F480119

General Info

Members Datasets Scaffolds Average Seq Length
772 241 771 441

Family's Representative Sequence

Representative Sequence 3300025945|Ga0207679_10005163|Ga0207679_100051634
Length 492
Sequence LKPKAAIPFFYVIAFCLKHMRQTKVFSGFFKLQIALPSSTIPHMKKIVLLLCMSAVLVACKQNDYKKIVHDPALFSNTVHELNQVVMGNNFSPIVGSRNYLYASVAAYEVIAAGYPEQYNSLAGQLNGLKVIPKPASNTAIDFEFAALLAYCKLGEAVTFPEGSMKDYVDSIKMMAKDHGMPSDIFENSVRYSDTVSSVVMAWSKKDNYAQTRSATKYTVTDFEGRWIPTPPAYTSAMEPHWSEIRTLVMDSANQFPAPPPYQYNMKDSNSAYCKEVMKIKTAVENLSDEQKHIADFWDDNPFKLNVSGHIMYATKKFSPPGHWESIVGIAAKKANADFATTVYAYAKTSIALFDAFIQCWNAKYTYNSARPETVINKTLDMEWRPYLQTPPFPEYTCGHSTCSSAAAEALTSVFGDNFSYTDTTELEFGIKSRSYKSFRHAADENNWARFYGGIHFHRSCIVSTELGRKVGELVVSKLKMKKNELTATVTN

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
159 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
160 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
161 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
162 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
163 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
164 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
165 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
166 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
177 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
178 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
179 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
180 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
181 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
191 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
192 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
193 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
194 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
195 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
196 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
197 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
198 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
206 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
207 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
235 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
236 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
237 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
238 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
239 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
240 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.42
Nodule 0
Rhizoplane 0.26
Rhizosphere 94.56
Stem 0
Stem Tuber 0
Unclassified 3.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000975 3300002459 Bacteria 6294
2 JGI25406J46586_10022917 3300003203 Bacteria 2477
3 rootH1_10045334 3300003316 Bacteria 10678
4 rootH1_10147241 3300003316 Bacteria 2066
5 rootH1_10147241 3300003323 Bacteria 1721
6 rootH2_10001891 3300003320 Bacteria 464318
7 rootH2_10053878 3300003320 Bacteria 12446
8 rootH2_10206634 3300003320 Bacteria 2902
9 rootH2_10218880 3300003320 Unclassified 4487
10 rootL2_10037862 3300003322 Bacteria 5180
11 rootL2_10039747 3300003322 Bacteria 3431
12 rootL2_10067458 3300003322 Bacteria 3923
13 rootH1_10016444 3300003323 Bacteria 2383
14 rootH1_10031468 3300003323 Bacteria 2927
15 rootH1_10278369 3300003323 Bacteria 1923
16 Ga0065714_10070154 3300005288 Bacteria 3955
17 Ga0065712_10011412 3300005290 Bacteria 2614
18 Ga0065712_10014996 3300005290 Bacteria 2784
19 Ga0065712_10090253 3300005290 Unclassified 2429
20 Ga0065715_10158521 3300005293 Unclassified 1652
21 Ga0065707_10006808 3300005295 Bacteria 2677
22 Ga0070658_10000027 3300005327 Bacteria 164254
23 Ga0070658_10001676 3300005327 Bacteria 18699
24 Ga0070658_10020971 3300005327 Bacteria 5235
25 Ga0070658_10026391 3300005327 Bacteria 4659
26 Ga0070658_10183672 3300005327 Archaea 1760
27 Ga0070676_10004075 3300005328 Bacteria 7682
28 Ga0070676_10028857 3300005328 Unclassified 3153
29 Ga0070676_10051846 3300005328 Bacteria 2410
30 Ga0070683_100004423 3300005329 Bacteria 11587
31 Ga0070683_100013392 3300005329 Bacteria 7152
32 Ga0070683_100047781 3300005329 Bacteria 3955
33 Ga0070690_100017469 3300005330 Bacteria 4314
34 Ga0070690_100025347 3300005330 Bacteria 3652
35 Ga0070690_100083218 3300005330 Bacteria 2096
36 Ga0070670_100024231 3300005331 Bacteria 5220
37 Ga0070670_100039614 3300005331 Bacteria 4052
38 Ga0070670_100067995 3300005331 Unclassified 3057
39 Ga0070670_100074745 3300005331 Unclassified 2911
40 Ga0070670_100128486 3300005331 Bacteria 2187
41 Ga0068869_100001574 3300005334 Bacteria 13563
42 Ga0068869_100012466 3300005334 Bacteria 5619
43 Ga0068869_100014525 3300005334 Bacteria 5262
44 Ga0068869_100015579 3300005334 Bacteria 5105
45 Ga0068869_100046810 3300005334 Bacteria 3120
46 Ga0068869_100073718 3300005334 Bacteria 2532
47 Ga0070666_10000050 3300005335 Bacteria 100280
48 Ga0070666_10005046 3300005335 Bacteria 8074
49 Ga0070666_10041186 3300005335 Bacteria 3085
50 Ga0070666_10054122 3300005335 Bacteria 2707
51 Ga0070666_10077082 3300005335 Bacteria 2275
52 Ga0070666_10106974 3300005335 Unclassified 1932
53 Ga0070680_100000819 3300005336 Bacteria 21946
54 Ga0070680_100041824 3300005336 Unclassified 3716
55 Ga0070682_100020371 3300005337 Bacteria 3901
56 Ga0068868_100000112 3300005338 Bacteria 50817
57 Ga0068868_100005340 3300005338 Bacteria 9020
58 Ga0068868_100034697 3300005338 Bacteria 3896
59 Ga0068868_100054875 3300005338 Bacteria 3142
60 Ga0068868_100075038 3300005338 Bacteria 2702
61 Ga0070660_100020983 3300005339 Bacteria 4809
62 Ga0070660_100070028 3300005339 Bacteria 2736
63 Ga0070691_10018505 3300005341 Bacteria 3212
64 Ga0070687_100029446 3300005343 Bacteria 2674
65 Ga0070687_100058780 3300005343 Bacteria 2022
66 Ga0070661_100024118 3300005344 Bacteria 4363
67 Ga0070661_100053610 3300005344 Bacteria 2952
68 Ga0070668_100000110 3300005347 Bacteria 50766
69 Ga0070668_100074075 3300005347 Bacteria 2655
70 Ga0070669_100051338 3300005353 Bacteria 3014
71 Ga0070669_100139037 3300005353 Bacteria 1871
72 Ga0070675_100051952 3300005354 Bacteria 3369
73 Ga0070675_100096490 3300005354 Unclassified 2484
74 Ga0070675_100126483 3300005354 Unclassified 2175
75 Ga0070675_100151212 3300005354 Bacteria 1991
76 Ga0070675_100165213 3300005354 Unclassified 1906
77 Ga0070671_100011381 3300005355 Bacteria 7152
78 Ga0070671_100016026 3300005355 Bacteria 6056
79 Ga0070671_100083476 3300005355 Bacteria 2671
80 Ga0070671_100106419 3300005355 Unclassified 2355
81 Ga0070671_100145952 3300005355 Bacteria 1997
82 Ga0070671_100164925 3300005355 Bacteria 1873
83 Ga0070674_100018171 3300005356 Bacteria 4440
84 Ga0070674_100034724 3300005356 Unclassified 3371
85 Ga0070673_100000305 3300005364 Bacteria 25760
86 Ga0070673_100000400 3300005364 Bacteria 22985
87 Ga0070673_100046985 3300005364 Bacteria 3356
88 Ga0070673_100056895 3300005364 Bacteria 3087
89 Ga0070688_100059224 3300005365 Bacteria 2414
90 Ga0070688_100082487 3300005365 Bacteria 2084
91 Ga0070659_100176527 3300005366 Bacteria 1752
92 Ga0070667_100013900 3300005367 Bacteria 6655
93 Ga0070667_100016746 3300005367 Bacteria 6066
94 Ga0070667_100043490 3300005367 Bacteria 3770
95 Ga0070667_100053128 3300005367 Bacteria 3419
96 Ga0070667_100091034 3300005367 Unclassified 2622
97 Ga0070667_100149431 3300005367 Bacteria 2051
98 Ga0070701_10048654 3300005438 Unclassified 2189
99 Ga0070700_100074008 3300005441 Unclassified 2182
100 Ga0070663_100015831 3300005455 Bacteria 4879
101 Ga0070678_100007009 3300005456 Bacteria 6659
102 Ga0070678_100013581 3300005456 Bacteria 5113
103 Ga0070678_100023647 3300005456 Bacteria 4099
104 Ga0070678_100103501 3300005456 Bacteria 2212
105 Ga0070662_100000045 3300005457 Bacteria 67900
106 Ga0070662_100027999 3300005457 Bacteria 3919
107 Ga0070662_100042465 3300005457 Bacteria 3247
108 Ga0070681_10015844 3300005458 Bacteria 7515
109 Ga0070681_10030115 3300005458 Bacteria 5445
110 Ga0070681_10038082 3300005458 Bacteria 4822
111 Ga0070681_10047701 3300005458 Bacteria 4282
112 Ga0070681_10176847 3300005458 Bacteria 2056
113 Ga0068867_100000519 3300005459 Bacteria 25675
114 Ga0068867_100000620 3300005459 Bacteria 23485
115 Ga0068867_100045251 3300005459 Unclassified 3227
116 Ga0068867_100048127 3300005459 Bacteria 3136
117 Ga0068867_100053273 3300005459 Bacteria 2988
118 Ga0068867_100065844 3300005459 Bacteria 2698
119 Ga0068867_100069205 3300005459 Bacteria 2636
120 Ga0068867_100213403 3300005459 Bacteria 1551
121 Ga0070698_100000261 3300005471 Bacteria 53090
122 Ga0070698_100002003 3300005471 Bacteria 22611
123 Ga0070698_100003063 3300005471 Bacteria 18436
124 Ga0070679_100012671 3300005530 Bacteria 8065
125 Ga0070679_100093594 3300005530 Unclassified 2992
126 Ga0070679_100136714 3300005530 Bacteria 2432
127 Ga0070679_100142523 3300005530 Bacteria 2375
128 Ga0070684_100025867 3300005535 Bacteria 4938
129 Ga0070684_100037004 3300005535 Bacteria 4184
130 Ga0070684_100139871 3300005535 Bacteria 2188
131 Ga0068853_100001722 3300005539 Bacteria 16023
132 Ga0068853_100003764 3300005539 Bacteria 11637
133 Ga0068853_100012711 3300005539 Bacteria 6855
134 Ga0068853_100023333 3300005539 Bacteria 5178
135 Ga0068853_100072551 3300005539 Unclassified 3000
136 Ga0068853_100120197 3300005539 Unclassified 2342
137 Ga0070672_100000020 3300005543 Bacteria 69277
138 Ga0070672_100051207 3300005543 Bacteria 3219
139 Ga0070672_100151274 3300005543 Bacteria 1920
140 Ga0070686_100014929 3300005544 Bacteria 4486
141 Ga0070686_100054756 3300005544 Unclassified 2553
142 Ga0070693_100032663 3300005547 Bacteria 2864
143 Ga0070693_100046893 3300005547 Bacteria 2456
144 Ga0070665_100000014 3300005548 Bacteria 484881
145 Ga0070665_100000020 3300005548 Bacteria 389687
146 Ga0070665_100000318 3300005548 Bacteria 74326
147 Ga0070704_100149514 3300005549 Bacteria 1834
148 Ga0068855_100000033 3300005563 Bacteria 167299
149 Ga0068855_100000556 3300005563 Bacteria 45792
150 Ga0068855_100001120 3300005563 Bacteria 33311
151 Ga0068855_100019483 3300005563 Bacteria 8153
152 Ga0068855_100040797 3300005563 Bacteria 5506
153 Ga0068855_100064607 3300005563 Bacteria 4268
154 Ga0068855_100078973 3300005563 Bacteria 3817
155 Ga0068855_100110113 3300005563 Bacteria 3162
156 Ga0068855_100132637 3300005563 Bacteria 2844
157 Ga0068855_100156418 3300005563 Bacteria 2589
158 Ga0070664_100029202 3300005564 Bacteria 4596
159 Ga0070664_100058975 3300005564 Bacteria 3265
160 Ga0070664_100072834 3300005564 Bacteria 2947
161 Ga0070664_100141641 3300005564 Bacteria 2118
162 Ga0070664_100237927 3300005564 Bacteria 1634
163 Ga0068857_100003443 3300005577 Bacteria 13201
164 Ga0068857_100033135 3300005577 Bacteria 4568
165 Ga0068857_100035129 3300005577 Unclassified 4437
166 Ga0068857_100105948 3300005577 Bacteria 2525
167 Ga0068857_100112444 3300005577 Unclassified 2448
168 Ga0068857_100260931 3300005577 Bacteria 1590
169 Ga0068854_100006457 3300005578 Bacteria 7461
170 Ga0068854_100034123 3300005578 Bacteria 3552
171 Ga0068854_100049388 3300005578 Bacteria 3005
172 Ga0068856_100000359 3300005614 Bacteria 49880
173 Ga0068856_100013339 3300005614 Bacteria 7956
174 Ga0068856_100025925 3300005614 Bacteria 5717
175 Ga0068856_100027095 3300005614 Bacteria 5590
176 Ga0068856_100081991 3300005614 Bacteria 3200
177 Ga0068856_100124977 3300005614 Unclassified 2575
178 Ga0068856_100133076 3300005614 Unclassified 2492
179 Ga0068856_100165564 3300005614 Bacteria 2222
180 Ga0068852_100001345 3300005616 Bacteria 16491
181 Ga0068852_100005907 3300005616 Bacteria 8803
182 Ga0068852_100009804 3300005616 Bacteria 7122
183 Ga0068852_100010585 3300005616 Bacteria 6901
184 Ga0068852_100020291 3300005616 Bacteria 5283
185 Ga0068852_100033541 3300005616 Bacteria 4264
186 Ga0068852_100075882 3300005616 Bacteria 2967
187 Ga0068852_100151192 3300005616 Bacteria 2159
188 Ga0068852_100180968 3300005616 Bacteria 1982
189 Ga0068852_100188113 3300005616 Bacteria 1946
190 Ga0068859_100000025 3300005617 Bacteria 191679
191 Ga0068859_100082667 3300005617 Bacteria 3254
192 Ga0068864_100000392 3300005618 Bacteria 38124
193 Ga0068864_100027917 3300005618 Bacteria 4769
194 Ga0068864_100030555 3300005618 Bacteria 4567
195 Ga0068864_100096577 3300005618 Bacteria 2615
196 Ga0068861_100007156 3300005719 Bacteria 7638
197 Ga0068861_100009832 3300005719 Bacteria 6616
198 Ga0068861_100040128 3300005719 Bacteria 3498
199 Ga0068861_100133175 3300005719 Bacteria 2020
200 Ga0068861_100147026 3300005719 Bacteria 1929
201 Ga0068851_10006000 3300005834 Bacteria 5534
202 Ga0068851_10057597 3300005834 Bacteria 1984
203 Ga0068863_100002244 3300005841 Bacteria 19182
204 Ga0068863_100007966 3300005841 Bacteria 10355
205 Ga0068863_100011055 3300005841 Bacteria 8756
206 Ga0068863_100016345 3300005841 Bacteria 7119
207 Ga0068863_100062044 3300005841 Bacteria 3535
208 Ga0068863_100199281 3300005841 Bacteria 1925
209 Ga0068858_100000342 3300005842 Bacteria 49465
210 Ga0068858_100061184 3300005842 Bacteria 3481
211 Ga0068858_100197746 3300005842 Unclassified 1900
212 Ga0068860_100000061 3300005843 Bacteria 192548
213 Ga0068860_100001898 3300005843 Bacteria 22184
214 Ga0068860_100002976 3300005843 Bacteria 17499
215 Ga0068860_100003705 3300005843 Bacteria 15722
216 Ga0068860_100004130 3300005843 Bacteria 14878
217 Ga0068860_100007522 3300005843 Bacteria 10900
218 Ga0068860_100008934 3300005843 Bacteria 9983
219 Ga0068860_100021106 3300005843 Bacteria 6307
220 Ga0068860_100045244 3300005843 Bacteria 4197
221 Ga0068860_100067376 3300005843 Bacteria 3402
222 Ga0068860_100130323 3300005843 Bacteria 2413
223 Ga0068862_100014299 3300005844 Bacteria 6584
224 Ga0068862_100114698 3300005844 Bacteria 2368
225 Ga0068862_100168814 3300005844 Bacteria 1958
226 Ga0068862_100183604 3300005844 Bacteria 1879
227 Ga0081540_1025198 3300005983 Unclassified 3430
228 Ga0081539_10003031 3300005985 Bacteria 21772
229 Ga0081539_10011072 3300005985 Bacteria 7209
230 Ga0075366_10000467 3300006195 Bacteria 18777
231 Ga0075366_10024404 3300006195 Unclassified 3527
232 Ga0097621_100003375 3300006237 Bacteria 10990
233 Ga0097621_100004382 3300006237 Bacteria 9821
234 Ga0097621_100005541 3300006237 Bacteria 8896
235 Ga0097621_100008467 3300006237 Bacteria 7411
236 Ga0097621_100017205 3300006237 Bacteria 5487
237 Ga0097621_100030561 3300006237 Bacteria 4265
238 Ga0097621_100051433 3300006237 Bacteria 3353
239 Ga0097621_100068666 3300006237 Bacteria 2924
240 Ga0068871_100000100 3300006358 Bacteria 51253
241 Ga0068871_100001044 3300006358 Bacteria 18562
242 Ga0068871_100002056 3300006358 Bacteria 13645
243 Ga0068871_100005284 3300006358 Bacteria 9040
244 Ga0068871_100010670 3300006358 Bacteria 6717
245 Ga0068871_100014817 3300006358 Bacteria 5822
246 Ga0068871_100078597 3300006358 Bacteria 2728
247 Ga0068871_100086753 3300006358 Unclassified 2601
248 Ga0075428_100028386 3300006844 Bacteria 6190
249 Ga0075428_100078646 3300006844 Bacteria 3600
250 Ga0075430_100002220 3300006846 Bacteria 16102
251 Ga0075431_100000819 3300006847 Bacteria 27158
252 Ga0075431_100097112 3300006847 Bacteria 3042
253 Ga0075429_100023162 3300006880 Bacteria 5386
254 Ga0075429_100112600 3300006880 Unclassified 2378
255 Ga0075429_100131873 3300006880 Unclassified 2186
256 Ga0068865_100000174 3300006881 Bacteria 35630
257 Ga0068865_100004637 3300006881 Bacteria 8300
258 Ga0068865_100012493 3300006881 Bacteria 5346
259 Ga0097620_100000025 3300006931 Bacteria 191679
260 Ga0097620_100082662 3300006931 Bacteria 3254
261 Ga0105240_10000396 3300009093 Bacteria 81252
262 Ga0105240_10000674 3300009093 Bacteria 62689
263 Ga0105240_10000998 3300009093 Bacteria 50528
264 Ga0105240_10001351 3300009093 Bacteria 42091
265 Ga0105240_10004944 3300009093 Bacteria 20039
266 Ga0105240_10009161 3300009093 Bacteria 14043
267 Ga0105240_10013501 3300009093 Bacteria 11218
268 Ga0105240_10014211 3300009093 Bacteria 10874
269 Ga0105240_10020572 3300009093 Bacteria 8796
270 Ga0105240_10022499 3300009093 Bacteria 8354
271 Ga0105240_10029462 3300009093 Bacteria 7150
272 Ga0105240_10061084 3300009093 Unclassified 4696
273 Ga0105240_10182316 3300009093 Bacteria 2477
274 Ga0105240_10188537 3300009093 Bacteria 2427
275 Ga0105247_10001380 3300009101 Bacteria 17607
276 Ga0105247_10015255 3300009101 Unclassified 4605
277 Ga0114129_10067485 3300009147 Bacteria 4988
278 Ga0114129_10104783 3300009147 Bacteria 3909
279 Ga0114129_10300708 3300009147 Unclassified 2139
280 Ga0105243_10021225 3300009148 Bacteria 4928
281 Ga0105243_10082364 3300009148 Unclassified 2630
282 Ga0105243_10148018 3300009148 Bacteria 2011
283 Ga0105243_10235633 3300009148 Bacteria 1626
284 Ga0105241_10000299 3300009174 Bacteria 37072
285 Ga0105241_10000688 3300009174 Bacteria 25457
286 Ga0105241_10000761 3300009174 Bacteria 24490
287 Ga0105241_10000796 3300009174 Bacteria 23959
288 Ga0105241_10001899 3300009174 Bacteria 15819
289 Ga0105241_10007361 3300009174 Bacteria 8098
290 Ga0105241_10237770 3300009174 Bacteria 1538
291 Ga0105242_10016013 3300009176 Bacteria 5825
292 Ga0105242_10020621 3300009176 Bacteria 5170
293 Ga0105248_10011596 3300009177 Bacteria 9709
294 Ga0105248_10136473 3300009177 Bacteria 2767
295 Ga0105237_10001169 3300009545 Bacteria 35074
296 Ga0105237_10001507 3300009545 Bacteria 30622
297 Ga0105237_10003761 3300009545 Bacteria 17860
298 Ga0105237_10006919 3300009545 Bacteria 12508
299 Ga0105237_10010656 3300009545 Bacteria 9768
300 Ga0105237_10020484 3300009545 Bacteria 6814
301 Ga0105237_10036510 3300009545 Bacteria 4973
302 Ga0105237_10048101 3300009545 Unclassified 4287
303 Ga0105237_10086948 3300009545 Unclassified 3116
304 Ga0105237_10108178 3300009545 Unclassified 2772
305 Ga0105237_10116674 3300009545 Bacteria 2663
306 Ga0105238_10000790 3300009551 Bacteria 32827
307 Ga0105238_10007423 3300009551 Bacteria 10980
308 Ga0105238_10014765 3300009551 Bacteria 7898
309 Ga0105238_10105735 3300009551 Unclassified 2796
310 Ga0105249_10001054 3300009553 Bacteria 24439
311 Ga0105249_10008648 3300009553 Bacteria 8872
312 Ga0105249_10023271 3300009553 Bacteria 5557
313 Ga0105249_10035127 3300009553 Bacteria 4544
314 Ga0105249_10055078 3300009553 Bacteria 3637
315 Ga0105249_10068632 3300009553 Bacteria 3270
316 Ga0105249_10109333 3300009553 Unclassified 2611
317 Ga0105239_10001545 3300010375 Bacteria 30416
318 Ga0105239_10005789 3300010375 Bacteria 14420
319 Ga0105239_10009377 3300010375 Bacteria 11043
320 Ga0105239_10011830 3300010375 Bacteria 9737
321 Ga0105239_10025660 3300010375 Bacteria 6489
322 Ga0105239_10027242 3300010375 Bacteria 6292
323 Ga0105239_10047136 3300010375 Bacteria 4723
324 Ga0105239_10063809 3300010375 Bacteria 4044
325 Ga0105239_10090349 3300010375 Unclassified 3379
326 Ga0105239_10096610 3300010375 Unclassified 3264
327 Ga0105239_10136292 3300010375 Unclassified 2733
328 Ga0105239_10157831 3300010375 Bacteria 2534
329 Ga0105246_10063544 3300011119 Unclassified 2575
330 Ga0157373_10003779 3300013100 Bacteria 11453
331 Ga0157373_10033350 3300013100 Bacteria 3705
332 Ga0157373_10034969 3300013100 Bacteria 3609
333 Ga0157371_10005572 3300013102 Bacteria 10583
334 Ga0157371_10010957 3300013102 Bacteria 7028
335 Ga0157371_10020816 3300013102 Bacteria 4825
336 Ga0157371_10027048 3300013102 Bacteria 4163
337 Ga0157371_10050290 3300013102 Bacteria 2961
338 Ga0157371_10067188 3300013102 Bacteria 2538
339 Ga0157371_10148904 3300013102 Bacteria 1669
340 Ga0157370_10000673 3300013104 Bacteria 42574
341 Ga0157370_10008553 3300013104 Bacteria 11033
342 Ga0157370_10029690 3300013104 Bacteria 5363
343 Ga0157370_10042465 3300013104 Bacteria 4382
344 Ga0157370_10236500 3300013104 Unclassified 1691
345 Ga0157369_10008359 3300013105 Bacteria 11869
346 Ga0157369_10041129 3300013105 Bacteria 5045
347 Ga0157369_10043119 3300013105 Bacteria 4919
348 Ga0157369_10080716 3300013105 Bacteria 3482
349 Ga0157369_10207788 3300013105 Unclassified 2053
350 Ga0157369_10209501 3300013105 Bacteria 2043
351 Ga0157369_10245748 3300013105 Bacteria 1868
352 Ga0157374_10000202 3300013296 Bacteria 54739
353 Ga0157374_10002159 3300013296 Bacteria 16586
354 Ga0157374_10005314 3300013296 Bacteria 10816
355 Ga0157374_10006821 3300013296 Bacteria 9713
356 Ga0157374_10013923 3300013296 Bacteria 7030
357 Ga0157374_10034609 3300013296 Bacteria 4616
358 Ga0157374_10038133 3300013296 Bacteria 4416
359 Ga0157378_10005161 3300013297 Bacteria 11466
360 Ga0157378_10015277 3300013297 Bacteria 6724
361 Ga0157378_10017150 3300013297 Bacteria 6348
362 Ga0157378_10019086 3300013297 Bacteria 6024
363 Ga0157378_10021365 3300013297 Bacteria 5691
364 Ga0157378_10029790 3300013297 Bacteria 4820
365 Ga0157378_10046894 3300013297 Bacteria 3841
366 Ga0157378_10057412 3300013297 Bacteria 3469
367 Ga0157378_10073638 3300013297 Bacteria 3071
368 Ga0157378_10100881 3300013297 Unclassified 2636
369 Ga0157378_10155381 3300013297 Bacteria 2135
370 Ga0157378_10334359 3300013297 Bacteria 1475
371 Ga0163162_10000032 3300013306 Bacteria 156609
372 Ga0163162_10000201 3300013306 Bacteria 55260
373 Ga0163162_10000544 3300013306 Bacteria 34854
374 Ga0163162_10000549 3300013306 Bacteria 34654
375 Ga0163162_10002245 3300013306 Bacteria 18145
376 Ga0163162_10002374 3300013306 Bacteria 17700
377 Ga0163162_10003819 3300013306 Bacteria 14443
378 Ga0163162_10009583 3300013306 Bacteria 9422
379 Ga0163162_10016297 3300013306 Bacteria 7265
380 Ga0163162_10072909 3300013306 Bacteria 3489
381 Ga0163162_10092742 3300013306 Bacteria 3104
382 Ga0163162_10123550 3300013306 Bacteria 2694
383 Ga0163162_10362508 3300013306 Bacteria 1582
384 Ga0157372_10000020 3300013307 Bacteria 208056
385 Ga0157372_10000894 3300013307 Bacteria 32388
386 Ga0157372_10003748 3300013307 Bacteria 16318
387 Ga0157372_10005808 3300013307 Bacteria 13145
388 Ga0157372_10006101 3300013307 Bacteria 12803
389 Ga0157372_10006151 3300013307 Bacteria 12758
390 Ga0157372_10036860 3300013307 Bacteria 5393
391 Ga0157372_10040159 3300013307 Bacteria 5166
392 Ga0157372_10059279 3300013307 Bacteria 4281
393 Ga0157372_10072620 3300013307 Bacteria 3878
394 Ga0157372_10078720 3300013307 Bacteria 3725
395 Ga0157372_10140157 3300013307 Bacteria 2785
396 Ga0157372_10144383 3300013307 Bacteria 2744
397 Ga0157372_10179157 3300013307 Bacteria 2453
398 Ga0157372_10347321 3300013307 Unclassified 1728
399 Ga0157372_10351160 3300013307 Bacteria 1718
400 Ga0157375_10000821 3300013308 Bacteria 27183
401 Ga0157375_10003434 3300013308 Bacteria 13738
402 Ga0157375_10003913 3300013308 Bacteria 12917
403 Ga0157375_10028292 3300013308 Bacteria 5251
404 Ga0157375_10051002 3300013308 Bacteria 4061
405 Ga0157375_10056180 3300013308 Bacteria 3885
406 Ga0157375_10161244 3300013308 Unclassified 2384
407 Ga0163163_10000079 3300014325 Bacteria 106874
408 Ga0163163_10000471 3300014325 Bacteria 36731
409 Ga0163163_10227766 3300014325 Bacteria 1913
410 Ga0157380_10010345 3300014326 Bacteria 6709
411 Ga0157380_10085268 3300014326 Bacteria 2592
412 Ga0157380_10117169 3300014326 Bacteria 2249
413 Ga0157377_10005020 3300014745 Bacteria 6176
414 Ga0157377_10009617 3300014745 Bacteria 4753
415 Ga0157377_10021089 3300014745 Bacteria 3422
416 Ga0157377_10021291 3300014745 Bacteria 3409
417 Ga0157379_10000115 3300014968 Bacteria 55499
418 Ga0157379_10007087 3300014968 Bacteria 9692
419 Ga0157379_10008675 3300014968 Bacteria 8853
420 Ga0157379_10033631 3300014968 Unclassified 4572
421 Ga0157379_10054904 3300014968 Bacteria 3559
422 Ga0157379_10065388 3300014968 Bacteria 3250
423 Ga0157379_10140503 3300014968 Bacteria 2177
424 Ga0157376_10001273 3300014969 Bacteria 16559
425 Ga0157376_10002338 3300014969 Bacteria 12798
426 Ga0157376_10003237 3300014969 Bacteria 11207
427 Ga0157376_10004628 3300014969 Bacteria 9584
428 Ga0157376_10013495 3300014969 Bacteria 6097
429 Ga0157376_10027053 3300014969 Bacteria 4541
430 Ga0157376_10092472 3300014969 Unclassified 2622
431 Ga0157376_10110770 3300014969 Bacteria 2416
432 Ga0157376_10120433 3300014969 Bacteria 2325
433 Ga0157376_10129796 3300014969 Bacteria 2247
434 Ga0163161_10002103 3300017792 Bacteria 14420
435 Ga0163161_10036617 3300017792 Bacteria 3514
436 Ga0209026_1005939 3300025250 Bacteria 3128
437 Ga0207697_10020282 3300025315 Bacteria 2721
438 Ga0207697_10023474 3300025315 Bacteria 2525
439 Ga0207682_10020942 3300025893 Unclassified 2571
440 Ga0207642_10002442 3300025899 Bacteria 5784
441 Ga0207680_10011428 3300025903 Bacteria 4487
442 Ga0207680_10090071 3300025903 Unclassified 1949
443 Ga0207680_10122908 3300025903 Bacteria 1700
444 Ga0207647_10000321 3300025904 Bacteria 39699
445 Ga0207647_10000511 3300025904 Bacteria 30935
446 Ga0207647_10064336 3300025904 Bacteria 2229
447 Ga0207645_10000874 3300025907 Bacteria 25051
448 Ga0207645_10001491 3300025907 Bacteria 19131
449 Ga0207645_10008058 3300025907 Bacteria 7391
450 Ga0207645_10065610 3300025907 Bacteria 2320
451 Ga0207643_10014097 3300025908 Bacteria 4339
452 Ga0207705_10000053 3300025909 Bacteria 162124
453 Ga0207705_10003949 3300025909 Bacteria 11276
454 Ga0207705_10021770 3300025909 Bacteria 4575
455 Ga0207705_10097985 3300025909 Bacteria 2154
456 Ga0207654_10000585 3300025911 Bacteria 20568
457 Ga0207654_10001259 3300025911 Bacteria 13484
458 Ga0207654_10012775 3300025911 Bacteria 4309
459 Ga0207654_10030053 3300025911 Unclassified 2979
460 Ga0207654_10042012 3300025911 Bacteria 2585
461 Ga0207707_10017719 3300025912 Bacteria 6213
462 Ga0207707_10024725 3300025912 Bacteria 5255
463 Ga0207707_10182078 3300025912 Bacteria 1834
464 Ga0207707_10194744 3300025912 Unclassified 1768
465 Ga0207695_10000023 3300025913 Bacteria 657903
466 Ga0207695_10000031 3300025913 Bacteria 526801
467 Ga0207695_10000110 3300025913 Bacteria 250079
468 Ga0207695_10001232 3300025913 Bacteria 43800
469 Ga0207695_10001344 3300025913 Bacteria 41706
470 Ga0207695_10001456 3300025913 Bacteria 39626
471 Ga0207695_10008031 3300025913 Bacteria 13283
472 Ga0207695_10009725 3300025913 Bacteria 11836
473 Ga0207695_10021005 3300025913 Bacteria 7457
474 Ga0207695_10022580 3300025913 Bacteria 7137
475 Ga0207695_10022991 3300025913 Bacteria 7060
476 Ga0207695_10057802 3300025913 Unclassified 4028
477 Ga0207695_10061337 3300025913 Unclassified 3886
478 Ga0207695_10139961 3300025913 Bacteria 2369
479 Ga0207695_10166590 3300025913 Bacteria 2131
480 Ga0207695_10190792 3300025913 Bacteria 1967
481 Ga0207671_10000974 3300025914 Bacteria 35495
482 Ga0207671_10001755 3300025914 Bacteria 24384
483 Ga0207671_10001885 3300025914 Bacteria 23302
484 Ga0207671_10002532 3300025914 Bacteria 19474
485 Ga0207671_10004604 3300025914 Bacteria 13095
486 Ga0207671_10004864 3300025914 Bacteria 12640
487 Ga0207671_10006852 3300025914 Bacteria 10054
488 Ga0207671_10008980 3300025914 Bacteria 8409
489 Ga0207671_10009040 3300025914 Bacteria 8380
490 Ga0207671_10011481 3300025914 Bacteria 7203
491 Ga0207671_10039592 3300025914 Bacteria 3490
492 Ga0207671_10050802 3300025914 Unclassified 3070
493 Ga0207671_10065202 3300025914 Unclassified 2708
494 Ga0207660_10008655 3300025917 Bacteria 6582
495 Ga0207660_10023754 3300025917 Bacteria 4143
496 Ga0207660_10029454 3300025917 Unclassified 3766
497 Ga0207662_10099105 3300025918 Unclassified 1804
498 Ga0207657_10019335 3300025919 Bacteria 6473
499 Ga0207657_10048929 3300025919 Unclassified 3688
500 Ga0207652_10000451 3300025921 Bacteria 42282
501 Ga0207652_10007289 3300025921 Bacteria 8909
502 Ga0207652_10017039 3300025921 Bacteria 5943
503 Ga0207652_10155768 3300025921 Bacteria 2047
504 Ga0207681_10088551 3300025923 Bacteria 2205
505 Ga0207694_10004366 3300025924 Bacteria 11044
506 Ga0207694_10013429 3300025924 Bacteria 6169
507 Ga0207694_10082221 3300025924 Bacteria 2531
508 Ga0207650_10006464 3300025925 Bacteria 7982
509 Ga0207650_10028226 3300025925 Bacteria 4021
510 Ga0207659_10010129 3300025926 Bacteria 5910
511 Ga0207659_10016624 3300025926 Bacteria 4793
512 Ga0207659_10095290 3300025926 Unclassified 2232
513 Ga0207659_10102738 3300025926 Bacteria 2158
514 Ga0207659_10112018 3300025926 Bacteria 2076
515 Ga0207659_10208994 3300025926 Bacteria 1563
516 Ga0207644_10031264 3300025931 Bacteria 3708
517 Ga0207690_10154461 3300025932 Bacteria 1704
518 Ga0207706_10000120 3300025933 Bacteria 84222
519 Ga0207706_10003224 3300025933 Bacteria 15663
520 Ga0207706_10008325 3300025933 Bacteria 9564
521 Ga0207706_10033612 3300025933 Bacteria 4563
522 Ga0207706_10047228 3300025933 Bacteria 3810
523 Ga0207686_10003837 3300025934 Bacteria 8061
524 Ga0207686_10007373 3300025934 Bacteria 5921
525 Ga0207709_10044636 3300025935 Bacteria 2679
526 Ga0207669_10002105 3300025937 Bacteria 8438
527 Ga0207669_10027965 3300025937 Unclassified 3096
528 Ga0207704_10000099 3300025938 Bacteria 48088
529 Ga0207704_10006041 3300025938 Bacteria 5614
530 Ga0207704_10014507 3300025938 Bacteria 3980
531 Ga0207691_10000322 3300025940 Bacteria 47690
532 Ga0207691_10009018 3300025940 Bacteria 9565
533 Ga0207691_10058709 3300025940 Bacteria 3499
534 Ga0207691_10068359 3300025940 Bacteria 3209
535 Ga0207691_10118175 3300025940 Bacteria 2352
536 Ga0207711_10033453 3300025941 Bacteria 4350
537 Ga0207711_10122791 3300025941 Unclassified 2320
538 Ga0207689_10002462 3300025942 Bacteria 17250
539 Ga0207689_10007633 3300025942 Bacteria 9470
540 Ga0207689_10013593 3300025942 Bacteria 6944
541 Ga0207689_10025756 3300025942 Bacteria 4928
542 Ga0207689_10074796 3300025942 Bacteria 2783
543 Ga0207661_10015706 3300025944 Bacteria 5578
544 Ga0207661_10018857 3300025944 Bacteria 5133
545 Ga0207679_10005163 3300025945 Bacteria 8177
546 Ga0207679_10039157 3300025945 Bacteria 3383
547 Ga0207679_10068693 3300025945 Bacteria 2663
548 Ga0207667_10000046 3300025949 Bacteria 245420
549 Ga0207667_10000098 3300025949 Bacteria 140051
550 Ga0207667_10000926 3300025949 Bacteria 37457
551 Ga0207667_10001699 3300025949 Bacteria 27690
552 Ga0207667_10002398 3300025949 Bacteria 23465
553 Ga0207667_10012033 3300025949 Bacteria 10011
554 Ga0207667_10013584 3300025949 Bacteria 9309
555 Ga0207667_10032551 3300025949 Bacteria 5617
556 Ga0207667_10090304 3300025949 Bacteria 3166
557 Ga0207667_10127196 3300025949 Unclassified 2625
558 Ga0207667_10181280 3300025949 Bacteria 2163
559 Ga0207667_10181850 3300025949 Bacteria 2159
560 Ga0207651_10005272 3300025960 Bacteria 6614
561 Ga0207651_10007887 3300025960 Bacteria 5703
562 Ga0207651_10110153 3300025960 Bacteria 2065
563 Ga0207712_10017000 3300025961 Bacteria 4719
564 Ga0207712_10019169 3300025961 Bacteria 4464
565 Ga0207712_10043360 3300025961 Bacteria 3103
566 Ga0207712_10050898 3300025961 Bacteria 2894
567 Ga0207668_10019504 3300025972 Bacteria 4289
568 Ga0207668_10149718 3300025972 Bacteria 1805
569 Ga0207668_10167018 3300025972 Unclassified 1722
570 Ga0207640_10016538 3300025981 Bacteria 4293
571 Ga0207658_10002779 3300025986 Bacteria 12608
572 Ga0207658_10027385 3300025986 Bacteria 4003
573 Ga0207658_10046209 3300025986 Bacteria 3178
574 Ga0207658_10078649 3300025986 Bacteria 2521
575 Ga0207658_10114287 3300025986 Bacteria 2140
576 Ga0207677_10012452 3300026023 Bacteria 4890
577 Ga0207677_10018271 3300026023 Unclassified 4205
578 Ga0207677_10071755 3300026023 Bacteria 2445
579 Ga0207677_10087736 3300026023 Bacteria 2253
580 Ga0207677_10211589 3300026023 Bacteria 1549
581 Ga0207703_10000814 3300026035 Bacteria 30775
582 Ga0207703_10001555 3300026035 Bacteria 20808
583 Ga0207703_10203038 3300026035 Bacteria 1762
584 Ga0207639_10006392 3300026041 Bacteria 8004
585 Ga0207639_10015544 3300026041 Bacteria 5372
586 Ga0207639_10023150 3300026041 Unclassified 4482
587 Ga0207639_10097544 3300026041 Bacteria 2367
588 Ga0207639_10105225 3300026041 Unclassified 2289
589 Ga0207639_10123606 3300026041 Bacteria 2130
590 Ga0207678_10238804 3300026067 Bacteria 1556
591 Ga0207708_10126058 3300026075 Unclassified 1998
592 Ga0207702_10000161 3300026078 Bacteria 79598
593 Ga0207702_10103612 3300026078 Unclassified 2517
594 Ga0207702_10135432 3300026078 Bacteria 2222
595 Ga0207641_10000191 3300026088 Bacteria 84147
596 Ga0207641_10000822 3300026088 Bacteria 32995
597 Ga0207641_10005620 3300026088 Bacteria 10681
598 Ga0207641_10023041 3300026088 Bacteria 5130
599 Ga0207641_10033664 3300026088 Bacteria 4257
600 Ga0207641_10034437 3300026088 Bacteria 4213
601 Ga0207648_10001459 3300026089 Bacteria 26009
602 Ga0207648_10002849 3300026089 Bacteria 18310
603 Ga0207648_10005953 3300026089 Bacteria 12201
604 Ga0207648_10006750 3300026089 Bacteria 11382
605 Ga0207648_10013507 3300026089 Bacteria 7595
606 Ga0207648_10027226 3300026089 Bacteria 5078
607 Ga0207648_10027988 3300026089 Bacteria 5001
608 Ga0207648_10093493 3300026089 Bacteria 2629
609 Ga0207648_10142762 3300026089 Bacteria 2111
610 Ga0207676_10004453 3300026095 Bacteria 9907
611 Ga0207676_10021098 3300026095 Bacteria 4776
612 Ga0207676_10069843 3300026095 Bacteria 2814
613 Ga0207676_10076651 3300026095 Bacteria 2702
614 Ga0207676_10105876 3300026095 Unclassified 2342
615 Ga0207674_10007910 3300026116 Bacteria 12348
616 Ga0207674_10017658 3300026116 Bacteria 7779
617 Ga0207674_10034726 3300026116 Bacteria 5268
618 Ga0207674_10128270 3300026116 Unclassified 2501
619 Ga0207675_100000809 3300026118 Bacteria 31123
620 Ga0207675_100003900 3300026118 Bacteria 14503
621 Ga0207675_100146569 3300026118 Bacteria 2245
622 Ga0207675_100187304 3300026118 Bacteria 1984
623 Ga0207683_10015784 3300026121 Bacteria 6428
624 Ga0207683_10016479 3300026121 Bacteria 6290
625 Ga0207683_10020939 3300026121 Bacteria 5597
626 Ga0207698_10017035 3300026142 Bacteria 4919
627 Ga0207698_10025762 3300026142 Unclassified 4150
628 Ga0207698_10031547 3300026142 Bacteria 3826
629 Ga0207698_10041491 3300026142 Bacteria 3429
630 Ga0207698_10061255 3300026142 Bacteria 2932
631 Ga0207698_10095525 3300026142 Bacteria 2447
632 Ga0207698_10095838 3300026142 Bacteria 2444
633 Ga0207698_10124249 3300026142 Bacteria 2191
634 Ga0207428_10021810 3300027907 Bacteria 5418
635 Ga0268266_10000018 3300028379 Bacteria 569141
636 Ga0268266_10000068 3300028379 Bacteria 241100
637 Ga0268266_10014466 3300028379 Bacteria 6783
638 Ga0268265_10026320 3300028380 Bacteria 4138
639 Ga0268265_10135862 3300028380 Bacteria 2051
640 Ga0268264_10000079 3300028381 Bacteria 249516
641 Ga0268264_10001681 3300028381 Bacteria 20386
642 Ga0268264_10003159 3300028381 Bacteria 14267
643 Ga0268264_10008273 3300028381 Bacteria 8642
644 Ga0268264_10008652 3300028381 Bacteria 8457
645 Ga0268264_10022622 3300028381 Bacteria 5130
646 Ga0268264_10081343 3300028381 Bacteria 2768
647 Ga0307517_10004683 3300028786 Bacteria 20955
648 Ga0307517_10067908 3300028786 Bacteria 3256
649 Ga0307515_10000001 3300028794 Bacteria 4259510
650 Ga0307515_10000162 3300028794 Bacteria 163720
651 Ga0307511_10000382 3300030521 Bacteria 47277
652 Ga0307511_10000554 3300030521 Bacteria 40123
653 Ga0265340_10047318 3300031247 Bacteria 2095
654 Ga0265327_10000316 3300031251 Bacteria 92271
655 Ga0265327_10000404 3300031251 Bacteria 80704
656 Ga0265327_10008285 3300031251 Bacteria 7783
657 Ga0307513_10048179 3300031456 Unclassified 4627
658 Ga0307509_10042194 3300031507 Bacteria 4946
659 Ga0307509_10060375 3300031507 Bacteria 4008
660 Ga0307508_10000636 3300031616 Bacteria 42249
661 Ga0307508_10057994 3300031616 Bacteria 3426
662 Ga0307516_10001823 3300031730 Bacteria 29270
663 Ga0307516_10163925 3300031730 Bacteria 1970
664 Ga0307414_10103493 3300032004 Bacteria 2148
665 Ga0307510_10002326 3300033180 Bacteria 21483
666 Ga0307510_10010841 3300033180 Bacteria 10834
667 Ga0373937_0056284 3300036401 Bacteria 3612
668 Ga0395899_0000245 3300037312 Bacteria 72304
669 Ga0395899_0000629 3300037312 Bacteria 36706
670 Ga0395899_0027913 3300037312 Unclassified 4251
671 Ga0395900_0000480 3300037418 Bacteria 56578
672 Ga0395900_0040897 3300037418 Bacteria 4778
673 Ga0395898_0006652 3300037466 Bacteria 12328
674 Ga0395898_0090721 3300037466 Bacteria 2940
675 Ga0395898_0331414 3300037466 Bacteria 1451
676 Ga0395905_0000738 3300037471 Bacteria 43061
677 Ga0395901_0029084 3300038443 Bacteria 5686
678 Ga0395901_0083858 3300038443 Bacteria 3331
679 Ga0436365_1668618 3300039437 Bacteria 3341
680 Ga0436361_0573832 3300039447 Bacteria 5377
681 Ga0439439_0024979 3300041406 Bacteria 1502
682 Ga0439433_0023867 3300041999 Bacteria 1377
683 Ga0439442_011242 3300042002 Bacteria 1820
684 Ga0439448_0029004 3300042005 Bacteria 1750
685 Ga0439457_008790 3300042014 Bacteria 2370
686 Ga0451577_0074560 3300042876 Bacteria 3026
687 Ga0466972_0000123 3300044658 Bacteria 65577
688 Ga0466972_0006738 3300044658 Bacteria 5766
689 Ga0466972_0011566 3300044658 Bacteria 4431
690 Ga0466961_0070898 3300044693 Unclassified 2212
691 Ga0453684_0289305 3300044712 Bacteria 1866
692 Ga0466968_0031915 3300044735 Unclassified 2188
693 Ga0466970_0032022 3300044765 Unclassified 2778
694 Ga0466959_0029318 3300045049 Bacteria 4077
695 Ga0495638_0011155 3300046460 Bacteria 6206
696 Ga0495638_0079173 3300046460 Unclassified 1999
697 Ga0495638_0123592 3300046460 Bacteria 1527
698 Ga0495650_0000003 3300046471 Bacteria 900730
699 Ga0495650_0020244 3300046471 Bacteria 3249
700 Ga0495650_0039532 3300046471 Bacteria 2035
701 Ga0495585_0001096 3300046492 Bacteria 22298
702 Ga0495583_0036359 3300046506 Bacteria 2344
703 Ga0495606_0001265 3300046507 Bacteria 35151
704 Ga0495606_0005740 3300046507 Bacteria 11737
705 Ga0495606_0041576 3300046507 Bacteria 3082
706 Ga0495610_0000952 3300046512 Bacteria 26811
707 Ga0495616_0000819 3300046513 Bacteria 22682
708 Ga0495616_0008664 3300046513 Bacteria 6003
709 Ga0495631_0013203 3300046518 Bacteria 4015
710 Ga0495648_0005768 3300046524 Bacteria 10214
711 Ga0495611_0000209 3300046648 Bacteria 41348
712 Ga0495625_0000005 3300046660 Bacteria 596135
713 Ga0495625_0003156 3300046660 Bacteria 16788
714 Ga0495625_0028893 3300046660 Bacteria 4152
715 Ga0495635_0075810 3300046663 Bacteria 2304
716 Ga0495635_0166643 3300046663 Bacteria 1499
717 Ga0495661_0003610 3300046665 Bacteria 11392
718 Ga0495661_0010067 3300046665 Bacteria 6467
719 Ga0495670_0063520 3300046691 Bacteria 1859
720 Ga0495649_0000003 3300046694 Bacteria 880817
721 Ga0495600_0119597 3300046809 Bacteria 1714
722 Ga0495672_0020619 3300047320 Bacteria 4313
723 Ga0495683_0018182 3300047323 Bacteria 3636
724 Ga0495687_000564 3300047443 Bacteria 43681
725 Ga0495687_001156 3300047443 Bacteria 25557
726 Ga0495686_0000004 3300047472 Bacteria 869019
727 Ga0495686_0000111 3300047472 Bacteria 168708
728 Ga0495686_0000154 3300047472 Bacteria 131970
729 Ga0495686_0011013 3300047472 Bacteria 6397
730 Ga0496100_0081775 3300048903 Bacteria 2183
731 Ga0496110_0144274 3300048913 Bacteria 2153
732 Ga0495678_063545 3300049459 Unclassified 1378
733 Ga0501031_0009047 3300049568 Bacteria 6480
734 Ga0501032_0032184 3300049569 Unclassified 3593
735 Ga0501032_0138492 3300049569 Unclassified 1603
736 Ga0501033_0050505 3300049570 Unclassified 3085
737 Ga0501034_0000004 3300049571 Bacteria 382255
738 Ga0501034_0226073 3300049571 Unclassified 1822
739 Ga0501036_0109130 3300049572 Unclassified 2338
740 Ga0501037_0022847 3300049573 Bacteria 4624
741 Ga0501038_0088487 3300049574 Unclassified 2599
742 Ga0501039_0022502 3300049575 Bacteria 4838
743 Ga0501043_0018799 3300049579 Bacteria 5423
744 Ga0501046_0226331 3300049580 Unclassified 1383
745 Ga0501047_0200722 3300049581 Unclassified 1855
746 Ga0501067_0099461 3300049583 Unclassified 1615
747 Ga0501069_0024826 3300049585 Unclassified 3272
748 Ga0501070_0024601 3300049586 Bacteria 5049
749 Ga0501073_0017835 3300049589 Bacteria 5137
750 Ga0501073_0125427 3300049589 Unclassified 1780
751 Ga0501035_0005500 3300049822 Bacteria 11969
752 Ga0501035_0110662 3300049822 Unclassified 2407
753 Ga0501044_0077955 3300049823 Unclassified 3359
754 nmdc:mga0k408_14037_c1 3300050493 Bacteria 4404
755 nmdc:mga0k408_6554_c1 3300050493 Bacteria 6202
756 nmdc:mga09592_295790_c1 3300050508 Unclassified 1404
757 nmdc:mga09592_63121_c1 3300050508 Unclassified 3134
758 nmdc:mga09592_8127_c1 3300050508 Bacteria 8532
759 nmdc:mga0qj67_5578_c1 3300050509 Bacteria 9197
760 nmdc:mga06r32_11498_c1 3300050510 Bacteria 7973
761 nmdc:mga06r32_288102_c1 3300050510 Bacteria 1629
762 nmdc:mga06r32_88425_c1 3300050510 Bacteria 3024
763 nmdc:mga08y16_8912_c1 3300050511 Bacteria 10534
764 Ga0500583_0006433 3300053092 Bacteria 4043
765 Ga0500618_000001 3300053125 Bacteria 538477
766 Ga0500568_0001404 3300053139 Bacteria 15626
767 Ga0500616_0012667 3300053153 Bacteria 4930
768 Ga0500622_0000398 3300053156 Bacteria 41643
769 Ga0500624_000199 3300053157 Bacteria 23714
770 Ga0500611_000001 3300053727 Bacteria 385744
771 Ga0501084_0005233 3300054114 Bacteria 10617

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0289305 Ga0453684_0289305_699_1844 370
2 3300049583 Ga0501067_0099461 Ga0501067_0099461_433_1605 374
3 3300013105 Ga0157369_10207788 Ga0157369_102077882 380
4 3300046471 Ga0495650_0039532 Ga0495650_0039532_776_1972 389
5 3300049585 Ga0501069_0024826 Ga0501069_0024826_23_1246 391
6 3300013297 Ga0157378_10005161 Ga0157378_100051615 394
7 3300014745 Ga0157377_10005020 Ga0157377_100050205 394
8 3300046663 Ga0495635_0166643 Ga0495635_0166643_94_1299 394
9 3300005327 Ga0070658_10000027 Ga0070658_1000002731 395
10 3300005563 Ga0068855_100040797 Ga0068855_1000407976 395
11 3300005844 Ga0068862_100014299 Ga0068862_1000142995 395
12 3300025909 Ga0207705_10000053 Ga0207705_1000005331 395
13 3300025917 Ga0207660_10023754 Ga0207660_100237543 395
14 3300025949 Ga0207667_10032551 Ga0207667_100325512 395
15 3300013307 Ga0157372_10003748 Ga0157372_100037484 403
16 3300049580 Ga0501046_0226331 Ga0501046_0226331_105_1361 409
17 3300009545 Ga0105237_10006919 Ga0105237_100069197 412
18 3300025914 Ga0207671_10004864 Ga0207671_100048647 412
19 3300048903 Ga0496100_0081775 Ga0496100_0081775_888_2153 413
20 3300005616 Ga0068852_100033541 Ga0068852_1000335412 414
21 3300013104 Ga0157370_10008553 Ga0157370_100085534 414
22 3300013307 Ga0157372_10040159 Ga0157372_100401595 414
23 3300025904 Ga0207647_10064336 Ga0207647_100643362 414
24 3300026041 Ga0207639_10123606 Ga0207639_101236062 414
25 3300026142 Ga0207698_10041491 Ga0207698_100414911 414
26 3300046663 Ga0495635_0075810 Ga0495635_0075810_1028_2284 414
27 3300037466 Ga0395898_0331414 Ga0395898_0331414_139_1392 415
28 3300044693 Ga0466961_0070898 Ga0466961_0070898_682_2040 418
29 3300044765 Ga0466970_0032022 Ga0466970_0032022_984_2342 418
30 3300045049 Ga0466959_0029318 Ga0466959_0029318_554_1912 418
31 3300049568 Ga0501031_0009047 Ga0501031_0009047_893_2218 419
32 3300049569 Ga0501032_0138492 Ga0501032_0138492_234_1559 419
33 3300049572 Ga0501036_0109130 Ga0501036_0109130_745_2070 419
34 3300049574 Ga0501038_0088487 Ga0501038_0088487_663_1988 419
35 3300049575 Ga0501039_0022502 Ga0501039_0022502_1118_2443 419
36 3300049579 Ga0501043_0018799 Ga0501043_0018799_1273_2598 419
37 3300049589 Ga0501073_0125427 Ga0501073_0125427_434_1759 419
38 3300049822 Ga0501035_0110662 Ga0501035_0110662_163_1488 419
39 3300049823 Ga0501044_0077955 Ga0501044_0077955_502_1827 419
40 3300031730 Ga0307516_10001823 Ga0307516_1000182321 420
41 3300005458 Ga0070681_10038082 Ga0070681_100380821 421
42 3300025912 Ga0207707_10182078 Ga0207707_101820782 421
43 3300005458 Ga0070681_10015844 Ga0070681_100158441 422
44 3300025912 Ga0207707_10194744 Ga0207707_101947441 422
45 3300047472 Ga0495686_0000004 Ga0495686_0000004_758072_759397 422
46 3300005329 Ga0070683_100013392 Ga0070683_1000133923 423
47 3300005535 Ga0070684_100025867 Ga0070684_1000258672 423
48 3300005539 Ga0068853_100120197 Ga0068853_1001201972 423
49 3300005563 Ga0068855_100000556 Ga0068855_10000055625 423
50 3300005563 Ga0068855_100156418 Ga0068855_1001564182 423
51 3300005577 Ga0068857_100035129 Ga0068857_1000351293 423
52 3300005614 Ga0068856_100133076 Ga0068856_1001330762 423
53 3300009093 Ga0105240_10009161 Ga0105240_100091612 423
54 3300009093 Ga0105240_10014211 Ga0105240_100142118 423
55 3300009545 Ga0105237_10003761 Ga0105237_1000376110 423
56 3300009545 Ga0105237_10020484 Ga0105237_100204843 423
57 3300010375 Ga0105239_10090349 Ga0105239_100903493 423
58 3300013104 Ga0157370_10029690 Ga0157370_100296903 423
59 3300025913 Ga0207695_10000110 Ga0207695_100001106 423
60 3300025944 Ga0207661_10018857 Ga0207661_100188573 423
61 3300025949 Ga0207667_10000098 Ga0207667_1000009816 423
62 3300025949 Ga0207667_10000926 Ga0207667_100009263 423
63 3300026078 Ga0207702_10103612 Ga0207702_101036122 423
64 3300026116 Ga0207674_10007910 Ga0207674_100079106 423
65 3300028786 Ga0307517_10067908 Ga0307517_100679083 423
66 3300031251 Ga0265327_10008285 Ga0265327_100082855 423
67 3300044658 Ga0466972_0011566 Ga0466972_0011566_1588_2997 423
68 3300005356 Ga0070674_100034724 Ga0070674_1000347242 424
69 3300005563 Ga0068855_100064607 Ga0068855_1000646072 424
70 3300005577 Ga0068857_100003443 Ga0068857_1000034434 424
71 3300005578 Ga0068854_100006457 Ga0068854_1000064574 424
72 3300005616 Ga0068852_100005907 Ga0068852_1000059074 424
73 3300005843 Ga0068860_100001898 Ga0068860_1000018982 424
74 3300005843 Ga0068860_100130323 Ga0068860_1001303233 424
75 3300009093 Ga0105240_10004944 Ga0105240_100049447 424
76 3300009093 Ga0105240_10020572 Ga0105240_100205724 424
77 3300009545 Ga0105237_10001507 Ga0105237_1000150719 424
78 3300009551 Ga0105238_10007423 Ga0105238_100074237 424
79 3300010375 Ga0105239_10157831 Ga0105239_101578312 424
80 3300013104 Ga0157370_10042465 Ga0157370_100424653 424
81 3300013105 Ga0157369_10080716 Ga0157369_100807162 424
82 3300013307 Ga0157372_10000894 Ga0157372_100008946 424
83 3300025913 Ga0207695_10008031 Ga0207695_100080312 424
84 3300025913 Ga0207695_10166590 Ga0207695_101665902 424
85 3300025913 Ga0207695_10190792 Ga0207695_101907922 424
86 3300025924 Ga0207694_10013429 Ga0207694_100134293 424
87 3300025942 Ga0207689_10025756 Ga0207689_100257564 424
88 3300025949 Ga0207667_10002398 Ga0207667_100023984 424
89 3300025981 Ga0207640_10016538 Ga0207640_100165383 424
90 3300026118 Ga0207675_100003900 Ga0207675_1000039005 424
91 3300026142 Ga0207698_10031547 Ga0207698_100315473 424
92 3300028381 Ga0268264_10008273 Ga0268264_100082733 424
93 3300031251 Ga0265327_10000316 Ga0265327_1000031660 424
94 3300005336 Ga0070680_100000819 Ga0070680_10000081911 425
95 3300005337 Ga0070682_100020371 Ga0070682_1000203714 425
96 3300005341 Ga0070691_10018505 Ga0070691_100185052 425
97 3300005458 Ga0070681_10176847 Ga0070681_101768471 425
98 3300005530 Ga0070679_100142523 Ga0070679_1001425232 425
99 3300005539 Ga0068853_100012711 Ga0068853_1000127115 425
100 3300005547 Ga0070693_100032663 Ga0070693_1000326632 425
101 3300009093 Ga0105240_10013501 Ga0105240_1001350110 425
102 3300009174 Ga0105241_10000299 Ga0105241_100002991 425
103 3300025911 Ga0207654_10012775 Ga0207654_100127754 425
104 3300025913 Ga0207695_10022580 Ga0207695_100225802 425
105 3300025917 Ga0207660_10029454 Ga0207660_100294541 425
106 3300025921 Ga0207652_10007289 Ga0207652_100072891 425
107 3300025949 Ga0207667_10181280 Ga0207667_101812803 425
108 3300026041 Ga0207639_10023150 Ga0207639_100231504 425
109 3300049571 Ga0501034_0226073 Ga0501034_0226073_232_1590 425
110 3300049586 Ga0501070_0024601 Ga0501070_0024601_3127_4485 425
111 3300049589 Ga0501073_0017835 Ga0501073_0017835_145_1503 425
112 3300054114 Ga0501084_0005233 Ga0501084_0005233_1402_2760 425
113 3300005548 Ga0070665_100000014 Ga0070665_100000014288 426
114 3300005844 Ga0068862_100168814 Ga0068862_1001688142 426
115 3300005983 Ga0081540_1025198 Ga0081540_10251983 426
116 3300009545 Ga0105237_10108178 Ga0105237_101081782 426
117 3300013307 Ga0157372_10140157 Ga0157372_101401573 426
118 3300025914 Ga0207671_10065202 Ga0207671_100652022 426
119 3300028379 Ga0268266_10000068 Ga0268266_10000068146 426
120 3300005293 Ga0065715_10158521 Ga0065715_101585212 427
121 3300005338 Ga0068868_100075038 Ga0068868_1000750382 427
122 3300005457 Ga0070662_100000045 Ga0070662_10000004512 427
123 3300006880 Ga0075429_100131873 Ga0075429_1001318732 427
124 3300009147 Ga0114129_10067485 Ga0114129_100674852 427
125 3300009174 Ga0105241_10000796 Ga0105241_1000079611 427
126 3300013100 Ga0157373_10033350 Ga0157373_100333502 427
127 3300013102 Ga0157371_10148904 Ga0157371_101489042 427
128 3300013296 Ga0157374_10005314 Ga0157374_100053142 427
129 3300013307 Ga0157372_10072620 Ga0157372_100726202 427
130 3300013308 Ga0157375_10003434 Ga0157375_100034346 427
131 3300014745 Ga0157377_10005020 Ga0157377_100050203 427
132 3300014745 Ga0157377_10021089 Ga0157377_100210892 427
133 3300025904 Ga0207647_10000511 Ga0207647_100005113 427
134 3300025911 Ga0207654_10000585 Ga0207654_100005859 427
135 3300025933 Ga0207706_10000120 Ga0207706_1000012054 427
136 3300026116 Ga0207674_10034726 Ga0207674_100347262 427
137 3300031247 Ga0265340_10047318 Ga0265340_100473182 427
138 3300050508 nmdc:mga09592_63121_c1 nmdc:mga09592_63121_c1_1069_2406 427
139 3300005290 Ga0065712_10011412 Ga0065712_100114122 428
140 3300005295 Ga0065707_10006808 Ga0065707_100068083 428
141 3300005328 Ga0070676_10028857 Ga0070676_100288571 428
142 3300005353 Ga0070669_100139037 Ga0070669_1001390372 428
143 3300005365 Ga0070688_100082487 Ga0070688_1000824872 428
144 3300005543 Ga0070672_100151274 Ga0070672_1001512742 428
145 3300005549 Ga0070704_100149514 Ga0070704_1001495142 428
146 3300005577 Ga0068857_100105948 Ga0068857_1001059482 428
147 3300005614 Ga0068856_100025925 Ga0068856_1000259252 428
148 3300005617 Ga0068859_100082667 Ga0068859_1000826672 428
149 3300005844 Ga0068862_100114698 Ga0068862_1001146982 428
150 3300006931 Ga0097620_100082662 Ga0097620_1000826622 428
151 3300009093 Ga0105240_10000998 Ga0105240_1000099821 428
152 3300009174 Ga0105241_10001899 Ga0105241_100018995 428
153 3300009551 Ga0105238_10000790 Ga0105238_1000079011 428
154 3300010375 Ga0105239_10025660 Ga0105239_100256605 428
155 3300013306 Ga0163162_10002374 Ga0163162_1000237413 428
156 3300013308 Ga0157375_10003913 Ga0157375_1000391310 428
157 3300025315 Ga0207697_10020282 Ga0207697_100202822 428
158 3300025911 Ga0207654_10030053 Ga0207654_100300532 428
159 3300025913 Ga0207695_10001344 Ga0207695_1000134421 428
160 3300025914 Ga0207671_10009040 Ga0207671_100090406 428
161 3300025923 Ga0207681_10088551 Ga0207681_100885512 428
162 3300025924 Ga0207694_10004366 Ga0207694_100043665 428
163 3300025940 Ga0207691_10118175 Ga0207691_101181753 428
164 3300025972 Ga0207668_10149718 Ga0207668_101497182 428
165 3300027907 Ga0207428_10021810 Ga0207428_100218105 428
166 3300028380 Ga0268265_10135862 Ga0268265_101358622 428
167 3300047443 Ga0495687_001156 Ga0495687_001156_15038_16363 428
168 3300005335 Ga0070666_10106974 Ga0070666_101069741 429
169 3300005539 Ga0068853_100072551 Ga0068853_1000725512 429
170 3300005616 Ga0068852_100188113 Ga0068852_1001881132 429
171 3300025903 Ga0207680_10090071 Ga0207680_100900711 429
172 3300026041 Ga0207639_10105225 Ga0207639_101052252 429
173 3300006195 Ga0075366_10024404 Ga0075366_100244042 430
174 3300009553 Ga0105249_10068632 Ga0105249_100686322 430
175 3300025961 Ga0207712_10050898 Ga0207712_100508981 430
176 3300044658 Ga0466972_0000123 Ga0466972_0000123_39025_40362 430
177 3300046460 Ga0495638_0011155 Ga0495638_0011155_2278_3642 430
178 3300046524 Ga0495648_0005768 Ga0495648_0005768_1044_2408 430
179 3300053092 Ga0500583_0006433 Ga0500583_0006433_2600_3964 430
180 3300053156 Ga0500622_0000398 Ga0500622_0000398_32626_33990 430
181 3300005290 Ga0065712_10090253 Ga0065712_100902532 431
182 3300005328 Ga0070676_10051846 Ga0070676_100518462 431
183 3300005354 Ga0070675_100126483 Ga0070675_1001264832 431
184 3300005577 Ga0068857_100260931 Ga0068857_1002609311 431
185 3300006195 Ga0075366_10000467 Ga0075366_100004678 431
186 3300013102 Ga0157371_10050290 Ga0157371_100502902 431
187 3300013105 Ga0157369_10209501 Ga0157369_102095012 431
188 3300013307 Ga0157372_10144383 Ga0157372_101443833 431
189 3300025907 Ga0207645_10001491 Ga0207645_1000149113 431
190 3300025926 Ga0207659_10095290 Ga0207659_100952902 431
191 3300025933 Ga0207706_10047228 Ga0207706_100472283 431
192 3300025942 Ga0207689_10002462 Ga0207689_1000246210 431
193 3300030521 Ga0307511_10000382 Ga0307511_1000038222 431
194 3300046460 Ga0495638_0079173 Ga0495638_0079173_308_1633 431
195 3300050493 nmdc:mga0k408_14037_c1 nmdc:mga0k408_14037_c1_1294_2619 431
196 3300050493 nmdc:mga0k408_6554_c1 nmdc:mga0k408_6554_c1_1497_2888 431
197 3300005331 Ga0070670_100024231 Ga0070670_1000242313 432
198 3300005335 Ga0070666_10005046 Ga0070666_100050465 432
199 3300005338 Ga0068868_100005340 Ga0068868_1000053403 432
200 3300005347 Ga0070668_100074075 Ga0070668_1000740752 432
201 3300005353 Ga0070669_100051338 Ga0070669_1000513383 432
202 3300005456 Ga0070678_100013581 Ga0070678_1000135813 432
203 3300005539 Ga0068853_100001722 Ga0068853_1000017222 432
204 3300005543 Ga0070672_100051207 Ga0070672_1000512072 432
205 3300005548 Ga0070665_100000020 Ga0070665_100000020216 432
206 3300005843 Ga0068860_100067376 Ga0068860_1000673763 432
207 3300006237 Ga0097621_100030561 Ga0097621_1000305613 432
208 3300006358 Ga0068871_100010670 Ga0068871_1000106704 432
209 3300006881 Ga0068865_100012493 Ga0068865_1000124932 432
210 3300009553 Ga0105249_10055078 Ga0105249_100550782 432
211 3300013296 Ga0157374_10034609 Ga0157374_100346094 432
212 3300013297 Ga0157378_10015277 Ga0157378_100152773 432
213 3300013306 Ga0163162_10000032 Ga0163162_1000003238 432
214 3300014969 Ga0157376_10120433 Ga0157376_101204332 432
215 3300025315 Ga0207697_10023474 Ga0207697_100234743 432
216 3300025899 Ga0207642_10002442 Ga0207642_100024423 432
217 3300025926 Ga0207659_10016624 Ga0207659_100166242 432
218 3300025938 Ga0207704_10014507 Ga0207704_100145073 432
219 3300025940 Ga0207691_10009018 Ga0207691_100090183 432
220 3300025972 Ga0207668_10019504 Ga0207668_100195043 432
221 3300026089 Ga0207648_10006750 Ga0207648_100067506 432
222 3300026121 Ga0207683_10020939 Ga0207683_100209393 432
223 3300026142 Ga0207698_10124249 Ga0207698_101242492 432
224 3300028379 Ga0268266_10000018 Ga0268266_10000018293 432
225 3300028381 Ga0268264_10081343 Ga0268264_100813433 432
226 3300003323 rootH1_10278369 rootH1_102783691 433
227 3300005614 Ga0068856_100165564 Ga0068856_1001655642 433
228 3300005616 Ga0068852_100180968 Ga0068852_1001809681 433
229 3300013306 Ga0163162_10003819 Ga0163162_100038196 433
230 3300026078 Ga0207702_10135432 Ga0207702_101354322 433
231 3300047443 Ga0495687_000564 Ga0495687_000564_31528_32886 433
232 3300049571 Ga0501034_0000004 Ga0501034_0000004_62855_64177 433
233 3300031616 Ga0307508_10000636 Ga0307508_1000063623 434
234 3300031616 Ga0307508_10057994 Ga0307508_100579941 434
235 3300005843 Ga0068860_100003705 Ga0068860_1000037055 435
236 3300006844 Ga0075428_100078646 Ga0075428_1000786462 435
237 3300006846 Ga0075430_100002220 Ga0075430_10000222011 435
238 3300028380 Ga0268265_10026320 Ga0268265_100263201 435
239 3300031507 Ga0307509_10060375 Ga0307509_100603752 435
240 3300041406 Ga0439439_0024979 Ga0439439_0024979_136_1467 435
241 3300005334 Ga0068869_100001574 Ga0068869_1000015749 436
242 3300005618 Ga0068864_100096577 Ga0068864_1000965772 436
243 3300025918 Ga0207662_10099105 Ga0207662_100991052 436
244 3300005290 Ga0065712_10014996 Ga0065712_100149962 437
245 3300005330 Ga0070690_100025347 Ga0070690_1000253474 437
246 3300005331 Ga0070670_100067995 Ga0070670_1000679952 437
247 3300005331 Ga0070670_100074745 Ga0070670_1000747452 437
248 3300005334 Ga0068869_100073718 Ga0068869_1000737182 437
249 3300005355 Ga0070671_100083476 Ga0070671_1000834762 437
250 3300005355 Ga0070671_100106419 Ga0070671_1001064192 437
251 3300005367 Ga0070667_100149431 Ga0070667_1001494312 437
252 3300005438 Ga0070701_10048654 Ga0070701_100486541 437
253 3300005459 Ga0068867_100045251 Ga0068867_1000452513 437
254 3300005459 Ga0068867_100069205 Ga0068867_1000692053 437
255 3300005544 Ga0070686_100054756 Ga0070686_1000547562 437
256 3300005564 Ga0070664_100029202 Ga0070664_1000292025 437
257 3300006237 Ga0097621_100003375 Ga0097621_1000033756 437
258 3300006358 Ga0068871_100005284 Ga0068871_1000052846 437
259 3300009148 Ga0105243_10021225 Ga0105243_100212253 437
260 3300009545 Ga0105237_10036510 Ga0105237_100365103 437
261 3300010375 Ga0105239_10005789 Ga0105239_100057896 437
262 3300010375 Ga0105239_10009377 Ga0105239_100093778 437
263 3300013100 Ga0157373_10003779 Ga0157373_100037799 437
264 3300013102 Ga0157371_10067188 Ga0157371_100671881 437
265 3300013297 Ga0157378_10073638 Ga0157378_100736383 437
266 3300013297 Ga0157378_10334359 Ga0157378_103343591 437
267 3300013307 Ga0157372_10006151 Ga0157372_100061514 437
268 3300013307 Ga0157372_10059279 Ga0157372_100592794 437
269 3300014968 Ga0157379_10065388 Ga0157379_100653883 437
270 3300025914 Ga0207671_10001885 Ga0207671_1000188512 437
271 3300025914 Ga0207671_10002532 Ga0207671_1000253217 437
272 3300025914 Ga0207671_10039592 Ga0207671_100395922 437
273 3300025925 Ga0207650_10006464 Ga0207650_100064642 437
274 3300025925 Ga0207650_10028226 Ga0207650_100282262 437
275 3300025935 Ga0207709_10044636 Ga0207709_100446362 437
276 3300025940 Ga0207691_10058709 Ga0207691_100587094 437
277 3300025942 Ga0207689_10013593 Ga0207689_100135932 437
278 3300025945 Ga0207679_10005163 Ga0207679_100051634 437
279 3300025949 Ga0207667_10181850 Ga0207667_101818502 437
280 3300025960 Ga0207651_10007887 Ga0207651_100078874 437
281 3300026023 Ga0207677_10018271 Ga0207677_100182712 437
282 3300026089 Ga0207648_10027226 Ga0207648_100272263 437
283 3300026089 Ga0207648_10027988 Ga0207648_100279883 437
284 3300046471 Ga0495650_0020244 Ga0495650_0020244_782_2104 437
285 3300046507 Ga0495606_0041576 Ga0495606_0041576_1225_2547 437
286 3300046513 Ga0495616_0000819 Ga0495616_0000819_15539_16861 437
287 3300046660 Ga0495625_0003156 Ga0495625_0003156_5214_6536 437
288 3300047472 Ga0495686_0000154 Ga0495686_0000154_115923_117245 437
289 3300047472 Ga0495686_0011013 Ga0495686_0011013_3968_5290 437
290 3300049459 Ga0495678_063545 Ga0495678_063545_36_1358 437
291 3300053139 Ga0500568_0001404 Ga0500568_0001404_260_1582 437
292 3300053157 Ga0500624_000199 Ga0500624_000199_10452_11774 437
293 3300003203 JGI25406J46586_10022917 JGI25406J46586_100229171 438
294 3300003316 rootH1_10045334 rootH1_100453342 438
295 3300003320 rootH2_10001891 rootH2_10001891207 438
296 3300003320 rootH2_10053878 rootH2_100538787 438
297 3300003320 rootH2_10206634 rootH2_102066342 438
298 3300003320 rootH2_10218880 rootH2_102188804 438
299 3300003323 rootH1_10031468 rootH1_100314681 438
300 3300005288 Ga0065714_10070154 Ga0065714_100701543 438
301 3300005327 Ga0070658_10001676 Ga0070658_1000167612 438
302 3300005327 Ga0070658_10020971 Ga0070658_100209713 438
303 3300005327 Ga0070658_10183672 Ga0070658_101836721 438
304 3300005328 Ga0070676_10004075 Ga0070676_100040753 438
305 3300005330 Ga0070690_100083218 Ga0070690_1000832182 438
306 3300005331 Ga0070670_100039614 Ga0070670_1000396142 438
307 3300005334 Ga0068869_100015579 Ga0068869_1000155793 438
308 3300005334 Ga0068869_100046810 Ga0068869_1000468102 438
309 3300005335 Ga0070666_10000050 Ga0070666_100000504 438
310 3300005335 Ga0070666_10077082 Ga0070666_100770822 438
311 3300005336 Ga0070680_100041824 Ga0070680_1000418242 438
312 3300005338 Ga0068868_100000112 Ga0068868_10000011228 438
313 3300005339 Ga0070660_100020983 Ga0070660_1000209832 438
314 3300005347 Ga0070668_100000110 Ga0070668_10000011012 438
315 3300005354 Ga0070675_100051952 Ga0070675_1000519522 438
316 3300005355 Ga0070671_100011381 Ga0070671_1000113812 438
317 3300005355 Ga0070671_100145952 Ga0070671_1001459522 438
318 3300005364 Ga0070673_100000305 Ga0070673_1000003059 438
319 3300005364 Ga0070673_100000400 Ga0070673_1000004005 438
320 3300005366 Ga0070659_100176527 Ga0070659_1001765272 438
321 3300005367 Ga0070667_100013900 Ga0070667_1000139003 438
322 3300005367 Ga0070667_100016746 Ga0070667_1000167465 438
323 3300005367 Ga0070667_100091034 Ga0070667_1000910342 438
324 3300005455 Ga0070663_100015831 Ga0070663_1000158315 438
325 3300005456 Ga0070678_100007009 Ga0070678_1000070092 438
326 3300005456 Ga0070678_100103501 Ga0070678_1001035012 438
327 3300005458 Ga0070681_10030115 Ga0070681_100301153 438
328 3300005458 Ga0070681_10047701 Ga0070681_100477014 438
329 3300005459 Ga0068867_100000519 Ga0068867_1000005192 438
330 3300005459 Ga0068867_100000620 Ga0068867_10000062018 438
331 3300005530 Ga0070679_100012671 Ga0070679_1000126715 438
332 3300005530 Ga0070679_100093594 Ga0070679_1000935942 438
333 3300005539 Ga0068853_100003764 Ga0068853_1000037643 438
334 3300005539 Ga0068853_100023333 Ga0068853_1000233334 438
335 3300005543 Ga0070672_100000020 Ga0070672_10000002047 438
336 3300005548 Ga0070665_100000318 Ga0070665_10000031812 438
337 3300005563 Ga0068855_100001120 Ga0068855_10000112010 438
338 3300005563 Ga0068855_100019483 Ga0068855_1000194837 438
339 3300005563 Ga0068855_100110113 Ga0068855_1001101132 438
340 3300005563 Ga0068855_100132637 Ga0068855_1001326372 438
341 3300005577 Ga0068857_100112444 Ga0068857_1001124442 438
342 3300005614 Ga0068856_100000359 Ga0068856_10000035925 438
343 3300005614 Ga0068856_100013339 Ga0068856_1000133393 438
344 3300005614 Ga0068856_100027095 Ga0068856_1000270952 438
345 3300005614 Ga0068856_100124977 Ga0068856_1001249773 438
346 3300005616 Ga0068852_100001345 Ga0068852_10000134511 438
347 3300005616 Ga0068852_100009804 Ga0068852_1000098042 438
348 3300005616 Ga0068852_100020291 Ga0068852_1000202912 438
349 3300005617 Ga0068859_100000025 Ga0068859_100000025173 438
350 3300005618 Ga0068864_100000392 Ga0068864_1000003929 438
351 3300005618 Ga0068864_100027917 Ga0068864_1000279174 438
352 3300005719 Ga0068861_100009832 Ga0068861_1000098323 438
353 3300005834 Ga0068851_10006000 Ga0068851_100060002 438
354 3300005841 Ga0068863_100002244 Ga0068863_10000224416 438
355 3300005841 Ga0068863_100011055 Ga0068863_1000110553 438
356 3300005841 Ga0068863_100016345 Ga0068863_1000163453 438
357 3300005842 Ga0068858_100000342 Ga0068858_10000034218 438
358 3300005842 Ga0068858_100197746 Ga0068858_1001977462 438
359 3300005843 Ga0068860_100000061 Ga0068860_10000006185 438
360 3300005843 Ga0068860_100002976 Ga0068860_10000297613 438
361 3300005843 Ga0068860_100004130 Ga0068860_1000041303 438
362 3300005843 Ga0068860_100007522 Ga0068860_1000075223 438
363 3300005843 Ga0068860_100008934 Ga0068860_1000089347 438
364 3300005843 Ga0068860_100021106 Ga0068860_1000211065 438
365 3300005985 Ga0081539_10003031 Ga0081539_1000303114 438
366 3300006237 Ga0097621_100004382 Ga0097621_1000043829 438
367 3300006237 Ga0097621_100005541 Ga0097621_1000055412 438
368 3300006237 Ga0097621_100017205 Ga0097621_1000172053 438
369 3300006237 Ga0097621_100068666 Ga0097621_1000686663 438
370 3300006358 Ga0068871_100000100 Ga0068871_10000010012 438
371 3300006358 Ga0068871_100014817 Ga0068871_1000148175 438
372 3300006847 Ga0075431_100000819 Ga0075431_10000081910 438
373 3300006880 Ga0075429_100023162 Ga0075429_1000231623 438
374 3300006881 Ga0068865_100000174 Ga0068865_10000017417 438
375 3300006881 Ga0068865_100004637 Ga0068865_1000046374 438
376 3300006931 Ga0097620_100000025 Ga0097620_100000025173 438
377 3300009093 Ga0105240_10000674 Ga0105240_1000067420 438
378 3300009093 Ga0105240_10001351 Ga0105240_1000135112 438
379 3300009093 Ga0105240_10022499 Ga0105240_100224997 438
380 3300009093 Ga0105240_10029462 Ga0105240_100294625 438
381 3300009093 Ga0105240_10061084 Ga0105240_100610843 438
382 3300009093 Ga0105240_10182316 Ga0105240_101823161 438
383 3300009101 Ga0105247_10001380 Ga0105247_1000138012 438
384 3300009101 Ga0105247_10015255 Ga0105247_100152553 438
385 3300009147 Ga0114129_10104783 Ga0114129_101047833 438
386 3300009148 Ga0105243_10082364 Ga0105243_100823642 438
387 3300009148 Ga0105243_10148018 Ga0105243_101480181 438
388 3300009174 Ga0105241_10000688 Ga0105241_1000068811 438
389 3300009174 Ga0105241_10000761 Ga0105241_1000076112 438
390 3300009174 Ga0105241_10007361 Ga0105241_100073611 438
391 3300009176 Ga0105242_10016013 Ga0105242_100160132 438
392 3300009545 Ga0105237_10001169 Ga0105237_1000116911 438
393 3300009545 Ga0105237_10010656 Ga0105237_100106565 438
394 3300009545 Ga0105237_10048101 Ga0105237_100481012 438
395 3300009545 Ga0105237_10086948 Ga0105237_100869482 438
396 3300009545 Ga0105237_10116674 Ga0105237_101166743 438
397 3300009551 Ga0105238_10014765 Ga0105238_100147653 438
398 3300009551 Ga0105238_10105735 Ga0105238_101057352 438
399 3300009553 Ga0105249_10109333 Ga0105249_101093332 438
400 3300010375 Ga0105239_10001545 Ga0105239_100015457 438
401 3300010375 Ga0105239_10011830 Ga0105239_100118303 438
402 3300010375 Ga0105239_10027242 Ga0105239_100272424 438
403 3300010375 Ga0105239_10096610 Ga0105239_100966102 438
404 3300010375 Ga0105239_10136292 Ga0105239_101362923 438
405 3300011119 Ga0105246_10063544 Ga0105246_100635442 438
406 3300013102 Ga0157371_10005572 Ga0157371_1000557213 438
407 3300013102 Ga0157371_10010957 Ga0157371_100109578 438
408 3300013104 Ga0157370_10000673 Ga0157370_100006734 438
409 3300013104 Ga0157370_10236500 Ga0157370_102365002 438
410 3300013105 Ga0157369_10041129 Ga0157369_100411292 438
411 3300013105 Ga0157369_10043119 Ga0157369_100431193 438
412 3300013296 Ga0157374_10000202 Ga0157374_1000020225 438
413 3300013296 Ga0157374_10002159 Ga0157374_100021594 438
414 3300013297 Ga0157378_10017150 Ga0157378_100171502 438
415 3300013297 Ga0157378_10019086 Ga0157378_100190862 438
416 3300013297 Ga0157378_10029790 Ga0157378_100297902 438
417 3300013297 Ga0157378_10046894 Ga0157378_100468943 438
418 3300013297 Ga0157378_10057412 Ga0157378_100574123 438
419 3300013306 Ga0163162_10000201 Ga0163162_1000020122 438
420 3300013306 Ga0163162_10000544 Ga0163162_1000054416 438
421 3300013306 Ga0163162_10000549 Ga0163162_1000054921 438
422 3300013306 Ga0163162_10009583 Ga0163162_100095834 438
423 3300013306 Ga0163162_10016297 Ga0163162_100162973 438
424 3300013307 Ga0157372_10000020 Ga0157372_10000020153 438
425 3300013307 Ga0157372_10005808 Ga0157372_1000580813 438
426 3300013307 Ga0157372_10006101 Ga0157372_100061016 438
427 3300013307 Ga0157372_10179157 Ga0157372_101791572 438
428 3300013307 Ga0157372_10347321 Ga0157372_103473211 438
429 3300013308 Ga0157375_10000821 Ga0157375_1000082119 438
430 3300013308 Ga0157375_10051002 Ga0157375_100510023 438
431 3300013308 Ga0157375_10161244 Ga0157375_101612442 438
432 3300014325 Ga0163163_10000471 Ga0163163_100004716 438
433 3300014326 Ga0157380_10010345 Ga0157380_100103453 438
434 3300014326 Ga0157380_10085268 Ga0157380_100852682 438
435 3300014968 Ga0157379_10000115 Ga0157379_1000011515 438
436 3300014968 Ga0157379_10008675 Ga0157379_100086753 438
437 3300014969 Ga0157376_10001273 Ga0157376_1000127313 438
438 3300014969 Ga0157376_10002338 Ga0157376_100023383 438
439 3300014969 Ga0157376_10003237 Ga0157376_100032375 438
440 3300014969 Ga0157376_10004628 Ga0157376_100046282 438
441 3300014969 Ga0157376_10092472 Ga0157376_100924723 438
442 3300025250 Ga0209026_1005939 Ga0209026_10059393 438
443 3300025903 Ga0207680_10011428 Ga0207680_100114282 438
444 3300025904 Ga0207647_10000321 Ga0207647_100003217 438
445 3300025907 Ga0207645_10000874 Ga0207645_100008748 438
446 3300025909 Ga0207705_10003949 Ga0207705_100039498 438
447 3300025909 Ga0207705_10021770 Ga0207705_100217703 438
448 3300025909 Ga0207705_10097985 Ga0207705_100979852 438
449 3300025911 Ga0207654_10001259 Ga0207654_100012595 438
450 3300025911 Ga0207654_10042012 Ga0207654_100420122 438
451 3300025912 Ga0207707_10017719 Ga0207707_100177194 438
452 3300025912 Ga0207707_10024725 Ga0207707_100247254 438
453 3300025913 Ga0207695_10001232 Ga0207695_1000123217 438
454 3300025913 Ga0207695_10001456 Ga0207695_1000145629 438
455 3300025913 Ga0207695_10009725 Ga0207695_100097252 438
456 3300025913 Ga0207695_10021005 Ga0207695_100210053 438
457 3300025913 Ga0207695_10057802 Ga0207695_100578023 438
458 3300025913 Ga0207695_10061337 Ga0207695_100613373 438
459 3300025914 Ga0207671_10000974 Ga0207671_1000097412 438
460 3300025914 Ga0207671_10001755 Ga0207671_100017553 438
461 3300025914 Ga0207671_10004604 Ga0207671_100046042 438
462 3300025914 Ga0207671_10006852 Ga0207671_100068523 438
463 3300025914 Ga0207671_10008980 Ga0207671_100089803 438
464 3300025914 Ga0207671_10011481 Ga0207671_100114815 438
465 3300025914 Ga0207671_10050802 Ga0207671_100508022 438
466 3300025917 Ga0207660_10008655 Ga0207660_100086556 438
467 3300025919 Ga0207657_10048929 Ga0207657_100489292 438
468 3300025921 Ga0207652_10000451 Ga0207652_1000045110 438
469 3300025921 Ga0207652_10017039 Ga0207652_100170393 438
470 3300025924 Ga0207694_10082221 Ga0207694_100822212 438
471 3300025926 Ga0207659_10010129 Ga0207659_100101295 438
472 3300025931 Ga0207644_10031264 Ga0207644_100312642 438
473 3300025933 Ga0207706_10033612 Ga0207706_100336124 438
474 3300025934 Ga0207686_10007373 Ga0207686_100073734 438
475 3300025938 Ga0207704_10000099 Ga0207704_1000009923 438
476 3300025938 Ga0207704_10006041 Ga0207704_100060414 438
477 3300025940 Ga0207691_10000322 Ga0207691_1000032228 438
478 3300025941 Ga0207711_10122791 Ga0207711_101227913 438
479 3300025942 Ga0207689_10007633 Ga0207689_100076338 438
480 3300025949 Ga0207667_10001699 Ga0207667_1000169910 438
481 3300025949 Ga0207667_10012033 Ga0207667_100120337 438
482 3300025949 Ga0207667_10013584 Ga0207667_100135843 438
483 3300025949 Ga0207667_10090304 Ga0207667_100903042 438
484 3300025949 Ga0207667_10127196 Ga0207667_101271963 438
485 3300025960 Ga0207651_10005272 Ga0207651_100052723 438
486 3300025961 Ga0207712_10019169 Ga0207712_100191692 438
487 3300025972 Ga0207668_10167018 Ga0207668_101670181 438
488 3300025986 Ga0207658_10002779 Ga0207658_1000277915 438
489 3300025986 Ga0207658_10027385 Ga0207658_100273853 438
490 3300025986 Ga0207658_10078649 Ga0207658_100786492 438
491 3300026023 Ga0207677_10012452 Ga0207677_100124524 438
492 3300026023 Ga0207677_10071755 Ga0207677_100717552 438
493 3300026035 Ga0207703_10000814 Ga0207703_1000081428 438
494 3300026035 Ga0207703_10001555 Ga0207703_1000155514 438
495 3300026041 Ga0207639_10015544 Ga0207639_100155443 438
496 3300026041 Ga0207639_10097544 Ga0207639_100975442 438
497 3300026067 Ga0207678_10238804 Ga0207678_102388041 438
498 3300026078 Ga0207702_10000161 Ga0207702_1000016125 438
499 3300026088 Ga0207641_10000822 Ga0207641_1000082223 438
500 3300026088 Ga0207641_10005620 Ga0207641_100056208 438
501 3300026088 Ga0207641_10023041 Ga0207641_100230413 438
502 3300026089 Ga0207648_10001459 Ga0207648_100014593 438
503 3300026089 Ga0207648_10002849 Ga0207648_1000284913 438
504 3300026095 Ga0207676_10004453 Ga0207676_100044535 438
505 3300026095 Ga0207676_10105876 Ga0207676_101058764 438
506 3300026116 Ga0207674_10128270 Ga0207674_101282702 438
507 3300026121 Ga0207683_10015784 Ga0207683_100157844 438
508 3300026142 Ga0207698_10017035 Ga0207698_100170354 438
509 3300026142 Ga0207698_10025762 Ga0207698_100257624 438
510 3300028379 Ga0268266_10014466 Ga0268266_100144665 438
511 3300028381 Ga0268264_10000079 Ga0268264_1000007998 438
512 3300028381 Ga0268264_10001681 Ga0268264_1000168113 438
513 3300028381 Ga0268264_10003159 Ga0268264_100031592 438
514 3300028381 Ga0268264_10008652 Ga0268264_100086522 438
515 3300028381 Ga0268264_10022622 Ga0268264_100226222 438
516 3300028786 Ga0307517_10004683 Ga0307517_100046834 438
517 3300028794 Ga0307515_10000162 Ga0307515_1000016216 438
518 3300030521 Ga0307511_10000554 Ga0307511_1000055431 438
519 3300031456 Ga0307513_10048179 Ga0307513_100481794 438
520 3300031507 Ga0307509_10042194 Ga0307509_100421942 438
521 3300031730 Ga0307516_10163925 Ga0307516_101639252 438
522 3300032004 Ga0307414_10103493 Ga0307414_101034932 438
523 3300033180 Ga0307510_10002326 Ga0307510_100023266 438
524 3300033180 Ga0307510_10010841 Ga0307510_100108416 438
525 3300036401 Ga0373937_0056284 Ga0373937_0056284_2112_3449 438
526 3300037312 Ga0395899_0000245 Ga0395899_0000245_27705_29084 438
527 3300037312 Ga0395899_0000629 Ga0395899_0000629_25450_26775 438
528 3300037312 Ga0395899_0027913 Ga0395899_0027913_2056_3381 438
529 3300037418 Ga0395900_0000480 Ga0395900_0000480_22152_23477 438
530 3300037418 Ga0395900_0040897 Ga0395900_0040897_2290_3615 438
531 3300037418 Ga0395900_0040897 Ga0395900_0040897_882_2249 438
532 3300037466 Ga0395898_0006652 Ga0395898_0006652_1595_2920 438
533 3300037466 Ga0395898_0090721 Ga0395898_0090721_661_1986 438
534 3300037471 Ga0395905_0000738 Ga0395905_0000738_19619_20944 438
535 3300038443 Ga0395901_0029084 Ga0395901_0029084_2660_3985 438
536 3300038443 Ga0395901_0083858 Ga0395901_0083858_1136_2461 438
537 3300039447 Ga0436361_0573832 Ga0436361_0573832_3692_5044 438
538 3300042005 Ga0439448_0029004 Ga0439448_0029004_224_1552 438
539 3300042876 Ga0451577_0074560 Ga0451577_0074560_1015_2340 438
540 3300044658 Ga0466972_0006738 Ga0466972_0006738_890_2218 438
541 3300044735 Ga0466968_0031915 Ga0466968_0031915_540_1868 438
542 3300046460 Ga0495638_0123592 Ga0495638_0123592_37_1365 438
543 3300046471 Ga0495650_0000003 Ga0495650_0000003_557545_558873 438
544 3300046492 Ga0495585_0001096 Ga0495585_0001096_5599_6927 438
545 3300046506 Ga0495583_0036359 Ga0495583_0036359_521_1849 438
546 3300046507 Ga0495606_0001265 Ga0495606_0001265_32718_34046 438
547 3300046507 Ga0495606_0005740 Ga0495606_0005740_146_1471 438
548 3300046512 Ga0495610_0000952 Ga0495610_0000952_20417_21745 438
549 3300046513 Ga0495616_0008664 Ga0495616_0008664_1967_3295 438
550 3300046518 Ga0495631_0013203 Ga0495631_0013203_1657_2982 438
551 3300046648 Ga0495611_0000209 Ga0495611_0000209_29626_30951 438
552 3300046660 Ga0495625_0000005 Ga0495625_0000005_493720_495048 438
553 3300046665 Ga0495661_0003610 Ga0495661_0003610_2465_3793 438
554 3300046665 Ga0495661_0010067 Ga0495661_0010067_1503_2831 438
555 3300046691 Ga0495670_0063520 Ga0495670_0063520_469_1800 438
556 3300046694 Ga0495649_0000003 Ga0495649_0000003_674478_675806 438
557 3300047323 Ga0495683_0018182 Ga0495683_0018182_32_1384 438
558 3300047472 Ga0495686_0000111 Ga0495686_0000111_76356_77690 438
559 3300049569 Ga0501032_0032184 Ga0501032_0032184_574_1923 438
560 3300049570 Ga0501033_0050505 Ga0501033_0050505_27_1376 438
561 3300049573 Ga0501037_0022847 Ga0501037_0022847_162_1511 438
562 3300049581 Ga0501047_0200722 Ga0501047_0200722_314_1663 438
563 3300049822 Ga0501035_0005500 Ga0501035_0005500_5587_6936 438
564 3300050510 nmdc:mga06r32_11498_c1 nmdc:mga06r32_11498_c1_6571_7920 438
565 3300053125 Ga0500618_000001 Ga0500618_000001_306880_308205 438
566 3300053153 Ga0500616_0012667 Ga0500616_0012667_2580_3914 438
567 3300003316 rootH1_10147241 rootH1_101472413 439
568 3300003322 rootL2_10037862 rootL2_100378623 439
569 3300003322 rootL2_10067458 rootL2_100674582 439
570 3300005327 Ga0070658_10026391 Ga0070658_100263914 439
571 3300005329 Ga0070683_100004423 Ga0070683_10000442316 439
572 3300005335 Ga0070666_10041186 Ga0070666_100411862 439
573 3300005338 Ga0068868_100034697 Ga0068868_1000346974 439
574 3300005339 Ga0070660_100070028 Ga0070660_1000700281 439
575 3300005344 Ga0070661_100024118 Ga0070661_1000241182 439
576 3300005354 Ga0070675_100096490 Ga0070675_1000964902 439
577 3300005354 Ga0070675_100151212 Ga0070675_1001512122 439
578 3300005356 Ga0070674_100018171 Ga0070674_1000181713 439
579 3300005364 Ga0070673_100056895 Ga0070673_1000568952 439
580 3300005457 Ga0070662_100027999 Ga0070662_1000279994 439
581 3300005459 Ga0068867_100053273 Ga0068867_1000532731 439
582 3300005459 Ga0068867_100213403 Ga0068867_1002134031 439
583 3300005530 Ga0070679_100136714 Ga0070679_1001367142 439
584 3300005535 Ga0070684_100037004 Ga0070684_1000370045 439
585 3300005547 Ga0070693_100046893 Ga0070693_1000468931 439
586 3300005563 Ga0068855_100000033 Ga0068855_100000033111 439
587 3300005563 Ga0068855_100078973 Ga0068855_1000789732 439
588 3300005564 Ga0070664_100058975 Ga0070664_1000589753 439
589 3300005564 Ga0070664_100072834 Ga0070664_1000728342 439
590 3300005564 Ga0070664_100141641 Ga0070664_1001416412 439
591 3300005578 Ga0068854_100049388 Ga0068854_1000493883 439
592 3300005614 Ga0068856_100081991 Ga0068856_1000819912 439
593 3300005616 Ga0068852_100010585 Ga0068852_1000105852 439
594 3300005616 Ga0068852_100151192 Ga0068852_1001511922 439
595 3300005843 Ga0068860_100045244 Ga0068860_1000452442 439
596 3300005844 Ga0068862_100183604 Ga0068862_1001836042 439
597 3300006358 Ga0068871_100002056 Ga0068871_10000205615 439
598 3300009093 Ga0105240_10000396 Ga0105240_1000039617 439
599 3300009174 Ga0105241_10237770 Ga0105241_102377702 439
600 3300010375 Ga0105239_10047136 Ga0105239_100471362 439
601 3300010375 Ga0105239_10063809 Ga0105239_100638092 439
602 3300013100 Ga0157373_10034969 Ga0157373_100349692 439
603 3300013102 Ga0157371_10020816 Ga0157371_100208163 439
604 3300013102 Ga0157371_10027048 Ga0157371_100270482 439
605 3300013105 Ga0157369_10008359 Ga0157369_1000835912 439
606 3300013105 Ga0157369_10245748 Ga0157369_102457481 439
607 3300013296 Ga0157374_10006821 Ga0157374_1000682114 439
608 3300013297 Ga0157378_10021365 Ga0157378_100213652 439
609 3300013306 Ga0163162_10072909 Ga0163162_100729094 439
610 3300013307 Ga0157372_10036860 Ga0157372_100368602 439
611 3300013307 Ga0157372_10078720 Ga0157372_100787203 439
612 3300013307 Ga0157372_10351160 Ga0157372_103511601 439
613 3300014745 Ga0157377_10009617 Ga0157377_100096172 439
614 3300025907 Ga0207645_10065610 Ga0207645_100656102 439
615 3300025913 Ga0207695_10000023 Ga0207695_10000023321 439
616 3300025913 Ga0207695_10000031 Ga0207695_10000031250 439
617 3300025913 Ga0207695_10022991 Ga0207695_100229916 439
618 3300025919 Ga0207657_10019335 Ga0207657_100193351 439
619 3300025921 Ga0207652_10155768 Ga0207652_101557682 439
620 3300025926 Ga0207659_10102738 Ga0207659_101027381 439
621 3300025932 Ga0207690_10154461 Ga0207690_101544611 439
622 3300025933 Ga0207706_10003224 Ga0207706_100032245 439
623 3300025937 Ga0207669_10002105 Ga0207669_100021056 439
624 3300025937 Ga0207669_10027965 Ga0207669_100279653 439
625 3300025945 Ga0207679_10039157 Ga0207679_100391572 439
626 3300025949 Ga0207667_10000046 Ga0207667_10000046186 439
627 3300025960 Ga0207651_10110153 Ga0207651_101101532 439
628 3300026041 Ga0207639_10006392 Ga0207639_100063924 439
629 3300026089 Ga0207648_10005953 Ga0207648_100059538 439
630 3300026089 Ga0207648_10013507 Ga0207648_100135074 439
631 3300026142 Ga0207698_10095525 Ga0207698_100955252 439
632 3300026142 Ga0207698_10095838 Ga0207698_100958382 439
633 3300028794 Ga0307515_10000001 Ga0307515_100000011482 439
634 3300031251 Ga0265327_10000404 Ga0265327_1000040426 439
635 3300039437 Ga0436365_1668618 Ga0436365_1668618_584_1918 439
636 3300046660 Ga0495625_0028893 Ga0495625_0028893_1488_2819 439
637 3300047320 Ga0495672_0020619 Ga0495672_0020619_2379_3752 439
638 3300005329 Ga0070683_100047781 Ga0070683_1000477812 440
639 3300005330 Ga0070690_100017469 Ga0070690_1000174694 440
640 3300005334 Ga0068869_100012466 Ga0068869_1000124663 440
641 3300005334 Ga0068869_100014525 Ga0068869_1000145253 440
642 3300005335 Ga0070666_10054122 Ga0070666_100541222 440
643 3300005338 Ga0068868_100054875 Ga0068868_1000548752 440
644 3300005344 Ga0070661_100053610 Ga0070661_1000536102 440
645 3300005354 Ga0070675_100165213 Ga0070675_1001652132 440
646 3300005355 Ga0070671_100016026 Ga0070671_1000160262 440
647 3300005364 Ga0070673_100046985 Ga0070673_1000469853 440
648 3300005367 Ga0070667_100053128 Ga0070667_1000531283 440
649 3300005456 Ga0070678_100023647 Ga0070678_1000236472 440
650 3300005457 Ga0070662_100042465 Ga0070662_1000424652 440
651 3300005459 Ga0068867_100065844 Ga0068867_1000658442 440
652 3300005535 Ga0070684_100139871 Ga0070684_1001398712 440
653 3300005544 Ga0070686_100014929 Ga0070686_1000149293 440
654 3300005564 Ga0070664_100237927 Ga0070664_1002379271 440
655 3300005577 Ga0068857_100033135 Ga0068857_1000331353 440
656 3300005578 Ga0068854_100034123 Ga0068854_1000341233 440
657 3300005616 Ga0068852_100075882 Ga0068852_1000758823 440
658 3300005719 Ga0068861_100133175 Ga0068861_1001331752 440
659 3300005834 Ga0068851_10057597 Ga0068851_100575971 440
660 3300005841 Ga0068863_100199281 Ga0068863_1001992812 440
661 3300005842 Ga0068858_100061184 Ga0068858_1000611842 440
662 3300005985 Ga0081539_10011072 Ga0081539_100110722 440
663 3300006358 Ga0068871_100078597 Ga0068871_1000785972 440
664 3300006358 Ga0068871_100086753 Ga0068871_1000867533 440
665 3300009093 Ga0105240_10188537 Ga0105240_101885373 440
666 3300009148 Ga0105243_10235633 Ga0105243_102356332 440
667 3300009553 Ga0105249_10023271 Ga0105249_100232713 440
668 3300013296 Ga0157374_10013923 Ga0157374_100139232 440
669 3300013296 Ga0157374_10038133 Ga0157374_100381332 440
670 3300013297 Ga0157378_10100881 Ga0157378_101008812 440
671 3300013308 Ga0157375_10028292 Ga0157375_100282924 440
672 3300014968 Ga0157379_10033631 Ga0157379_100336312 440
673 3300014968 Ga0157379_10054904 Ga0157379_100549042 440
674 3300014969 Ga0157376_10027053 Ga0157376_100270531 440
675 3300014969 Ga0157376_10110770 Ga0157376_101107702 440
676 3300017792 Ga0163161_10036617 Ga0163161_100366173 440
677 3300025893 Ga0207682_10020942 Ga0207682_100209422 440
678 3300025903 Ga0207680_10122908 Ga0207680_101229082 440
679 3300025907 Ga0207645_10008058 Ga0207645_100080582 440
680 3300025913 Ga0207695_10139961 Ga0207695_101399613 440
681 3300025933 Ga0207706_10008325 Ga0207706_100083256 440
682 3300025944 Ga0207661_10015706 Ga0207661_100157062 440
683 3300025945 Ga0207679_10068693 Ga0207679_100686933 440
684 3300025986 Ga0207658_10114287 Ga0207658_101142871 440
685 3300026023 Ga0207677_10087736 Ga0207677_100877362 440
686 3300026035 Ga0207703_10203038 Ga0207703_102030381 440
687 3300026089 Ga0207648_10093493 Ga0207648_100934932 440
688 3300026089 Ga0207648_10142762 Ga0207648_101427622 440
689 3300026095 Ga0207676_10076651 Ga0207676_100766512 440
690 3300026116 Ga0207674_10017658 Ga0207674_100176586 440
691 3300026121 Ga0207683_10016479 Ga0207683_100164792 440
692 3300026142 Ga0207698_10061255 Ga0207698_100612553 440
693 3300048913 Ga0496110_0144274 Ga0496110_0144274_255_1583 440
694 3300053727 Ga0500611_000001 Ga0500611_000001_212463_213788 440
695 3300005355 Ga0070671_100164925 Ga0070671_1001649252 441
696 3300005367 Ga0070667_100043490 Ga0070667_1000434902 441
697 3300005459 Ga0068867_100048127 Ga0068867_1000481272 441
698 3300005471 Ga0070698_100000261 Ga0070698_10000026129 441
699 3300005719 Ga0068861_100040128 Ga0068861_1000401283 441
700 3300005841 Ga0068863_100062044 Ga0068863_1000620442 441
701 3300006237 Ga0097621_100008467 Ga0097621_1000084674 441
702 3300006358 Ga0068871_100001044 Ga0068871_10000104411 441
703 3300006844 Ga0075428_100028386 Ga0075428_1000283863 441
704 3300009147 Ga0114129_10300708 Ga0114129_103007081 441
705 3300009177 Ga0105248_10011596 Ga0105248_100115964 441
706 3300009553 Ga0105249_10035127 Ga0105249_100351273 441
707 3300013297 Ga0157378_10155381 Ga0157378_101553812 441
708 3300013306 Ga0163162_10002245 Ga0163162_100022456 441
709 3300013306 Ga0163162_10123550 Ga0163162_101235502 441
710 3300014326 Ga0157380_10117169 Ga0157380_101171692 441
711 3300014745 Ga0157377_10021291 Ga0157377_100212913 441
712 3300014968 Ga0157379_10007087 Ga0157379_100070873 441
713 3300014968 Ga0157379_10140503 Ga0157379_101405032 441
714 3300014969 Ga0157376_10013495 Ga0157376_100134952 441
715 3300017792 Ga0163161_10002103 Ga0163161_100021033 441
716 3300025926 Ga0207659_10112018 Ga0207659_101120182 441
717 3300025941 Ga0207711_10033453 Ga0207711_100334533 441
718 3300025986 Ga0207658_10046209 Ga0207658_100462093 441
719 3300026118 Ga0207675_100187304 Ga0207675_1001873042 441
720 3300041999 Ga0439433_0023867 Ga0439433_0023867_16_1365 441
721 3300042002 Ga0439442_011242 Ga0439442_011242_187_1536 441
722 3300042014 Ga0439457_008790 Ga0439457_008790_410_1759 441
723 3300050508 nmdc:mga09592_8127_c1 nmdc:mga09592_8127_c1_6592_7938 441
724 3300050510 nmdc:mga06r32_88425_c1 nmdc:mga06r32_88425_c1_1385_2731 441
725 3300050511 nmdc:mga08y16_8912_c1 nmdc:mga08y16_8912_c1_381_1709 441
726 3300003322 rootL2_10039747 rootL2_100397472 442
727 3300003323 rootH1_10016444 rootH1_100164441 442
728 3300005343 Ga0070687_100029446 Ga0070687_1000294462 442
729 3300005719 Ga0068861_100007156 Ga0068861_1000071564 442
730 3300006847 Ga0075431_100097112 Ga0075431_1000971121 442
731 3300006880 Ga0075429_100112600 Ga0075429_1001126001 442
732 3300014325 Ga0163163_10000079 Ga0163163_1000007921 442
733 3300026118 Ga0207675_100000809 Ga0207675_10000080914 442
734 3300050508 nmdc:mga09592_295790_c1 nmdc:mga09592_295790_c1_64_1392 442
735 3300050509 nmdc:mga0qj67_5578_c1 nmdc:mga0qj67_5578_c1_1691_3019 442
736 3300050510 nmdc:mga06r32_288102_c1 nmdc:mga06r32_288102_c1_80_1408 442
737 3300002459 JGI24751J29686_10000975 JGI24751J29686_100009755 443
738 3300005331 Ga0070670_100128486 Ga0070670_1001284861 443
739 3300005343 Ga0070687_100058780 Ga0070687_1000587802 443
740 3300005365 Ga0070688_100059224 Ga0070688_1000592243 443
741 3300005441 Ga0070700_100074008 Ga0070700_1000740081 443
742 3300005471 Ga0070698_100002003 Ga0070698_10000200310 443
743 3300005471 Ga0070698_100003063 Ga0070698_10000306310 443
744 3300005618 Ga0068864_100030555 Ga0068864_1000305553 443
745 3300005719 Ga0068861_100147026 Ga0068861_1001470262 443
746 3300005841 Ga0068863_100007966 Ga0068863_1000079669 443
747 3300006237 Ga0097621_100051433 Ga0097621_1000514332 443
748 3300009176 Ga0105242_10020621 Ga0105242_100206214 443
749 3300009177 Ga0105248_10136473 Ga0105248_101364733 443
750 3300009553 Ga0105249_10001054 Ga0105249_1000105411 443
751 3300009553 Ga0105249_10008648 Ga0105249_100086485 443
752 3300013306 Ga0163162_10092742 Ga0163162_100927423 443
753 3300013306 Ga0163162_10362508 Ga0163162_103625082 443
754 3300013308 Ga0157375_10056180 Ga0157375_100561803 443
755 3300014325 Ga0163163_10227766 Ga0163163_102277662 443
756 3300014969 Ga0157376_10129796 Ga0157376_101297962 443
757 3300025908 Ga0207643_10014097 Ga0207643_100140973 443
758 3300025926 Ga0207659_10208994 Ga0207659_102089941 443
759 3300025934 Ga0207686_10003837 Ga0207686_100038375 443
760 3300025940 Ga0207691_10068359 Ga0207691_100683592 443
761 3300025942 Ga0207689_10074796 Ga0207689_100747963 443
762 3300025961 Ga0207712_10017000 Ga0207712_100170003 443
763 3300025961 Ga0207712_10043360 Ga0207712_100433602 443
764 3300026023 Ga0207677_10211589 Ga0207677_102115892 443
765 3300026075 Ga0207708_10126058 Ga0207708_101260581 443
766 3300026088 Ga0207641_10000191 Ga0207641_1000019121 443
767 3300026088 Ga0207641_10033664 Ga0207641_100336642 443
768 3300026088 Ga0207641_10034437 Ga0207641_100344374 443
769 3300026095 Ga0207676_10021098 Ga0207676_100210982 443
770 3300026095 Ga0207676_10069843 Ga0207676_100698432 443
771 3300026118 Ga0207675_100146569 Ga0207675_1001465692 443
772 3300046809 Ga0495600_0119597 Ga0495600_0119597_39_1394 443

Structural Annotation

Top 5 Hits

ID Description Score Start End
4usz-assembly1.cif.gz_A crystal structure of the first bacterial vanadium dependant iodoperoxidase 0.9464 31 443
4cit-assembly1.cif.gz_A crystal structure of the first bacterial vanadium dependant iodoperoxidase 0.9412 32 443
4usz-assembly1.cif.gz_A crystal structure of the first bacterial vanadium dependant iodoperoxidase 0.9241 31 443
4cit-assembly1.cif.gz_A crystal structure of the first bacterial vanadium dependant iodoperoxidase 0.9121 32 443
8cxl-assembly1.cif.gz_B structure of naph3, a vanadium-dependent haloperoxidase homolog catalyzing the stereospecific alpha-hydroxyketone rearrangement reaction in napyradiomycin biosynthesis 0.7343 53 438
ID Description Score Start End Superfamily
4citA00 Mainly Alpha;Orthogonal Bundle;Vanadium-containing Chloroperoxidase; domain 2; 0.9402 32 443 1.10.606.20
4citA00 Mainly Alpha;Orthogonal Bundle;Vanadium-containing Chloroperoxidase; domain 2; 0.911 32 443 1.10.606.20
af_Q54FF5_166_492_1.10.606.10 Mainly Alpha;Orthogonal Bundle;Vanadium-containing Chloroperoxidase; domain 2;Vanadium-containing Chloroperoxidase, domain 2 0.7753 186 438 1.10.606.10
af_Q75HI8_51_243_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.6838 236 437 1.20.144.10
1qhbF00 Mainly Alpha;Orthogonal Bundle;Vanadium-containing Chloroperoxidase; domain 2;Vanadium-containing Chloroperoxidase, domain 2 0.6814 303 438 1.10.606.10
ID Description Score Start End GO Terms
AF-A0A849D8M1-F1-model_v4 Phosphatase PAP2 family protein 0.9826 351 443
AF-A0A4Q3DX40-F1-model_v4 Phosphatase PAP2 family protein 0.9819 198 443
AF-A0A3B8T443-F1-model_v4 deleted 0.9813 302 443
AF-A0A0J1BQ34-F1-model_v4 Phosphatidic acid phosphatase type 2/haloperoxidase domain-containing protein 0.9803 364 443
AF-A0A537JLG3-F1-model_v4 Vanadium-dependent haloperoxidase 0.9791 135 443 GO:0004601

Feature Viewer

pLDDT pTM Quality
91.28 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map