050898 | Ga0207712_100508981 | 430 |
| 176 | 3300044658 | Ga0466972_0000123 | Ga0466972_0000123_39025_40362 | 430 |
| 177 | 3300046460 | Ga0495638_0011155 | Ga0495638_0011155_2278_3642 | 430 |
| 178 | 3300046524 | Ga0495648_0005768 | Ga0495648_0005768_1044_2408 | 430 |
| 179 | 3300053092 | Ga0500583_0006433 | Ga0500583_0006433_2600_3964 | 430 |
| 180 | 3300053156 | Ga0500622_0000398 | Ga0500622_0000398_32626_33990 | 430 |
| 181 | 3300005290 | Ga0065712_10090253 | Ga0065712_100902532 | 431 |
| 182 | 3300005328 | Ga0070676_10051846 | Ga0070676_100518462 | 431 |
| 183 | 3300005354 | Ga0070675_100126483 | Ga0070675_1001264832 | 431 |
| 184 | 3300005577 | Ga0068857_100260931 | Ga0068857_1002609311 | 431 |
| 185 | 3300006195 | Ga0075366_10000467 | Ga0075366_100004678 | 431 |
| 186 | 3300013102 | Ga0157371_10050290 | Ga0157371_100502902 | 431 |
| 187 | 3300013105 | Ga0157369_10209501 | Ga0157369_102095012 | 431 |
| 188 | 3300013307 | Ga0157372_10144383 | Ga0157372_101443833 | 431 |
| 189 | 3300025907 | Ga0207645_10001491 | Ga0207645_1000149113 | 431 |
| 190 | 3300025926 | Ga0207659_10095290 | Ga0207659_100952902 | 431 |
| 191 | 3300025933 | Ga0207706_10047228 | Ga0207706_100472283 | 431 |
| 192 | 3300025942 | Ga0207689_10002462 | Ga0207689_1000246210 | 431 |
| 193 | 3300030521 | Ga0307511_10000382 | Ga0307511_1000038222 | 431 |
| 194 | 3300046460 | Ga0495638_0079173 | Ga0495638_0079173_308_1633 | 431 |
| 195 | 3300050493 | nmdc:mga0k408_14037_c1 | nmdc:mga0k408_14037_c1_1294_2619 | 431 |
| 196 | 3300050493 | nmdc:mga0k408_6554_c1 | nmdc:mga0k408_6554_c1_1497_2888 | 431 |
| 197 | 3300005331 | Ga0070670_100024231 | Ga0070670_1000242313 | 432 |
| 198 | 3300005335 | Ga0070666_10005046 | Ga0070666_100050465 | 432 |
| 199 | 3300005338 | Ga0068868_100005340 | Ga0068868_1000053403 | 432 |
| 200 | 3300005347 | Ga0070668_100074075 | Ga0070668_1000740752 | 432 |
| 201 | 3300005353 | Ga0070669_100051338 | Ga0070669_1000513383 | 432 |
| 202 | 3300005456 | Ga0070678_100013581 | Ga0070678_1000135813 | 432 |
| 203 | 3300005539 | Ga0068853_100001722 | Ga0068853_1000017222 | 432 |
| 204 | 3300005543 | Ga0070672_100051207 | Ga0070672_1000512072 | 432 |
| 205 | 3300005548 | Ga0070665_100000020 | Ga0070665_100000020216 | 432 |
| 206 | 3300005843 | Ga0068860_100067376 | Ga0068860_1000673763 | 432 |
| 207 | 3300006237 | Ga0097621_100030561 | Ga0097621_1000305613 | 432 |
| 208 | 3300006358 | Ga0068871_100010670 | Ga0068871_1000106704 | 432 |
| 209 | 3300006881 | Ga0068865_100012493 | Ga0068865_1000124932 | 432 |
| 210 | 3300009553 | Ga0105249_10055078 | Ga0105249_100550782 | 432 |
| 211 | 3300013296 | Ga0157374_10034609 | Ga0157374_100346094 | 432 |
| 212 | 3300013297 | Ga0157378_10015277 | Ga0157378_100152773 | 432 |
| 213 | 3300013306 | Ga0163162_10000032 | Ga0163162_1000003238 | 432 |
| 214 | 3300014969 | Ga0157376_10120433 | Ga0157376_101204332 | 432 |
| 215 | 3300025315 | Ga0207697_10023474 | Ga0207697_100234743 | 432 |
| 216 | 3300025899 | Ga0207642_10002442 | Ga0207642_100024423 | 432 |
| 217 | 3300025926 | Ga0207659_10016624 | Ga0207659_100166242 | 432 |
| 218 | 3300025938 | Ga0207704_10014507 | Ga0207704_100145073 | 432 |
| 219 | 3300025940 | Ga0207691_10009018 | Ga0207691_100090183 | 432 |
| 220 | 3300025972 | Ga0207668_10019504 | Ga0207668_100195043 | 432 |
| 221 | 3300026089 | Ga0207648_10006750 | Ga0207648_100067506 | 432 |
| 222 | 3300026121 | Ga0207683_10020939 | Ga0207683_100209393 | 432 |
| 223 | 3300026142 | Ga0207698_10124249 | Ga0207698_101242492 | 432 |
| 224 | 3300028379 | Ga0268266_10000018 | Ga0268266_10000018293 | 432 |
| 225 | 3300028381 | Ga0268264_10081343 | Ga0268264_100813433 | 432 |
| 226 | 3300003323 | rootH1_10278369 | rootH1_102783691 | 433 |
| 227 | 3300005614 | Ga0068856_100165564 | Ga0068856_1001655642 | 433 |
| 228 | 3300005616 | Ga0068852_100180968 | Ga0068852_1001809681 | 433 |
| 229 | 3300013306 | Ga0163162_10003819 | Ga0163162_100038196 | 433 |
| 230 | 3300026078 | Ga0207702_10135432 | Ga0207702_101354322 | 433 |
| 231 | 3300047443 | Ga0495687_000564 | Ga0495687_000564_31528_32886 | 433 |
| 232 | 3300049571 | Ga0501034_0000004 | Ga0501034_0000004_62855_64177 | 433 |
| 233 | 3300031616 | Ga0307508_10000636 | Ga0307508_1000063623 | 434 |
| 234 | 3300031616 | Ga0307508_10057994 | Ga0307508_100579941 | 434 |
| 235 | 3300005843 | Ga0068860_100003705 | Ga0068860_1000037055 | 435 |
| 236 | 3300006844 | Ga0075428_100078646 | Ga0075428_1000786462 | 435 |
| 237 | 3300006846 | Ga0075430_100002220 | Ga0075430_10000222011 | 435 |
| 238 | 3300028380 | Ga0268265_10026320 | Ga0268265_100263201 | 435 |
| 239 | 3300031507 | Ga0307509_10060375 | Ga0307509_100603752 | 435 |
| 240 | 3300041406 | Ga0439439_0024979 | Ga0439439_0024979_136_1467 | 435 |
| 241 | 3300005334 | Ga0068869_100001574 | Ga0068869_1000015749 | 436 |
| 242 | 3300005618 | Ga0068864_100096577 | Ga0068864_1000965772 | 436 |
| 243 | 3300025918 | Ga0207662_10099105 | Ga0207662_100991052 | 436 |
| 244 | 3300005290 | Ga0065712_10014996 | Ga0065712_100149962 | 437 |
| 245 | 3300005330 | Ga0070690_100025347 | Ga0070690_1000253474 | 437 |
| 246 | 3300005331 | Ga0070670_100067995 | Ga0070670_1000679952 | 437 |
| 247 | 3300005331 | Ga0070670_100074745 | Ga0070670_1000747452 | 437 |
| 248 | 3300005334 | Ga0068869_100073718 | Ga0068869_1000737182 | 437 |
| 249 | 3300005355 | Ga0070671_100083476 | Ga0070671_1000834762 | 437 |
| 250 | 3300005355 | Ga0070671_100106419 | Ga0070671_1001064192 | 437 |
| 251 | 3300005367 | Ga0070667_100149431 | Ga0070667_1001494312 | 437 |
| 252 | 3300005438 | Ga0070701_10048654 | Ga0070701_100486541 | 437 |
| 253 | 3300005459 | Ga0068867_100045251 | Ga0068867_1000452513 | 437 |
| 254 | 3300005459 | Ga0068867_100069205 | Ga0068867_1000692053 | 437 |
| 255 | 3300005544 | Ga0070686_100054756 | Ga0070686_1000547562 | 437 |
| 256 | 3300005564 | Ga0070664_100029202 | Ga0070664_1000292025 | 437 |
| 257 | 3300006237 | Ga0097621_100003375 | Ga0097621_1000033756 | 437 |
| 258 | 3300006358 | Ga0068871_100005284 | Ga0068871_1000052846 | 437 |
| 259 | 3300009148 | Ga0105243_10021225 | Ga0105243_100212253 | 437 |
| 260 | 3300009545 | Ga0105237_10036510 | Ga0105237_100365103 | 437 |
| 261 | 3300010375 | Ga0105239_10005789 | Ga0105239_100057896 | 437 |
| 262 | 3300010375 | Ga0105239_10009377 | Ga0105239_100093778 | 437 |
| 263 | 3300013100 | Ga0157373_10003779 | Ga0157373_100037799 | 437 |
| 264 | 3300013102 | Ga0157371_10067188 | Ga0157371_100671881 | 437 |
| 265 | 3300013297 | Ga0157378_10073638 | Ga0157378_100736383 | 437 |
| 266 | 3300013297 | Ga0157378_10334359 | Ga0157378_103343591 | 437 |
| 267 | 3300013307 | Ga0157372_10006151 | Ga0157372_100061514 | 437 |
| 268 | 3300013307 | Ga0157372_10059279 | Ga0157372_100592794 | 437 |
| 269 | 3300014968 | Ga0157379_10065388 | Ga0157379_100653883 | 437 |
| 270 | 3300025914 | Ga0207671_10001885 | Ga0207671_1000188512 | 437 |
| 271 | 3300025914 | Ga0207671_10002532 | Ga0207671_1000253217 | 437 |
| 272 | 3300025914 | Ga0207671_10039592 | Ga0207671_100395922 | 437 |
| 273 | 3300025925 | Ga0207650_10006464 | Ga0207650_100064642 | 437 |
| 274 | 3300025925 | Ga0207650_10028226 | Ga0207650_100282262 | 437 |
| 275 | 3300025935 | Ga0207709_10044636 | Ga0207709_100446362 | 437 |
| 276 | 3300025940 | Ga0207691_10058709 | Ga0207691_100587094 | 437 |
| 277 | 3300025942 | Ga0207689_10013593 | Ga0207689_100135932 | 437 |
| 278 | 3300025945 | Ga0207679_10005163 | Ga0207679_100051634 | 437 |
| 279 | 3300025949 | Ga0207667_10181850 | Ga0207667_101818502 | 437 |
| 280 | 3300025960 | Ga0207651_10007887 | Ga0207651_100078874 | 437 |
| 281 | 3300026023 | Ga0207677_10018271 | Ga0207677_100182712 | 437 |
| 282 | 3300026089 | Ga0207648_10027226 | Ga0207648_100272263 | 437 |
| 283 | 3300026089 | Ga0207648_10027988 | Ga0207648_100279883 | 437 |
| 284 | 3300046471 | Ga0495650_0020244 | Ga0495650_0020244_782_2104 | 437 |
| 285 | 3300046507 | Ga0495606_0041576 | Ga0495606_0041576_1225_2547 | 437 |
| 286 | 3300046513 | Ga0495616_0000819 | Ga0495616_0000819_15539_16861 | 437 |
| 287 | 3300046660 | Ga0495625_0003156 | Ga0495625_0003156_5214_6536 | 437 |
| 288 | 3300047472 | Ga0495686_0000154 | Ga0495686_0000154_115923_117245 | 437 |
| 289 | 3300047472 | Ga0495686_0011013 | Ga0495686_0011013_3968_5290 | 437 |
| 290 | 3300049459 | Ga0495678_063545 | Ga0495678_063545_36_1358 | 437 |
| 291 | 3300053139 | Ga0500568_0001404 | Ga0500568_0001404_260_1582 | 437 |
| 292 | 3300053157 | Ga0500624_000199 | Ga0500624_000199_10452_11774 | 437 |
| 293 | 3300003203 | JGI25406J46586_10022917 | JGI25406J46586_100229171 | 438 |
| 294 | 3300003316 | rootH1_10045334 | rootH1_100453342 | 438 |
| 295 | 3300003320 | rootH2_10001891 | rootH2_10001891207 | 438 |
| 296 | 3300003320 | rootH2_10053878 | rootH2_100538787 | 438 |
| 297 | 3300003320 | rootH2_10206634 | rootH2_102066342 | 438 |
| 298 | 3300003320 | rootH2_10218880 | rootH2_102188804 | 438 |
| 299 | 3300003323 | rootH1_10031468 | rootH1_100314681 | 438 |
| 300 | 3300005288 | Ga0065714_10070154 | Ga0065714_100701543 | 438 |
| 301 | 3300005327 | Ga0070658_10001676 | Ga0070658_1000167612 | 438 |
| 302 | 3300005327 | Ga0070658_10020971 | Ga0070658_100209713 | 438 |
| 303 | 3300005327 | Ga0070658_10183672 | Ga0070658_101836721 | 438 |
| 304 | 3300005328 | Ga0070676_10004075 | Ga0070676_100040753 | 438 |
| 305 | 3300005330 | Ga0070690_100083218 | Ga0070690_1000832182 | 438 |
| 306 | 3300005331 | Ga0070670_100039614 | Ga0070670_1000396142 | 438 |
| 307 | 3300005334 | Ga0068869_100015579 | Ga0068869_1000155793 | 438 |
| 308 | 3300005334 | Ga0068869_100046810 | Ga0068869_1000468102 | 438 |
| 309 | 3300005335 | Ga0070666_10000050 | Ga0070666_100000504 | 438 |
| 310 | 3300005335 | Ga0070666_10077082 | Ga0070666_100770822 | 438 |
| 311 | 3300005336 | Ga0070680_100041824 | Ga0070680_1000418242 | 438 |
| 312 | 3300005338 | Ga0068868_100000112 | Ga0068868_10000011228 | 438 |
| 313 | 3300005339 | Ga0070660_100020983 | Ga0070660_1000209832 | 438 |
| 314 | 3300005347 | Ga0070668_100000110 | Ga0070668_10000011012 | 438 |
| 315 | 3300005354 | Ga0070675_100051952 | Ga0070675_1000519522 | 438 |
| 316 | 3300005355 | Ga0070671_100011381 | Ga0070671_1000113812 | 438 |
| 317 | 3300005355 | Ga0070671_100145952 | Ga0070671_1001459522 | 438 |
| 318 | 3300005364 | Ga0070673_100000305 | Ga0070673_1000003059 | 438 |
| 319 | 3300005364 | Ga0070673_100000400 | Ga0070673_1000004005 | 438 |
| 320 | 3300005366 | Ga0070659_100176527 | Ga0070659_1001765272 | 438 |
| 321 | 3300005367 | Ga0070667_100013900 | Ga0070667_1000139003 | 438 |
| 322 | 3300005367 | Ga0070667_100016746 | Ga0070667_1000167465 | 438 |
| 323 | 3300005367 | Ga0070667_100091034 | Ga0070667_1000910342 | 438 |
| 324 | 3300005455 | Ga0070663_100015831 | Ga0070663_1000158315 | 438 |
| 325 | 3300005456 | Ga0070678_100007009 | Ga0070678_1000070092 | 438 |
| 326 | 3300005456 | Ga0070678_100103501 | Ga0070678_1001035012 | 438 |
| 327 | 3300005458 | Ga0070681_10030115 | Ga0070681_100301153 | 438 |
| 328 | 3300005458 | Ga0070681_10047701 | Ga0070681_100477014 | 438 |
| 329 | 3300005459 | Ga0068867_100000519 | Ga0068867_1000005192 | 438 |
| 330 | 3300005459 | Ga0068867_100000620 | Ga0068867_10000062018 | 438 |
| 331 | 3300005530 | Ga0070679_100012671 | Ga0070679_1000126715 | 438 |
| 332 | 3300005530 | Ga0070679_100093594 | Ga0070679_1000935942 | 438 |
| 333 | 3300005539 | Ga0068853_100003764 | Ga0068853_1000037643 | 438 |
| 334 | 3300005539 | Ga0068853_100023333 | Ga0068853_1000233334 | 438 |
| 335 | 3300005543 | Ga0070672_100000020 | Ga0070672_10000002047 | 438 |
| 336 | 3300005548 | Ga0070665_100000318 | Ga0070665_10000031812 | 438 |
| 337 | 3300005563 | Ga0068855_100001120 | Ga0068855_10000112010 | 438 |
| 338 | 3300005563 | Ga0068855_100019483 | Ga0068855_1000194837 | 438 |
| 339 | 3300005563 | Ga0068855_100110113 | Ga0068855_1001101132 | 438 |
| 340 | 3300005563 | Ga0068855_100132637 | Ga0068855_1001326372 | 438 |
| 341 | 3300005577 | Ga0068857_100112444 | Ga0068857_1001124442 | 438 |
| 342 | 3300005614 | Ga0068856_100000359 | Ga0068856_10000035925 | 438 |
| 343 | 3300005614 | Ga0068856_100013339 | Ga0068856_1000133393 | 438 |
| 344 | 3300005614 | Ga0068856_100027095 | Ga0068856_1000270952 | 438 |
| 345 | 3300005614 | Ga0068856_100124977 | Ga0068856_1001249773 | 438 |
| 346 | 3300005616 | Ga0068852_100001345 | Ga0068852_10000134511 | 438 |
| 347 | 3300005616 | Ga0068852_100009804 | Ga0068852_1000098042 | 438 |
| 348 | 3300005616 | Ga0068852_100020291 | Ga0068852_1000202912 | 438 |
| 349 | 3300005617 | Ga0068859_100000025 | Ga0068859_100000025173 | 438 |
| 350 | 3300005618 | Ga0068864_100000392 | Ga0068864_1000003929 | 438 |
| 351 | 3300005618 | Ga0068864_100027917 | Ga0068864_1000279174 | 438 |
| 352 | 3300005719 | Ga0068861_100009832 | Ga0068861_1000098323 | 438 |
| 353 | 3300005834 | Ga0068851_10006000 | Ga0068851_100060002 | 438 |
| 354 | 3300005841 | Ga0068863_100002244 | Ga0068863_10000224416 | 438 |
| 355 | 3300005841 | Ga0068863_100011055 | Ga0068863_1000110553 | 438 |
| 356 | 3300005841 | Ga0068863_100016345 | Ga0068863_1000163453 | 438 |
| 357 | 3300005842 | Ga0068858_100000342 | Ga0068858_10000034218 | 438 |
| 358 | 3300005842 | Ga0068858_100197746 | Ga0068858_1001977462 | 438 |
| 359 | 3300005843 | Ga0068860_100000061 | Ga0068860_10000006185 | 438 |
| 360 | 3300005843 | Ga0068860_100002976 | Ga0068860_10000297613 | 438 |
| 361 | 3300005843 | Ga0068860_100004130 | Ga0068860_1000041303 | 438 |
| 362 | 3300005843 | Ga0068860_100007522 | Ga0068860_1000075223 | 438 |
| 363 | 3300005843 | Ga0068860_100008934 | Ga0068860_1000089347 | 438 |
| 364 | 3300005843 | Ga0068860_100021106 | Ga0068860_1000211065 | 438 |
| 365 | 3300005985 | Ga0081539_10003031 | Ga0081539_1000303114 | 438 |
| 366 | 3300006237 | Ga0097621_100004382 | Ga0097621_1000043829 | 438 |
| 367 | 3300006237 | Ga0097621_100005541 | Ga0097621_1000055412 | 438 |
| 368 | 3300006237 | Ga0097621_100017205 | Ga0097621_1000172053 | 438 |
| 369 | 3300006237 | Ga0097621_100068666 | Ga0097621_1000686663 | 438 |
| 370 | 3300006358 | Ga0068871_100000100 | Ga0068871_10000010012 | 438 |
| 371 | 3300006358 | Ga0068871_100014817 | Ga0068871_1000148175 | 438 |
| 372 | 3300006847 | Ga0075431_100000819 | Ga0075431_10000081910 | 438 |
| 373 | 3300006880 | Ga0075429_100023162 | Ga0075429_1000231623 | 438 |
| 374 | 3300006881 | Ga0068865_100000174 | Ga0068865_10000017417 | 438 |
| 375 | 3300006881 | Ga0068865_100004637 | Ga0068865_1000046374 | 438 |
| 376 | 3300006931 | Ga0097620_100000025 | Ga0097620_100000025173 | 438 |
| 377 | 3300009093 | Ga0105240_10000674 | Ga0105240_1000067420 | 438 |
| 378 | 3300009093 | Ga0105240_10001351 | Ga0105240_1000135112 | 438 |
| 379 | 3300009093 | Ga0105240_10022499 | Ga0105240_100224997 | 438 |
| 380 | 3300009093 | Ga0105240_10029462 | Ga0105240_100294625 | 438 |
| 381 | 3300009093 | Ga0105240_10061084 | Ga0105240_100610843 | 438 |
| 382 | 3300009093 | Ga0105240_10182316 | Ga0105240_101823161 | 438 |
| 383 | 3300009101 | Ga0105247_10001380 | Ga0105247_1000138012 | 438 |
| 384 | 3300009101 | Ga0105247_10015255 | Ga0105247_100152553 | 438 |
| 385 | 3300009147 | Ga0114129_10104783 | Ga0114129_101047833 | 438 |
| 386 | 3300009148 | Ga0105243_10082364 | Ga0105243_100823642 | 438 |
| 387 | 3300009148 | Ga0105243_10148018 | Ga0105243_101480181 | 438 |
| 388 | 3300009174 | Ga0105241_10000688 | Ga0105241_1000068811 | 438 |
| 389 | 3300009174 | Ga0105241_10000761 | Ga0105241_1000076112 | 438 |
| 390 | 3300009174 | Ga0105241_10007361 | Ga0105241_100073611 | 438 |
| 391 | 3300009176 | Ga0105242_10016013 | Ga0105242_100160132 | 438 |
| 392 | 3300009545 | Ga0105237_10001169 | Ga0105237_1000116911 | 438 |
| 393 | 3300009545 | Ga0105237_10010656 | Ga0105237_100106565 | 438 |
| 394 | 3300009545 | Ga0105237_10048101 | Ga0105237_100481012 | 438 |
| 395 | 3300009545 | Ga0105237_10086948 | Ga0105237_100869482 | 438 |
| 396 | 3300009545 | Ga0105237_10116674 | Ga0105237_101166743 | 438 |
| 397 | 3300009551 | Ga0105238_10014765 | Ga0105238_100147653 | 438 |
| 398 | 3300009551 | Ga0105238_10105735 | Ga0105238_101057352 | 438 |
| 399 | 3300009553 | Ga0105249_10109333 | Ga0105249_101093332 | 438 |
| 400 | 3300010375 | Ga0105239_10001545 | Ga0105239_100015457 | 438 |
| 401 | 3300010375 | Ga0105239_10011830 | Ga0105239_100118303 | 438 |
| 402 | 3300010375 | Ga0105239_10027242 | Ga0105239_100272424 | 438 |
| 403 | 3300010375 | Ga0105239_10096610 | Ga0105239_100966102 | 438 |
| 404 | 3300010375 | Ga0105239_10136292 | Ga0105239_101362923 | 438 |
| 405 | 3300011119 | Ga0105246_10063544 | Ga0105246_100635442 | 438 |
| 406 | 3300013102 | Ga0157371_10005572 | Ga0157371_1000557213 | 438 |
| 407 | 3300013102 | Ga0157371_10010957 | Ga0157371_100109578 | 438 |
| 408 | 3300013104 | Ga0157370_10000673 | Ga0157370_100006734 | 438 |
| 409 | 3300013104 | Ga0157370_10236500 | Ga0157370_102365002 | 438 |
| 410 | 3300013105 | Ga0157369_10041129 | Ga0157369_100411292 | 438 |
| 411 | 3300013105 | Ga0157369_10043119 | Ga0157369_100431193 | 438 |
| 412 | 3300013296 | Ga0157374_10000202 | Ga0157374_1000020225 | 438 |
| 413 | 3300013296 | Ga0157374_10002159 | Ga0157374_100021594 | 438 |
| 414 | 3300013297 | Ga0157378_10017150 | Ga0157378_100171502 | 438 |
| 415 | 3300013297 | Ga0157378_10019086 | Ga0157378_100190862 | 438 |
| 416 | 3300013297 | Ga0157378_10029790 | Ga0157378_100297902 | 438 |
| 417 | 3300013297 | Ga0157378_10046894 | Ga0157378_100468943 | 438 |
| 418 | 3300013297 | Ga0157378_10057412 | Ga0157378_100574123 | 438 |
| 419 | 3300013306 | Ga0163162_10000201 | Ga0163162_1000020122 | 438 |
| 420 | 3300013306 | Ga0163162_10000544 | Ga0163162_1000054416 | 438 |
| 421 | 3300013306 | Ga0163162_10000549 | Ga0163162_1000054921 | 438 |
| 422 | 3300013306 | Ga0163162_10009583 | Ga0163162_100095834 | 438 |
| 423 | 3300013306 | Ga0163162_10016297 | Ga0163162_100162973 | 438 |
| 424 | 3300013307 | Ga0157372_10000020 | Ga0157372_10000020153 | 438 |
| 425 | 3300013307 | Ga0157372_10005808 | Ga0157372_1000580813 | 438 |
| 426 | 3300013307 | Ga0157372_10006101 | Ga0157372_100061016 | 438 |
| 427 | 3300013307 | Ga0157372_10179157 | Ga0157372_101791572 | 438 |
| 428 | 3300013307 | Ga0157372_10347321 | Ga0157372_103473211 | 438 |
| 429 | 3300013308 | Ga0157375_10000821 | Ga0157375_1000082119 | 438 |
| 430 | 3300013308 | Ga0157375_10051002 | Ga0157375_100510023 | 438 |
| 431 | 3300013308 | Ga0157375_10161244 | Ga0157375_101612442 | 438 |
| 432 | 3300014325 | Ga0163163_10000471 | Ga0163163_100004716 | 438 |
| 433 | 3300014326 | Ga0157380_10010345 | Ga0157380_100103453 | 438 |
| 434 | 3300014326 | Ga0157380_10085268 | Ga0157380_100852682 | 438 |
| 435 | 3300014968 | Ga0157379_10000115 | Ga0157379_1000011515 | 438 |
| 436 | 3300014968 | Ga0157379_10008675 | Ga0157379_100086753 | 438 |
| 437 | 3300014969 | Ga0157376_10001273 | Ga0157376_1000127313 | 438 |
| 438 | 3300014969 | Ga0157376_10002338 | Ga0157376_100023383 | 438 |
| 439 | 3300014969 | Ga0157376_10003237 | Ga0157376_100032375 | 438 |
| 440 | 3300014969 | Ga0157376_10004628 | Ga0157376_100046282 | 438 |
| 441 | 3300014969 | Ga0157376_10092472 | Ga0157376_100924723 | 438 |
| 442 | 3300025250 | Ga0209026_1005939 | Ga0209026_10059393 | 438 |
| 443 | 3300025903 | Ga0207680_10011428 | Ga0207680_100114282 | 438 |
| 444 | 3300025904 | Ga0207647_10000321 | Ga0207647_100003217 | 438 |
| 445 | 3300025907 | Ga0207645_10000874 | Ga0207645_100008748 | 438 |
| 446 | 3300025909 | Ga0207705_10003949 | Ga0207705_100039498 | 438 |
| 447 | 3300025909 | Ga0207705_10021770 | Ga0207705_100217703 | 438 |
| 448 | 3300025909 | Ga0207705_10097985 | Ga0207705_100979852 | 438 |
| 449 | 3300025911 | Ga0207654_10001259 | Ga0207654_100012595 | 438 |
| 450 | 3300025911 | Ga0207654_10042012 | Ga0207654_100420122 | 438 |
| 451 | 3300025912 | Ga0207707_10017719 | Ga0207707_100177194 | 438 |
| 452 | 3300025912 | Ga0207707_10024725 | Ga0207707_100247254 | 438 |
| 453 | 3300025913 | Ga0207695_10001232 | Ga0207695_1000123217 | 438 |
| 454 | 3300025913 | Ga0207695_10001456 | Ga0207695_1000145629 | 438 |
| 455 | 3300025913 | Ga0207695_10009725 | Ga0207695_100097252 | 438 |
| 456 | 3300025913 | Ga0207695_10021005 | Ga0207695_100210053 | 438 |
| 457 | 3300025913 | Ga0207695_10057802 | Ga0207695_100578023 | 438 |
| 458 | 3300025913 | Ga0207695_10061337 | Ga0207695_100613373 | 438 |
| 459 | 3300025914 | Ga0207671_10000974 | Ga0207671_1000097412 | 438 |
| 460 | 3300025914 | Ga0207671_10001755 | Ga0207671_100017553 | 438 |
| 461 | 3300025914 | Ga0207671_10004604 | Ga0207671_100046042 | 438 |
| 462 | 3300025914 | Ga0207671_10006852 | Ga0207671_100068523 | 438 |
| 463 | 3300025914 | Ga0207671_10008980 | Ga0207671_100089803 | 438 |
| 464 | 3300025914 | Ga0207671_10011481 | Ga0207671_100114815 | 438 |
| 465 | 3300025914 | Ga0207671_10050802 | Ga0207671_100508022 | 438 |
| 466 | 3300025917 | Ga0207660_10008655 | Ga0207660_100086556 | 438 |
| 467 | 3300025919 | Ga0207657_10048929 | Ga0207657_100489292 | 438 |
| 468 | 3300025921 | Ga0207652_10000451 | Ga0207652_1000045110 | 438 |
| 469 | 3300025921 | Ga0207652_10017039 | Ga0207652_100170393 | 438 |
| 470 | 3300025924 | Ga0207694_10082221 | Ga0207694_100822212 | 438 |
| 471 | 3300025926 | Ga0207659_10010129 | Ga0207659_100101295 | 438 |
| 472 | 3300025931 | Ga0207644_10031264 | Ga0207644_100312642 | 438 |
| 473 | 3300025933 | Ga0207706_10033612 | Ga0207706_100336124 | 438 |
| 474 | 3300025934 | Ga0207686_10007373 | Ga0207686_100073734 | 438 |
| 475 | 3300025938 | Ga0207704_10000099 | Ga0207704_1000009923 | 438 |
| 476 | 3300025938 | Ga0207704_10006041 | Ga0207704_100060414 | 438 |
| 477 | 3300025940 | Ga0207691_10000322 | Ga0207691_1000032228 | 438 |
| 478 | 3300025941 | Ga0207711_10122791 | Ga0207711_101227913 | 438 |
| 479 | 3300025942 | Ga0207689_10007633 | Ga0207689_100076338 | 438 |
| 480 | 3300025949 | Ga0207667_10001699 | Ga0207667_1000169910 | 438 |
| 481 | 3300025949 | Ga0207667_10012033 | Ga0207667_100120337 | 438 |
| 482 | 3300025949 | Ga0207667_10013584 | Ga0207667_100135843 | 438 |
| 483 | 3300025949 | Ga0207667_10090304 | Ga0207667_100903042 | 438 |
| 484 | 3300025949 | Ga0207667_10127196 | Ga0207667_101271963 | 438 |
| 485 | 3300025960 | Ga0207651_10005272 | Ga0207651_100052723 | 438 |
| 486 | 3300025961 | Ga0207712_10019169 | Ga0207712_100191692 | 438 |
| 487 | 3300025972 | Ga0207668_10167018 | Ga0207668_101670181 | 438 |
| 488 | 3300025986 | Ga0207658_10002779 | Ga0207658_1000277915 | 438 |
| 489 | 3300025986 | Ga0207658_10027385 | Ga0207658_100273853 | 438 |
| 490 | 3300025986 | Ga0207658_10078649 | Ga0207658_100786492 | 438 |
| 491 | 3300026023 | Ga0207677_10012452 | Ga0207677_100124524 | 438 |
| 492 | 3300026023 | Ga0207677_10071755 | Ga0207677_100717552 | 438 |
| 493 | 3300026035 | Ga0207703_10000814 | Ga0207703_1000081428 | 438 |
| 494 | 3300026035 | Ga0207703_10001555 | Ga0207703_1000155514 | 438 |
| 495 | 3300026041 | Ga0207639_10015544 | Ga0207639_100155443 | 438 |
| 496 | 3300026041 | Ga0207639_10097544 | Ga0207639_100975442 | 438 |
| 497 | 3300026067 | Ga0207678_10238804 | Ga0207678_102388041 | 438 |
| 498 | 3300026078 | Ga0207702_10000161 | Ga0207702_1000016125 | 438 |
| 499 | 3300026088 | Ga0207641_10000822 | Ga0207641_1000082223 | 438 |
| 500 | 3300026088 | Ga0207641_10005620 | Ga0207641_100056208 | 438 |
| 501 | 3300026088 | Ga0207641_10023041 | Ga0207641_100230413 | 438 |
| 502 | 3300026089 | Ga0207648_10001459 | Ga0207648_100014593 | 438 |
| 503 | 3300026089 | Ga0207648_10002849 | Ga0207648_1000284913 | 438 |
| 504 | 3300026095 | Ga0207676_10004453 | Ga0207676_100044535 | 438 |
| 505 | 3300026095 | Ga0207676_10105876 | Ga0207676_101058764 | 438 |
| 506 | 3300026116 | Ga0207674_10128270 | Ga0207674_101282702 | 438 |
| 507 | 3300026121 | Ga0207683_10015784 | Ga0207683_100157844 | 438 |
| 508 | 3300026142 | Ga0207698_10017035 | Ga0207698_100170354 | 438 |
| 509 | 3300026142 | Ga0207698_10025762 | Ga0207698_100257624 | 438 |
| 510 | 3300028379 | Ga0268266_10014466 | Ga0268266_100144665 | 438 |
| 511 | 3300028381 | Ga0268264_10000079 | Ga0268264_1000007998 | 438 |
| 512 | 3300028381 | Ga0268264_10001681 | Ga0268264_1000168113 | 438 |
| 513 | 3300028381 | Ga0268264_10003159 | Ga0268264_100031592 | 438 |
| 514 | 3300028381 | Ga0268264_10008652 | Ga0268264_100086522 | 438 |
| 515 | 3300028381 | Ga0268264_10022622 | Ga0268264_100226222 | 438 |
| 516 | 3300028786 | Ga0307517_10004683 | Ga0307517_100046834 | 438 |
| 517 | 3300028794 | Ga0307515_10000162 | Ga0307515_1000016216 | 438 |
| 518 | 3300030521 | Ga0307511_10000554 | Ga0307511_1000055431 | 438 |
| 519 | 3300031456 | Ga0307513_10048179 | Ga0307513_100481794 | 438 |
| 520 | 3300031507 | Ga0307509_10042194 | Ga0307509_100421942 | 438 |
| 521 | 3300031730 | Ga0307516_10163925 | Ga0307516_101639252 | 438 |
| 522 | 3300032004 | Ga0307414_10103493 | Ga0307414_101034932 | 438 |
| 523 | 3300033180 | Ga0307510_10002326 | Ga0307510_100023266 | 438 |
| 524 | 3300033180 | Ga0307510_10010841 | Ga0307510_100108416 | 438 |
| 525 | 3300036401 | Ga0373937_0056284 | Ga0373937_0056284_2112_3449 | 438 |
| 526 | 3300037312 | Ga0395899_0000245 | Ga0395899_0000245_27705_29084 | 438 |
| 527 | 3300037312 | Ga0395899_0000629 | Ga0395899_0000629_25450_26775 | 438 |
| 528 | 3300037312 | Ga0395899_0027913 | Ga0395899_0027913_2056_3381 | 438 |
| 529 | 3300037418 | Ga0395900_0000480 | Ga0395900_0000480_22152_23477 | 438 |
| 530 | 3300037418 | Ga0395900_0040897 | Ga0395900_0040897_2290_3615 | 438 |
| 531 | 3300037418 | Ga0395900_0040897 | Ga0395900_0040897_882_2249 | 438 |
| 532 | 3300037466 | Ga0395898_0006652 | Ga0395898_0006652_1595_2920 | 438 |
| 533 | 3300037466 | Ga0395898_0090721 | Ga0395898_0090721_661_1986 | 438 |
| 534 | 3300037471 | Ga0395905_0000738 | Ga0395905_0000738_19619_20944 | 438 |
| 535 | 3300038443 | Ga0395901_0029084 | Ga0395901_0029084_2660_3985 | 438 |
| 536 | 3300038443 | Ga0395901_0083858 | Ga0395901_0083858_1136_2461 | 438 |
| 537 | 3300039447 | Ga0436361_0573832 | Ga0436361_0573832_3692_5044 | 438 |
| 538 | 3300042005 | Ga0439448_0029004 | Ga0439448_0029004_224_1552 | 438 |
| 539 | 3300042876 | Ga0451577_0074560 | Ga0451577_0074560_1015_2340 | 438 |
| 540 | 3300044658 | Ga0466972_0006738 | Ga0466972_0006738_890_2218 | 438 |
| 541 | 3300044735 | Ga0466968_0031915 | Ga0466968_0031915_540_1868 | 438 |
| 542 | 3300046460 | Ga0495638_0123592 | Ga0495638_0123592_37_1365 | 438 |
| 543 | 3300046471 | Ga0495650_0000003 | Ga0495650_0000003_557545_558873 | 438 |
| 544 | 3300046492 | Ga0495585_0001096 | Ga0495585_0001096_5599_6927 | 438 |
| 545 | 3300046506 | Ga0495583_0036359 | Ga0495583_0036359_521_1849 | 438 |
| 546 | 3300046507 | Ga0495606_0001265 | Ga0495606_0001265_32718_34046 | 438 |
| 547 | 3300046507 | Ga0495606_0005740 | Ga0495606_0005740_146_1471 | 438 |
| 548 | 3300046512 | Ga0495610_0000952 | Ga0495610_0000952_20417_21745 | 438 |
| 549 | 3300046513 | Ga0495616_0008664 | Ga0495616_0008664_1967_3295 | 438 |
| 550 | 3300046518 | Ga0495631_0013203 | Ga0495631_0013203_1657_2982 | 438 |
| 551 | 3300046648 | Ga0495611_0000209 | Ga0495611_0000209_29626_30951 | 438 |
| 552 | 3300046660 | Ga0495625_0000005 | Ga0495625_0000005_493720_495048 | 438 |
| 553 | 3300046665 | Ga0495661_0003610 | Ga0495661_0003610_2465_3793 | 438 |
| 554 | 3300046665 | Ga0495661_0010067 | Ga0495661_0010067_1503_2831 | 438 |
| 555 | 3300046691 | Ga0495670_0063520 | Ga0495670_0063520_469_1800 | 438 |
| 556 | 3300046694 | Ga0495649_0000003 | Ga0495649_0000003_674478_675806 | 438 |
| 557 | 3300047323 | Ga0495683_0018182 | Ga0495683_0018182_32_1384 | 438 |
| 558 | 3300047472 | Ga0495686_0000111 | Ga0495686_0000111_76356_77690 | 438 |
| 559 | 3300049569 | Ga0501032_0032184 | Ga0501032_0032184_574_1923 | 438 |
| 560 | 3300049570 | Ga0501033_0050505 | Ga0501033_0050505_27_1376 | 438 |
| 561 | 3300049573 | Ga0501037_0022847 | Ga0501037_0022847_162_1511 | 438 |
| 562 | 3300049581 | Ga0501047_0200722 | Ga0501047_0200722_314_1663 | 438 |
| 563 | 3300049822 | Ga0501035_0005500 | Ga0501035_0005500_5587_6936 | 438 |
| 564 | 3300050510 | nmdc:mga06r32_11498_c1 | nmdc:mga06r32_11498_c1_6571_7920 | 438 |
| 565 | 3300053125 | Ga0500618_000001 | Ga0500618_000001_306880_308205 | 438 |
| 566 | 3300053153 | Ga0500616_0012667 | Ga0500616_0012667_2580_3914 | 438 |
| 567 | 3300003316 | rootH1_10147241 | rootH1_101472413 | 439 |
| 568 | 3300003322 | rootL2_10037862 | rootL2_100378623 | 439 |
| 569 | 3300003322 | rootL2_10067458 | rootL2_100674582 | 439 |
| 570 | 3300005327 | Ga0070658_10026391 | Ga0070658_100263914 | 439 |
| 571 | 3300005329 | Ga0070683_100004423 | Ga0070683_10000442316 | 439 |
| 572 | 3300005335 | Ga0070666_10041186 | Ga0070666_100411862 | 439 |
| 573 | 3300005338 | Ga0068868_100034697 | Ga0068868_1000346974 | 439 |
| 574 | 3300005339 | Ga0070660_100070028 | Ga0070660_1000700281 | 439 |
| 575 | 3300005344 | Ga0070661_100024118 | Ga0070661_1000241182 | 439 |
| 576 | 3300005354 | Ga0070675_100096490 | Ga0070675_1000964902 | 439 |
| 577 | 3300005354 | Ga0070675_100151212 | Ga0070675_1001512122 | 439 |
| 578 | 3300005356 | Ga0070674_100018171 | Ga0070674_1000181713 | 439 |
| 579 | 3300005364 | Ga0070673_100056895 | Ga0070673_1000568952 | 439 |
| 580 | 3300005457 | Ga0070662_100027999 | Ga0070662_1000279994 | 439 |
| 581 | 3300005459 | Ga0068867_100053273 | Ga0068867_1000532731 | 439 |
| 582 | 3300005459 | Ga0068867_100213403 | Ga0068867_1002134031 | 439 |
| 583 | 3300005530 | Ga0070679_100136714 | Ga0070679_1001367142 | 439 |
| 584 | 3300005535 | Ga0070684_100037004 | Ga0070684_1000370045 | 439 |
| 585 | 3300005547 | Ga0070693_100046893 | Ga0070693_1000468931 | 439 |
| 586 | 3300005563 | Ga0068855_100000033 | Ga0068855_100000033111 | 439 |
| 587 | 3300005563 | Ga0068855_100078973 | Ga0068855_1000789732 | 439 |
| 588 | 3300005564 | Ga0070664_100058975 | Ga0070664_1000589753 | 439 |
| 589 | 3300005564 | Ga0070664_100072834 | Ga0070664_1000728342 | 439 |
| 590 | 3300005564 | Ga0070664_100141641 | Ga0070664_1001416412 | 439 |
| 591 | 3300005578 | Ga0068854_100049388 | Ga0068854_1000493883 | 439 |
| 592 | 3300005614 | Ga0068856_100081991 | Ga0068856_1000819912 | 439 |
| 593 | 3300005616 | Ga0068852_100010585 | Ga0068852_1000105852 | 439 |
| 594 | 3300005616 | Ga0068852_100151192 | Ga0068852_1001511922 | 439 |
| 595 | 3300005843 | Ga0068860_100045244 | Ga0068860_1000452442 | 439 |
| 596 | 3300005844 | Ga0068862_100183604 | Ga0068862_1001836042 | 439 |
| 597 | 3300006358 | Ga0068871_100002056 | Ga0068871_10000205615 | 439 |
| 598 | 3300009093 | Ga0105240_10000396 | Ga0105240_1000039617 | 439 |
| 599 | 3300009174 | Ga0105241_10237770 | Ga0105241_102377702 | 439 |
| 600 | 3300010375 | Ga0105239_10047136 | Ga0105239_100471362 | 439 |
| 601 | 3300010375 | Ga0105239_10063809 | Ga0105239_100638092 | 439 |
| 602 | 3300013100 | Ga0157373_10034969 | Ga0157373_100349692 | 439 |
| 603 | 3300013102 | Ga0157371_10020816 | Ga0157371_100208163 | 439 |
| 604 | 3300013102 | Ga0157371_10027048 | Ga0157371_100270482 | 439 |
| 605 | 3300013105 | Ga0157369_10008359 | Ga0157369_1000835912 | 439 |
| 606 | 3300013105 | Ga0157369_10245748 | Ga0157369_102457481 | 439 |
| 607 | 3300013296 | Ga0157374_10006821 | Ga0157374_1000682114 | 439 |
| 608 | 3300013297 | Ga0157378_10021365 | Ga0157378_100213652 | 439 |
| 609 | 3300013306 | Ga0163162_10072909 | Ga0163162_100729094 | 439 |
| 610 | 3300013307 | Ga0157372_10036860 | Ga0157372_100368602 | 439 |
| 611 | 3300013307 | Ga0157372_10078720 | Ga0157372_100787203 | 439 |
| 612 | 3300013307 | Ga0157372_10351160 | Ga0157372_103511601 | 439 |
| 613 | 3300014745 | Ga0157377_10009617 | Ga0157377_100096172 | 439 |
| 614 | 3300025907 | Ga0207645_10065610 | Ga0207645_100656102 | 439 |
| 615 | 3300025913 | Ga0207695_10000023 | Ga0207695_10000023321 | 439 |
| 616 | 3300025913 | Ga0207695_10000031 | Ga0207695_10000031250 | 439 |
| 617 | 3300025913 | Ga0207695_10022991 | Ga0207695_100229916 | 439 |
| 618 | 3300025919 | Ga0207657_10019335 | Ga0207657_100193351 | 439 |
| 619 | 3300025921 | Ga0207652_10155768 | Ga0207652_101557682 | 439 |
| 620 | 3300025926 | Ga0207659_10102738 | Ga0207659_101027381 | 439 |
| 621 | 3300025932 | Ga0207690_10154461 | Ga0207690_101544611 | 439 |
| 622 | 3300025933 | Ga0207706_10003224 | Ga0207706_100032245 | 439 |
| 623 | 3300025937 | Ga0207669_10002105 | Ga0207669_100021056 | 439 |
| 624 | 3300025937 | Ga0207669_10027965 | Ga0207669_100279653 | 439 |
| 625 | 3300025945 | Ga0207679_10039157 | Ga0207679_100391572 | 439 |
| 626 | 3300025949 | Ga0207667_10000046 | Ga0207667_10000046186 | 439 |
| 627 | 3300025960 | Ga0207651_10110153 | Ga0207651_101101532 | 439 |
| 628 | 3300026041 | Ga0207639_10006392 | Ga0207639_100063924 | 439 |
| 629 | 3300026089 | Ga0207648_10005953 | Ga0207648_100059538 | 439 |
| 630 | 3300026089 | Ga0207648_10013507 | Ga0207648_100135074 | 439 |
| 631 | 3300026142 | Ga0207698_10095525 | Ga0207698_100955252 | 439 |
| 632 | 3300026142 | Ga0207698_10095838 | Ga0207698_100958382 | 439 |
| 633 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000011482 | 439 |
| 634 | 3300031251 | Ga0265327_10000404 | Ga0265327_1000040426 | 439 |
| 635 | 3300039437 | Ga0436365_1668618 | Ga0436365_1668618_584_1918 | 439 |
| 636 | 3300046660 | Ga0495625_0028893 | Ga0495625_0028893_1488_2819 | 439 |
| 637 | 3300047320 | Ga0495672_0020619 | Ga0495672_0020619_2379_3752 | 439 |
| 638 | 3300005329 | Ga0070683_100047781 | Ga0070683_1000477812 | 440 |
| 639 | 3300005330 | Ga0070690_100017469 | Ga0070690_1000174694 | 440 |
| 640 | 3300005334 | Ga0068869_100012466 | Ga0068869_1000124663 | 440 |
| 641 | 3300005334 | Ga0068869_100014525 | Ga0068869_1000145253 | 440 |
| 642 | 3300005335 | Ga0070666_10054122 | Ga0070666_100541222 | 440 |
| 643 | 3300005338 | Ga0068868_100054875 | Ga0068868_1000548752 | 440 |
| 644 | 3300005344 | Ga0070661_100053610 | Ga0070661_1000536102 | 440 |
| 645 | 3300005354 | Ga0070675_100165213 | Ga0070675_1001652132 | 440 |
| 646 | 3300005355 | Ga0070671_100016026 | Ga0070671_1000160262 | 440 |
| 647 | 3300005364 | Ga0070673_100046985 | Ga0070673_1000469853 | 440 |
| 648 | 3300005367 | Ga0070667_100053128 | Ga0070667_1000531283 | 440 |
| 649 | 3300005456 | Ga0070678_100023647 | Ga0070678_1000236472 | 440 |
| 650 | 3300005457 | Ga0070662_100042465 | Ga0070662_1000424652 | 440 |
| 651 | 3300005459 | Ga0068867_100065844 | Ga0068867_1000658442 | 440 |
| 652 | 3300005535 | Ga0070684_100139871 | Ga0070684_1001398712 | 440 |
| 653 | 3300005544 | Ga0070686_100014929 | Ga0070686_1000149293 | 440 |
| 654 | 3300005564 | Ga0070664_100237927 | Ga0070664_1002379271 | 440 |
| 655 | 3300005577 | Ga0068857_100033135 | Ga0068857_1000331353 | 440 |
| 656 | 3300005578 | Ga0068854_100034123 | Ga0068854_1000341233 | 440 |
| 657 | 3300005616 | Ga0068852_100075882 | Ga0068852_1000758823 | 440 |
| 658 | 3300005719 | Ga0068861_100133175 | Ga0068861_1001331752 | 440 |
| 659 | 3300005834 | Ga0068851_10057597 | Ga0068851_100575971 | 440 |
| 660 | 3300005841 | Ga0068863_100199281 | Ga0068863_1001992812 | 440 |
| 661 | 3300005842 | Ga0068858_100061184 | Ga0068858_1000611842 | 440 |
| 662 | 3300005985 | Ga0081539_10011072 | Ga0081539_100110722 | 440 |
| 663 | 3300006358 | Ga0068871_100078597 | Ga0068871_1000785972 | 440 |
| 664 | 3300006358 | Ga0068871_100086753 | Ga0068871_1000867533 | 440 |
| 665 | 3300009093 | Ga0105240_10188537 | Ga0105240_101885373 | 440 |
| 666 | 3300009148 | Ga0105243_10235633 | Ga0105243_102356332 | 440 |
| 667 | 3300009553 | Ga0105249_10023271 | Ga0105249_100232713 | 440 |
| 668 | 3300013296 | Ga0157374_10013923 | Ga0157374_100139232 | 440 |
| 669 | 3300013296 | Ga0157374_10038133 | Ga0157374_100381332 | 440 |
| 670 | 3300013297 | Ga0157378_10100881 | Ga0157378_101008812 | 440 |
| 671 | 3300013308 | Ga0157375_10028292 | Ga0157375_100282924 | 440 |
| 672 | 3300014968 | Ga0157379_10033631 | Ga0157379_100336312 | 440 |
| 673 | 3300014968 | Ga0157379_10054904 | Ga0157379_100549042 | 440 |
| 674 | 3300014969 | Ga0157376_10027053 | Ga0157376_100270531 | 440 |
| 675 | 3300014969 | Ga0157376_10110770 | Ga0157376_101107702 | 440 |
| 676 | 3300017792 | Ga0163161_10036617 | Ga0163161_100366173 | 440 |
| 677 | 3300025893 | Ga0207682_10020942 | Ga0207682_100209422 | 440 |
| 678 | 3300025903 | Ga0207680_10122908 | Ga0207680_101229082 | 440 |
| 679 | 3300025907 | Ga0207645_10008058 | Ga0207645_100080582 | 440 |
| 680 | 3300025913 | Ga0207695_10139961 | Ga0207695_101399613 | 440 |
| 681 | 3300025933 | Ga0207706_10008325 | Ga0207706_100083256 | 440 |
| 682 | 3300025944 | Ga0207661_10015706 | Ga0207661_100157062 | 440 |
| 683 | 3300025945 | Ga0207679_10068693 | Ga0207679_100686933 | 440 |
| 684 | 3300025986 | Ga0207658_10114287 | Ga0207658_101142871 | 440 |
| 685 | 3300026023 | Ga0207677_10087736 | Ga0207677_100877362 | 440 |
| 686 | 3300026035 | Ga0207703_10203038 | Ga0207703_102030381 | 440 |
| 687 | 3300026089 | Ga0207648_10093493 | Ga0207648_100934932 | 440 |
| 688 | 3300026089 | Ga0207648_10142762 | Ga0207648_101427622 | 440 |
| 689 | 3300026095 | Ga0207676_10076651 | Ga0207676_100766512 | 440 |
| 690 | 3300026116 | Ga0207674_10017658 | Ga0207674_100176586 | 440 |
| 691 | 3300026121 | Ga0207683_10016479 | Ga0207683_100164792 | 440 |
| 692 | 3300026142 | Ga0207698_10061255 | Ga0207698_100612553 | 440 |
| 693 | 3300048913 | Ga0496110_0144274 | Ga0496110_0144274_255_1583 | 440 |
| 694 | 3300053727 | Ga0500611_000001 | Ga0500611_000001_212463_213788 | 440 |
| 695 | 3300005355 | Ga0070671_100164925 | Ga0070671_1001649252 | 441 |
| 696 | 3300005367 | Ga0070667_100043490 | Ga0070667_1000434902 | 441 |
| 697 | 3300005459 | Ga0068867_100048127 | Ga0068867_1000481272 | 441 |
| 698 | 3300005471 | Ga0070698_100000261 | Ga0070698_10000026129 | 441 |
| 699 | 3300005719 | Ga0068861_100040128 | Ga0068861_1000401283 | 441 |
| 700 | 3300005841 | Ga0068863_100062044 | Ga0068863_1000620442 | 441 |
| 701 | 3300006237 | Ga0097621_100008467 | Ga0097621_1000084674 | 441 |
| 702 | 3300006358 | Ga0068871_100001044 | Ga0068871_10000104411 | 441 |
| 703 | 3300006844 | Ga0075428_100028386 | Ga0075428_1000283863 | 441 |
| 704 | 3300009147 | Ga0114129_10300708 | Ga0114129_103007081 | 441 |
| 705 | 3300009177 | Ga0105248_10011596 | Ga0105248_100115964 | 441 |
| 706 | 3300009553 | Ga0105249_10035127 | Ga0105249_100351273 | 441 |
| 707 | 3300013297 | Ga0157378_10155381 | Ga0157378_101553812 | 441 |
| 708 | 3300013306 | Ga0163162_10002245 | Ga0163162_100022456 | 441 |
| 709 | 3300013306 | Ga0163162_10123550 | Ga0163162_101235502 | 441 |
| 710 | 3300014326 | Ga0157380_10117169 | Ga0157380_101171692 | 441 |
| 711 | 3300014745 | Ga0157377_10021291 | Ga0157377_100212913 | 441 |
| 712 | 3300014968 | Ga0157379_10007087 | Ga0157379_100070873 | 441 |
| 713 | 3300014968 | Ga0157379_10140503 | Ga0157379_101405032 | 441 |
| 714 | 3300014969 | Ga0157376_10013495 | Ga0157376_100134952 | 441 |
| 715 | 3300017792 | Ga0163161_10002103 | Ga0163161_100021033 | 441 |
| 716 | 3300025926 | Ga0207659_10112018 | Ga0207659_101120182 | 441 |
| 717 | 3300025941 | Ga0207711_10033453 | Ga0207711_100334533 | 441 |
| 718 | 3300025986 | Ga0207658_10046209 | Ga0207658_100462093 | 441 |
| 719 | 3300026118 | Ga0207675_100187304 | Ga0207675_1001873042 | 441 |
| 720 | 3300041999 | Ga0439433_0023867 | Ga0439433_0023867_16_1365 | 441 |
| 721 | 3300042002 | Ga0439442_011242 | Ga0439442_011242_187_1536 | 441 |
| 722 | 3300042014 | Ga0439457_008790 | Ga0439457_008790_410_1759 | 441 |
| 723 | 3300050508 | nmdc:mga09592_8127_c1 | nmdc:mga09592_8127_c1_6592_7938 | 441 |
| 724 | 3300050510 | nmdc:mga06r32_88425_c1 | nmdc:mga06r32_88425_c1_1385_2731 | 441 |
| 725 | 3300050511 | nmdc:mga08y16_8912_c1 | nmdc:mga08y16_8912_c1_381_1709 | 441 |
| 726 | 3300003322 | rootL2_10039747 | rootL2_100397472 | 442 |
| 727 | 3300003323 | rootH1_10016444 | rootH1_100164441 | 442 |
| 728 | 3300005343 | Ga0070687_100029446 | Ga0070687_1000294462 | 442 |
| 729 | 3300005719 | Ga0068861_100007156 | Ga0068861_1000071564 | 442 |
| 730 | 3300006847 | Ga0075431_100097112 | Ga0075431_1000971121 | 442 |
| 731 | 3300006880 | Ga0075429_100112600 | Ga0075429_1001126001 | 442 |
| 732 | 3300014325 | Ga0163163_10000079 | Ga0163163_1000007921 | 442 |
| 733 | 3300026118 | Ga0207675_100000809 | Ga0207675_10000080914 | 442 |
| 734 | 3300050508 | nmdc:mga09592_295790_c1 | nmdc:mga09592_295790_c1_64_1392 | 442 |
| 735 | 3300050509 | nmdc:mga0qj67_5578_c1 | nmdc:mga0qj67_5578_c1_1691_3019 | 442 |
| 736 | 3300050510 | nmdc:mga06r32_288102_c1 | nmdc:mga06r32_288102_c1_80_1408 | 442 |
| 737 | 3300002459 | JGI24751J29686_10000975 | JGI24751J29686_100009755 | 443 |
| 738 | 3300005331 | Ga0070670_100128486 | Ga0070670_1001284861 | 443 |
| 739 | 3300005343 | Ga0070687_100058780 | Ga0070687_1000587802 | 443 |
| 740 | 3300005365 | Ga0070688_100059224 | Ga0070688_1000592243 | 443 |
| 741 | 3300005441 | Ga0070700_100074008 | Ga0070700_1000740081 | 443 |
| 742 | 3300005471 | Ga0070698_100002003 | Ga0070698_10000200310 | 443 |
| 743 | 3300005471 | Ga0070698_100003063 | Ga0070698_10000306310 | 443 |
| 744 | 3300005618 | Ga0068864_100030555 | Ga0068864_1000305553 | 443 |
| 745 | 3300005719 | Ga0068861_100147026 | Ga0068861_1001470262 | 443 |
| 746 | 3300005841 | Ga0068863_100007966 | Ga0068863_1000079669 | 443 |
| 747 | 3300006237 | Ga0097621_100051433 | Ga0097621_1000514332 | 443 |
| 748 | 3300009176 | Ga0105242_10020621 | Ga0105242_100206214 | 443 |
| 749 | 3300009177 | Ga0105248_10136473 | Ga0105248_101364733 | 443 |
| 750 | 3300009553 | Ga0105249_10001054 | Ga0105249_1000105411 | 443 |
| 751 | 3300009553 | Ga0105249_10008648 | Ga0105249_100086485 | 443 |
| 752 | 3300013306 | Ga0163162_10092742 | Ga0163162_100927423 | 443 |
| 753 | 3300013306 | Ga0163162_10362508 | Ga0163162_103625082 | 443 |
| 754 | 3300013308 | Ga0157375_10056180 | Ga0157375_100561803 | 443 |
| 755 | 3300014325 | Ga0163163_10227766 | Ga0163163_102277662 | 443 |
| 756 | 3300014969 | Ga0157376_10129796 | Ga0157376_101297962 | 443 |
| 757 | 3300025908 | Ga0207643_10014097 | Ga0207643_100140973 | 443 |
| 758 | 3300025926 | Ga0207659_10208994 | Ga0207659_102089941 | 443 |
| 759 | 3300025934 | Ga0207686_10003837 | Ga0207686_100038375 | 443 |
| 760 | 3300025940 | Ga0207691_10068359 | Ga0207691_100683592 | 443 |
| 761 | 3300025942 | Ga0207689_10074796 | Ga0207689_100747963 | 443 |
| 762 | 3300025961 | Ga0207712_10017000 | Ga0207712_100170003 | 443 |
| 763 | 3300025961 | Ga0207712_10043360 | Ga0207712_100433602 | 443 |
| 764 | 3300026023 | Ga0207677_10211589 | Ga0207677_102115892 | 443 |
| 765 | 3300026075 | Ga0207708_10126058 | Ga0207708_101260581 | 443 |
| 766 | 3300026088 | Ga0207641_10000191 | Ga0207641_1000019121 | 443 |
| 767 | 3300026088 | Ga0207641_10033664 | Ga0207641_100336642 | 443 |
| 768 | 3300026088 | Ga0207641_10034437 | Ga0207641_100344374 | 443 |
| 769 | 3300026095 | Ga0207676_10021098 | Ga0207676_100210982 | 443 |
| 770 | 3300026095 | Ga0207676_10069843 | Ga0207676_100698432 | 443 |
| 771 | 3300026118 | Ga0207675_100146569 | Ga0207675_1001465692 | 443 |
| 772 | 3300046809 | Ga0495600_0119597 | Ga0495600_0119597_39_1394 | 443 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4usz-assembly1.cif.gz_A | crystal structure of the first bacterial vanadium dependant iodoperoxidase | 0.9464 | 31 | 443 |
| 4cit-assembly1.cif.gz_A | crystal structure of the first bacterial vanadium dependant iodoperoxidase | 0.9412 | 32 | 443 |
| 4usz-assembly1.cif.gz_A | crystal structure of the first bacterial vanadium dependant iodoperoxidase | 0.9241 | 31 | 443 |
| 4cit-assembly1.cif.gz_A | crystal structure of the first bacterial vanadium dependant iodoperoxidase | 0.9121 | 32 | 443 |
| 8cxl-assembly1.cif.gz_B | structure of naph3, a vanadium-dependent haloperoxidase homolog catalyzing the stereospecific alpha-hydroxyketone rearrangement reaction in napyradiomycin biosynthesis | 0.7343 | 53 | 438 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4citA00 | Mainly Alpha;Orthogonal Bundle;Vanadium-containing Chloroperoxidase; domain 2; | 0.9402 | 32 | 443 | 1.10.606.20 |
| 4citA00 | Mainly Alpha;Orthogonal Bundle;Vanadium-containing Chloroperoxidase; domain 2; | 0.911 | 32 | 443 | 1.10.606.20 |
| af_Q54FF5_166_492_1.10.606.10 | Mainly Alpha;Orthogonal Bundle;Vanadium-containing Chloroperoxidase; domain 2;Vanadium-containing Chloroperoxidase, domain 2 | 0.7753 | 186 | 438 | 1.10.606.10 |
| af_Q75HI8_51_243_1.20.144.10 | Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase | 0.6838 | 236 | 437 | 1.20.144.10 |
| 1qhbF00 | Mainly Alpha;Orthogonal Bundle;Vanadium-containing Chloroperoxidase; domain 2;Vanadium-containing Chloroperoxidase, domain 2 | 0.6814 | 303 | 438 | 1.10.606.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A849D8M1-F1-model_v4 | Phosphatase PAP2 family protein | 0.9826 | 351 | 443 |
|
| AF-A0A4Q3DX40-F1-model_v4 | Phosphatase PAP2 family protein | 0.9819 | 198 | 443 |
|
| AF-A0A3B8T443-F1-model_v4 | deleted | 0.9813 | 302 | 443 |
|
| AF-A0A0J1BQ34-F1-model_v4 | Phosphatidic acid phosphatase type 2/haloperoxidase domain-containing protein | 0.9803 | 364 | 443 |
|
| AF-A0A537JLG3-F1-model_v4 | Vanadium-dependent haloperoxidase | 0.9791 | 135 | 443 |
GO:0004601
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar