F480123

General Info

Members Datasets Scaffolds Average Seq Length
772 308 756 158

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10678243|Ga0307405_106782432
Length 147
Sequence MSEGSNIRIEEVEGVAPPPRARVDESPQAKLERKRDYLDGFLAQKPAEVPAGEPGGPLYDGVIDALKEIYDPEIPVNIYELGLIYGVDVSDDADTPHCPVAESMPGEVELRVGAVPGVRDAEVNLVWDPPWDPAKMSDEARLELGML

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
4 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
5 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
6 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
7 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
8 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
9 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
10 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
11 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
12 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
13 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
14 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
15 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
16 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
17 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
18 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
19 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
20 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
21 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
22 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
25 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
26 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
27 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
28 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
29 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
170 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
171 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
184 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
185 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
186 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
187 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
188 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
191 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
192 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
197 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
198 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
199 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
200 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
201 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
202 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
203 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
204 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
205 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
208 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
209 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
226 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
227 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
228 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
229 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
230 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
231 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
232 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
233 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
234 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
237 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
238 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
239 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
251 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
252 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
253 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
254 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
255 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
256 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
257 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
258 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
259 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
260 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
261 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
262 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
263 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
264 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
265 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
266 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
267 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
268 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
269 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
270 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
274 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
275 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
276 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
277 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
278 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
279 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
280 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
281 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
284 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
285 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
286 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
287 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
288 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
289 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
290 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
291 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
292 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
293 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
294 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
295 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
296 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
297 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
298 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
299 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
300 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
301 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
302 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
303 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
304 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
305 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
306 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
307 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
308 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.93
Metatranscriptomes 0
Isolates 2.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.53
Nodule 0.26
Rhizoplane 4.66
Rhizosphere 76.3
Stem 0
Stem Tuber 0
Unclassified 7.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2375226 2162886007 Bacteria 9321
2 SwRhRL2b_contig_3705888 2162886007 Bacteria 2379
3 JGI24736J21556_1000162 3300001904 Bacteria 11868
4 JGI24741J21665_1030381 3300001915 Bacteria 810
5 JGI24752J21851_1000138 3300001976 Bacteria 9836
6 JGI24752J21851_1002192 3300001976 Bacteria 2608
7 JGI24740J21852_10045219 3300001979 Bacteria 1301
8 JGI24740J21852_10104351 3300001979 Bacteria 719
9 JGI24739J22299_10008859 3300001989 Bacteria 3751
10 JGI24737J22298_10030127 3300001990 Bacteria 1699
11 JGI24750J21931_1000338 3300002070 Bacteria 7951
12 JGI24750J21931_1036357 3300002070 Bacteria 737
13 JGI24748J21848_1000033 3300002074 Bacteria 78443
14 JGI24738J21930_10024920 3300002075 Bacteria 1230
15 JGI24749J21850_1002743 3300002076 Bacteria 2467
16 JGI24034J26672_10000032 3300002239 Bacteria 89175
17 JGI24034J26672_10049767 3300002239 Bacteria 719
18 JGI24751J29686_10013878 3300002459 Bacteria 1663
19 Ga0055530_10061550 3300003791 Bacteria 836
20 Ga0065704_10000553 3300005289 Bacteria 24228
21 Ga0065704_10070157 3300005289 Bacteria 211668
22 Ga0065704_10084844 3300005289 Bacteria 3289
23 Ga0065704_10358848 3300005289 Bacteria 800
24 Ga0065707_10253023 3300005295 Bacteria 1119
25 Ga0070658_10001686 3300005327 Bacteria 18655
26 Ga0070658_10005850 3300005327 Bacteria 9970
27 Ga0070658_10061342 3300005327 Bacteria 3063
28 Ga0070658_10249434 3300005327 Bacteria 1506
29 Ga0070658_10568577 3300005327 Bacteria 981
30 Ga0070676_10163105 3300005328 Bacteria 1436
31 Ga0070683_100065348 3300005329 Bacteria 3387
32 Ga0070683_100500741 3300005329 Bacteria 1160
33 Ga0070690_100000011 3300005330 Bacteria 95472
34 Ga0070670_100016491 3300005331 Bacteria 6343
35 Ga0070670_100032619 3300005331 Bacteria 4486
36 Ga0070670_101202986 3300005331 Bacteria 692
37 Ga0068869_101094469 3300005334 Bacteria 697
38 Ga0070666_10000035 3300005335 Bacteria 121458
39 Ga0070666_10000067 3300005335 Bacteria 76560
40 Ga0070666_10033802 3300005335 Bacteria 3386
41 Ga0070680_100050345 3300005336 Bacteria 3397
42 Ga0070680_100186823 3300005336 Bacteria 1746
43 Ga0070680_100574742 3300005336 Bacteria 967
44 Ga0070682_100102095 3300005337 Bacteria 1895
45 Ga0070682_100632998 3300005337 Bacteria 849
46 Ga0070660_100042448 3300005339 Bacteria 3471
47 Ga0070660_100051571 3300005339 Bacteria 3169
48 Ga0070660_100208849 3300005339 Bacteria 1584
49 Ga0070660_100251325 3300005339 Bacteria 1442
50 Ga0070689_100019644 3300005340 Bacteria 4997
51 Ga0070689_101381840 3300005340 Bacteria 636
52 Ga0070661_100001389 3300005344 Bacteria 16919
53 Ga0070692_10175896 3300005345 Bacteria 1237
54 Ga0070668_100039525 3300005347 Bacteria 3607
55 Ga0070668_100178090 3300005347 Bacteria 1735
56 Ga0070668_100360993 3300005347 Bacteria 1232
57 Ga0070669_100000029 3300005353 Bacteria 163005
58 Ga0070669_100000074 3300005353 Bacteria 99054
59 Ga0070669_100000131 3300005353 Bacteria 68114
60 Ga0070669_100000280 3300005353 Bacteria 40554
61 Ga0070669_100008611 3300005353 Bacteria 7280
62 Ga0070669_100291997 3300005353 Bacteria 1309
63 Ga0070669_100470863 3300005353 Bacteria 1038
64 Ga0070671_100000005 3300005355 Bacteria 256547
65 Ga0070671_100000016 3300005355 Bacteria 156166
66 Ga0070671_100000375 3300005355 Bacteria 30813
67 Ga0070671_100015960 3300005355 Bacteria 6068
68 Ga0070671_100291002 3300005355 Bacteria 1390
69 Ga0070671_100412615 3300005355 Bacteria 1156
70 Ga0070688_100001817 3300005365 Bacteria 10703
71 Ga0070659_100039475 3300005366 Bacteria 3685
72 Ga0070667_100000131 3300005367 Bacteria 94986
73 Ga0070667_100000513 3300005367 Bacteria 39042
74 Ga0070667_100001796 3300005367 Bacteria 19107
75 Ga0070667_100004694 3300005367 Bacteria 11465
76 Ga0070667_100086305 3300005367 Bacteria 2692
77 Ga0070667_100093007 3300005367 Bacteria 2596
78 Ga0070667_100145492 3300005367 Bacteria 2078
79 Ga0070705_101229347 3300005440 Bacteria 618
80 Ga0070708_100348132 3300005445 Bacteria 1396
81 Ga0070663_101619535 3300005455 Bacteria 577
82 Ga0070678_100126175 3300005456 Bacteria 2026
83 Ga0070662_100007379 3300005457 Bacteria 7124
84 Ga0070662_100011103 3300005457 Bacteria 5930
85 Ga0070662_100044182 3300005457 Bacteria 3190
86 Ga0070662_100107279 3300005457 Bacteria 2123
87 Ga0070681_10003398 3300005458 Bacteria 14901
88 Ga0070685_10007591 3300005466 Bacteria 5547
89 Ga0070685_10086499 3300005466 Bacteria 1890
90 Ga0070707_100124009 3300005468 Bacteria 2509
91 Ga0070707_100863848 3300005468 Bacteria 869
92 Ga0070679_100007479 3300005530 Bacteria 10213
93 Ga0070679_100120493 3300005530 Bacteria 2608
94 Ga0070679_100150339 3300005530 Bacteria 2305
95 Ga0070679_101651250 3300005530 Bacteria 588
96 Ga0070684_100203640 3300005535 Bacteria 1803
97 Ga0070684_100395541 3300005535 Bacteria 1274
98 Ga0068853_100040907 3300005539 Bacteria 3957
99 Ga0068853_100133003 3300005539 Bacteria 2228
100 Ga0068853_100462054 3300005539 Bacteria 1195
101 Ga0068853_100560360 3300005539 Bacteria 1083
102 Ga0068853_100843839 3300005539 Bacteria 878
103 Ga0070686_100000035 3300005544 Bacteria 108191
104 Ga0070686_100014214 3300005544 Bacteria 4583
105 Ga0070665_100000161 3300005548 Bacteria 122088
106 Ga0070665_100001089 3300005548 Bacteria 33704
107 Ga0070665_100005502 3300005548 Bacteria 13039
108 Ga0070665_100149673 3300005548 Bacteria 2337
109 Ga0070665_100635539 3300005548 Bacteria 1080
110 Ga0070665_100966929 3300005548 Bacteria 864
111 Ga0068855_100000644 3300005563 Bacteria 42733
112 Ga0068855_100005378 3300005563 Bacteria 15619
113 Ga0068855_100007675 3300005563 Bacteria 13033
114 Ga0068855_100069885 3300005563 Bacteria 4086
115 Ga0068855_100137624 3300005563 Bacteria 2785
116 Ga0068855_100273237 3300005563 Bacteria 1879
117 Ga0068855_101280560 3300005563 Bacteria 759
118 Ga0070664_100016187 3300005564 Bacteria 6111
119 Ga0070664_100063041 3300005564 Bacteria 3161
120 Ga0068857_100165210 3300005577 Bacteria 2010
121 Ga0068857_100207427 3300005577 Bacteria 1787
122 Ga0068857_100273739 3300005577 Bacteria 1552
123 Ga0068857_101374411 3300005577 Bacteria 686
124 Ga0068854_100014709 3300005578 Bacteria 5164
125 Ga0068854_100033054 3300005578 Bacteria 3604
126 Ga0068854_100053631 3300005578 Bacteria 2896
127 Ga0068854_100306023 3300005578 Bacteria 1287
128 Ga0068854_100909848 3300005578 Bacteria 774
129 Ga0068854_101665757 3300005578 Bacteria 582
130 Ga0068856_100011950 3300005614 Bacteria 8407
131 Ga0068856_100027069 3300005614 Bacteria 5594
132 Ga0068856_100253791 3300005614 Bacteria 1774
133 Ga0068856_101971128 3300005614 Bacteria 594
134 Ga0068852_100000174 3300005616 Bacteria 43394
135 Ga0068852_100050804 3300005616 Bacteria 3555
136 Ga0068852_100462850 3300005616 Bacteria 1257
137 Ga0068852_100464695 3300005616 Bacteria 1255
138 Ga0068852_100928346 3300005616 Bacteria 888
139 Ga0068859_100000110 3300005617 Bacteria 77515
140 Ga0068859_100039049 3300005617 Bacteria 4761
141 Ga0068864_100005229 3300005618 Bacteria 10639
142 Ga0068864_100014687 3300005618 Bacteria 6505
143 Ga0068864_100018960 3300005618 Bacteria 5752
144 Ga0068864_100163743 3300005618 Bacteria 2023
145 Ga0068864_100222879 3300005618 Bacteria 1740
146 Ga0068861_100008987 3300005719 Bacteria 6887
147 Ga0068861_100021448 3300005719 Bacteria 4642
148 Ga0068851_10183448 3300005834 Bacteria 1160
149 Ga0068863_100000060 3300005841 Bacteria 122123
150 Ga0068863_100000466 3300005841 Bacteria 41328
151 Ga0068863_100013913 3300005841 Bacteria 7758
152 Ga0068863_100019211 3300005841 Bacteria 6540
153 Ga0068863_100041563 3300005841 Bacteria 4372
154 Ga0068863_101380064 3300005841 Bacteria 712
155 Ga0068858_100002514 3300005842 Bacteria 18483
156 Ga0068858_100007941 3300005842 Bacteria 10226
157 Ga0068858_100009946 3300005842 Bacteria 9036
158 Ga0068858_100060889 3300005842 Bacteria 3489
159 Ga0068860_100000013 3300005843 Bacteria 323055
160 Ga0068860_100000126 3300005843 Bacteria 122923
161 Ga0068860_100000473 3300005843 Bacteria 49993
162 Ga0068860_100006579 3300005843 Bacteria 11669
163 Ga0068860_100023043 3300005843 Bacteria 6022
164 Ga0068860_100048221 3300005843 Bacteria 4059
165 Ga0068860_100776938 3300005843 Bacteria 970
166 Ga0068862_100000146 3300005844 Bacteria 80138
167 Ga0068862_100005381 3300005844 Bacteria 10712
168 Ga0068862_100013808 3300005844 Bacteria 6694
169 Ga0068862_100014001 3300005844 Bacteria 6651
170 Ga0068862_100078842 3300005844 Bacteria 2854
171 Ga0068862_100247202 3300005844 Bacteria 1624
172 Ga0068862_102018123 3300005844 Bacteria 587
173 Ga0075365_10001463 3300006038 Bacteria 10723
174 Ga0075368_10000287 3300006042 Bacteria 14467
175 Ga0075363_100000629 3300006048 Bacteria 11673
176 Ga0075363_100000904 3300006048 Bacteria 10461
177 Ga0075364_10002645 3300006051 Bacteria 10055
178 Ga0075364_10055359 3300006051 Bacteria 2595
179 Ga0075364_10151124 3300006051 Bacteria 1565
180 Ga0075364_10334942 3300006051 Bacteria 1031
181 Ga0075432_10000636 3300006058 Bacteria 10713
182 Ga0075362_10000043 3300006177 Bacteria 44587
183 Ga0075362_10001875 3300006177 Bacteria 6889
184 Ga0075362_10095994 3300006177 Bacteria 1381
185 Ga0075362_10157457 3300006177 Bacteria 1092
186 Ga0075367_10000871 3300006178 Bacteria 12080
187 Ga0075367_10255167 3300006178 Bacteria 1100
188 Ga0075367_10863251 3300006178 Bacteria 577
189 Ga0075366_10000830 3300006195 Bacteria 14848
190 Ga0075366_10079432 3300006195 Bacteria 1958
191 Ga0075366_10087476 3300006195 Bacteria 1865
192 Ga0075366_10628441 3300006195 Bacteria 666
193 Ga0075370_10000002 3300006353 Bacteria 142637
194 Ga0075370_10009387 3300006353 Bacteria 5077
195 Ga0075370_10017854 3300006353 Bacteria 3839
196 Ga0075370_10055104 3300006353 Bacteria 2259
197 Ga0075370_10056327 3300006353 Bacteria 2234
198 Ga0075370_10122011 3300006353 Bacteria 1518
199 Ga0075370_10542908 3300006353 Bacteria 703
200 Ga0097620_100000110 3300006931 Bacteria 77515
201 Ga0097620_100039048 3300006931 Bacteria 4761
202 Ga0079104_1031823 3300006946 Bacteria 1305
203 Ga0079104_1046047 3300006946 Bacteria 993
204 Ga0105251_10008372 3300009011 Bacteria 6235
205 Ga0105251_10079527 3300009011 Bacteria 1517
206 Ga0105251_10272905 3300009011 Bacteria 764
207 Ga0105250_10018579 3300009092 Bacteria 2815
208 Ga0105250_10151833 3300009092 Bacteria 964
209 Ga0105250_10171932 3300009092 Bacteria 907
210 Ga0105240_10002147 3300009093 Bacteria 32213
211 Ga0105240_10009965 3300009093 Bacteria 13394
212 Ga0105240_11485371 3300009093 Bacteria 711
213 Ga0111539_11919351 3300009094 Bacteria 687
214 Ga0105247_10010759 3300009101 Bacteria 5527
215 Ga0105247_10038204 3300009101 Bacteria 2930
216 Ga0105247_10487528 3300009101 Bacteria 896
217 Ga0114129_10465210 3300009147 Bacteria 1657
218 Ga0105243_10116855 3300009148 Bacteria 2241
219 Ga0105241_10545035 3300009174 Bacteria 1041
220 Ga0105248_10047334 3300009177 Bacteria 4822
221 Ga0105248_10070601 3300009177 Bacteria 3922
222 Ga0105248_10083705 3300009177 Bacteria 3588
223 Ga0105248_10160999 3300009177 Bacteria 2531
224 Ga0105248_10230722 3300009177 Bacteria 2084
225 Ga0105248_10340473 3300009177 Bacteria 1689
226 Ga0105248_10448293 3300009177 Bacteria 1454
227 Ga0105248_11072170 3300009177 Bacteria 910
228 Ga0105237_10884958 3300009545 Bacteria 900
229 Ga0105237_11315958 3300009545 Bacteria 729
230 Ga0105238_10593923 3300009551 Bacteria 1115
231 Ga0105238_10609350 3300009551 Bacteria 1100
232 Ga0105249_10000094 3300009553 Bacteria 122611
233 Ga0105249_10027171 3300009553 Bacteria 5162
234 Ga0105249_10098910 3300009553 Bacteria 2741
235 Ga0105249_10147326 3300009553 Bacteria 2263
236 Ga0105239_10204978 3300010375 Bacteria 2210
237 Ga0105246_10001552 3300011119 Bacteria 13642
238 Ga0157373_10006736 3300013100 Bacteria 8552
239 Ga0157373_10036270 3300013100 Bacteria 3540
240 Ga0157373_10141677 3300013100 Bacteria 1691
241 Ga0157373_10340324 3300013100 Bacteria 1069
242 Ga0157373_11082072 3300013100 Bacteria 601
243 Ga0157371_10000785 3300013102 Bacteria 36569
244 Ga0157371_10067925 3300013102 Bacteria 2523
245 Ga0157371_10348334 3300013102 Bacteria 1078
246 Ga0157370_10001694 3300013104 Bacteria 27128
247 Ga0157370_10677540 3300013104 Bacteria 942
248 Ga0157369_10012283 3300013105 Bacteria 9726
249 Ga0157369_10026111 3300013105 Bacteria 6480
250 Ga0157369_11635110 3300013105 Bacteria 655
251 Ga0163162_10020604 3300013306 Bacteria 6479
252 Ga0163162_10041921 3300013306 Bacteria 4580
253 Ga0163162_10066747 3300013306 Bacteria 3647
254 Ga0163162_10279919 3300013306 Bacteria 1800
255 Ga0163162_11761576 3300013306 Bacteria 708
256 Ga0157372_10029102 3300013307 Bacteria 6028
257 Ga0157372_10163734 3300013307 Bacteria 2571
258 Ga0157372_10705751 3300013307 Bacteria 1174
259 Ga0157372_11692251 3300013307 Bacteria 728
260 Ga0157375_10144108 3300013308 Bacteria 2512
261 Ga0157375_10179481 3300013308 Bacteria 2268
262 Ga0163163_10349797 3300014325 Bacteria 1534
263 Ga0157380_10007934 3300014326 Bacteria 7556
264 Ga0157380_10104608 3300014326 Bacteria 2365
265 Ga0157380_11425757 3300014326 Bacteria 744
266 Ga0157377_10024862 3300014745 Bacteria 3188
267 Ga0157379_10030612 3300014968 Bacteria 4792
268 Ga0157379_10089610 3300014968 Bacteria 2759
269 Ga0163161_10000195 3300017792 Bacteria 55605
270 Ga0163161_10075125 3300017792 Bacteria 2480
271 Ga0163161_10598175 3300017792 Bacteria 909
272 Ga0163161_10721008 3300017792 Bacteria 832
273 Ga0207672_1001676 3300025223 Bacteria 1569
274 Ga0209050_1000784 3300025298 Bacteria 45231
275 Ga0207697_10000295 3300025315 Bacteria 27867
276 Ga0207697_10115308 3300025315 Bacteria 1153
277 Ga0207697_10307810 3300025315 Bacteria 703
278 Ga0207656_10052395 3300025321 Bacteria 1767
279 Ga0207656_10408355 3300025321 Bacteria 683
280 Ga0207696_1001635 3300025711 Bacteria 11807
281 Ga0207713_1004070 3300025735 Bacteria 9645
282 Ga0207713_1044420 3300025735 Bacteria 1825
283 Ga0207710_10039577 3300025900 Bacteria 2087
284 Ga0207710_10294186 3300025900 Bacteria 819
285 Ga0207680_10000007 3300025903 Bacteria 623574
286 Ga0207680_10001445 3300025903 Bacteria 11267
287 Ga0207680_10038091 3300025903 Bacteria 2781
288 Ga0207680_10280858 3300025903 Bacteria 1157
289 Ga0207680_10420056 3300025903 Bacteria 947
290 Ga0207680_10502387 3300025903 Bacteria 864
291 Ga0207647_10000444 3300025904 Bacteria 33672
292 Ga0207647_10016274 3300025904 Bacteria 5077
293 Ga0207705_10000007 3300025909 Bacteria 597387
294 Ga0207705_10004092 3300025909 Bacteria 11063
295 Ga0207705_10010322 3300025909 Bacteria 6793
296 Ga0207705_10013576 3300025909 Bacteria 5880
297 Ga0207705_10024300 3300025909 Bacteria 4326
298 Ga0207654_10003992 3300025911 Bacteria 7431
299 Ga0207707_10042051 3300025912 Bacteria 3990
300 Ga0207707_11521785 3300025912 Bacteria 529
301 Ga0207695_10001471 3300025913 Bacteria 39463
302 Ga0207695_10126665 3300025913 Bacteria 2515
303 Ga0207695_10399106 3300025913 Bacteria 1260
304 Ga0207671_10000457 3300025914 Bacteria 56223
305 Ga0207671_10260172 3300025914 Bacteria 1366
306 Ga0207660_10089817 3300025917 Bacteria 2275
307 Ga0207660_10097427 3300025917 Bacteria 2191
308 Ga0207657_10000156 3300025919 Bacteria 69892
309 Ga0207657_10105319 3300025919 Bacteria 2335
310 Ga0207649_10049011 3300025920 Bacteria 2607
311 Ga0207649_10492548 3300025920 Bacteria 931
312 Ga0207652_10029192 3300025921 Bacteria 4608
313 Ga0207652_10043930 3300025921 Bacteria 3806
314 Ga0207652_10063665 3300025921 Bacteria 3190
315 Ga0207652_10232045 3300025921 Bacteria 1663
316 Ga0207652_10987242 3300025921 Bacteria 741
317 Ga0207652_11156991 3300025921 Bacteria 675
318 Ga0207646_10129915 3300025922 Bacteria 2267
319 Ga0207646_10731553 3300025922 Bacteria 884
320 Ga0207681_10000040 3300025923 Bacteria 147547
321 Ga0207681_10000053 3300025923 Bacteria 110626
322 Ga0207681_10000096 3300025923 Bacteria 74995
323 Ga0207681_10000120 3300025923 Bacteria 66235
324 Ga0207681_10002113 3300025923 Bacteria 12733
325 Ga0207681_10037734 3300025923 Bacteria 3196
326 Ga0207681_10409780 3300025923 Bacteria 1096
327 Ga0207694_10088716 3300025924 Bacteria 2438
328 Ga0207694_10274535 3300025924 Bacteria 1383
329 Ga0207694_10345887 3300025924 Bacteria 1230
330 Ga0207650_10007453 3300025925 Bacteria 7458
331 Ga0207650_10050238 3300025925 Bacteria 3083
332 Ga0207650_10120978 3300025925 Bacteria 2038
333 Ga0207650_10855037 3300025925 Bacteria 772
334 Ga0207644_10000008 3300025931 Bacteria 354219
335 Ga0207644_10000023 3300025931 Bacteria 156180
336 Ga0207644_10002058 3300025931 Bacteria 13020
337 Ga0207644_10015656 3300025931 Bacteria 5094
338 Ga0207644_10024648 3300025931 Bacteria 4131
339 Ga0207644_10381592 3300025931 Bacteria 1149
340 Ga0207690_10010558 3300025932 Bacteria 5495
341 Ga0207690_10041541 3300025932 Bacteria 3014
342 Ga0207690_10712426 3300025932 Bacteria 826
343 Ga0207690_10782312 3300025932 Bacteria 788
344 Ga0207706_10001803 3300025933 Bacteria 21030
345 Ga0207706_10012286 3300025933 Bacteria 7803
346 Ga0207706_10072887 3300025933 Bacteria 3020
347 Ga0207706_10978789 3300025933 Bacteria 712
348 Ga0207670_10011560 3300025936 Bacteria 5130
349 Ga0207711_10012882 3300025941 Bacteria 6947
350 Ga0207711_10124221 3300025941 Bacteria 2307
351 Ga0207711_10138634 3300025941 Bacteria 2187
352 Ga0207711_10155432 3300025941 Bacteria 2067
353 Ga0207711_10161377 3300025941 Bacteria 2029
354 Ga0207711_11159970 3300025941 Bacteria 714
355 Ga0207711_11398261 3300025941 Bacteria 642
356 Ga0207661_10025722 3300025944 Bacteria 4478
357 Ga0207661_10432261 3300025944 Bacteria 1197
358 Ga0207679_10050397 3300025945 Bacteria 3042
359 Ga0207679_10681731 3300025945 Bacteria 931
360 Ga0207667_10001801 3300025949 Bacteria 26994
361 Ga0207667_10002631 3300025949 Bacteria 22203
362 Ga0207667_10008785 3300025949 Bacteria 11963
363 Ga0207667_10056598 3300025949 Bacteria 4119
364 Ga0207667_10102292 3300025949 Bacteria 2956
365 Ga0207667_10191554 3300025949 Bacteria 2098
366 Ga0207667_10246079 3300025949 Bacteria 1830
367 Ga0207667_10352524 3300025949 Bacteria 1501
368 Ga0207667_10533107 3300025949 Bacteria 1189
369 Ga0207667_11140759 3300025949 Bacteria 761
370 Ga0207667_11406901 3300025949 Bacteria 671
371 Ga0207712_10000004 3300025961 Bacteria 614655
372 Ga0207712_10007583 3300025961 Bacteria 6856
373 Ga0207712_10156973 3300025961 Bacteria 1763
374 Ga0207668_10028040 3300025972 Bacteria 3676
375 Ga0207668_10053416 3300025972 Bacteria 2800
376 Ga0207668_10054318 3300025972 Bacteria 2780
377 Ga0207668_10058897 3300025972 Bacteria 2687
378 Ga0207668_10182480 3300025972 Bacteria 1657
379 Ga0207668_10906167 3300025972 Bacteria 785
380 Ga0207640_10002520 3300025981 Bacteria 9822
381 Ga0207640_10006942 3300025981 Bacteria 6229
382 Ga0207640_10035619 3300025981 Bacteria 3116
383 Ga0207640_10295914 3300025981 Bacteria 1278
384 Ga0207658_10000067 3300025986 Bacteria 116584
385 Ga0207658_10000288 3300025986 Bacteria 52709
386 Ga0207658_10001126 3300025986 Bacteria 21549
387 Ga0207658_10001427 3300025986 Bacteria 18634
388 Ga0207658_10003756 3300025986 Bacteria 10693
389 Ga0207658_10275454 3300025986 Bacteria 1440
390 Ga0207658_10658224 3300025986 Bacteria 944
391 Ga0207658_11224592 3300025986 Bacteria 686
392 Ga0207703_10001553 3300026035 Bacteria 20823
393 Ga0207703_10002077 3300026035 Bacteria 17605
394 Ga0207703_10003308 3300026035 Bacteria 13528
395 Ga0207703_10045631 3300026035 Bacteria 3526
396 Ga0207703_10077839 3300026035 Bacteria 2754
397 Ga0207639_10001184 3300026041 Bacteria 17717
398 Ga0207639_10200615 3300026041 Bacteria 1711
399 Ga0207639_10280397 3300026041 Bacteria 1465
400 Ga0207639_10442825 3300026041 Bacteria 1178
401 Ga0207639_10474822 3300026041 Bacteria 1139
402 Ga0207639_11268134 3300026041 Bacteria 692
403 Ga0207678_10007056 3300026067 Bacteria 9976
404 Ga0207678_10099517 3300026067 Bacteria 2484
405 Ga0207678_10143527 3300026067 Bacteria 2038
406 Ga0207678_10194657 3300026067 Bacteria 1733
407 Ga0207702_10011176 3300026078 Bacteria 7488
408 Ga0207702_10111922 3300026078 Bacteria 2429
409 Ga0207702_10235282 3300026078 Bacteria 1714
410 Ga0207702_10464183 3300026078 Bacteria 1230
411 Ga0207702_10894557 3300026078 Bacteria 880
412 Ga0207641_10000098 3300026088 Bacteria 123514
413 Ga0207641_10000100 3300026088 Bacteria 122664
414 Ga0207641_10007053 3300026088 Bacteria 9388
415 Ga0207641_10029943 3300026088 Bacteria 4503
416 Ga0207641_10083615 3300026088 Bacteria 2776
417 Ga0207676_10000888 3300026095 Bacteria 23213
418 Ga0207676_10004838 3300026095 Bacteria 9546
419 Ga0207676_10026680 3300026095 Bacteria 4297
420 Ga0207676_10141458 3300026095 Bacteria 2060
421 Ga0207676_10483568 3300026095 Bacteria 1173
422 Ga0207674_10009464 3300026116 Bacteria 11130
423 Ga0207674_10045876 3300026116 Bacteria 4492
424 Ga0207674_10049173 3300026116 Bacteria 4314
425 Ga0207674_10056465 3300026116 Bacteria 3987
426 Ga0207674_10135300 3300026116 Bacteria 2426
427 Ga0207674_11717693 3300026116 Bacteria 596
428 Ga0207675_100001359 3300026118 Bacteria 24514
429 Ga0207675_100002120 3300026118 Bacteria 19658
430 Ga0207683_10248083 3300026121 Bacteria 1624
431 Ga0207698_10000098 3300026142 Bacteria 55118
432 Ga0207698_10038950 3300026142 Bacteria 3517
433 Ga0207698_10054747 3300026142 Bacteria 3071
434 Ga0207698_10115306 3300026142 Bacteria 2262
435 Ga0207698_10397518 3300026142 Bacteria 1316
436 Ga0207698_11417413 3300026142 Bacteria 710
437 Ga0209983_1028317 3300027665 Bacteria 1188
438 Ga0209813_10000027 3300027866 Bacteria 69637
439 Ga0207428_10021045 3300027907 Bacteria 5528
440 Ga0268266_10000040 3300028379 Bacteria 323843
441 Ga0268266_10002543 3300028379 Bacteria 19369
442 Ga0268266_10008044 3300028379 Bacteria 9424
443 Ga0268266_10269197 3300028379 Bacteria 1581
444 Ga0268266_10300856 3300028379 Bacteria 1496
445 Ga0268266_10569806 3300028379 Bacteria 1086
446 Ga0268266_10583339 3300028379 Bacteria 1073
447 Ga0268265_10000098 3300028380 Bacteria 110108
448 Ga0268265_10000128 3300028380 Bacteria 96118
449 Ga0268265_10003510 3300028380 Bacteria 11222
450 Ga0268265_10005291 3300028380 Bacteria 8839
451 Ga0268265_10262033 3300028380 Bacteria 1537
452 Ga0268264_10000003 3300028381 Bacteria 1141976
453 Ga0268264_10000039 3300028381 Bacteria 376641
454 Ga0268264_10000141 3300028381 Bacteria 170966
455 Ga0268264_10000224 3300028381 Bacteria 110355
456 Ga0268264_10001883 3300028381 Bacteria 19050
457 Ga0268264_10004589 3300028381 Bacteria 11744
458 Ga0268264_10015428 3300028381 Bacteria 6265
459 Ga0268264_10036868 3300028381 Bacteria 4029
460 Ga0268264_10229401 3300028381 Bacteria 1714
461 Ga0265338_10408599 3300028800 Bacteria 967
462 Ga0316177_1166439 3300030731 Bacteria 2112
463 Ga0307408_100086591 3300031548 Bacteria 2355
464 Ga0307408_100205143 3300031548 Bacteria 1598
465 Ga0307408_100411890 3300031548 Bacteria 1163
466 Ga0307408_100733634 3300031548 Bacteria 891
467 Ga0307408_101257004 3300031548 Bacteria 692
468 Ga0307508_10071375 3300031616 Bacteria 3046
469 Ga0316579_10032772 3300031691 Bacteria 2384
470 Ga0307516_10248583 3300031730 Bacteria 1474
471 Ga0307405_10042472 3300031731 Bacteria 2768
472 Ga0307405_10272817 3300031731 Bacteria 1269
473 Ga0307405_10528624 3300031731 Bacteria 950
474 Ga0307405_10678243 3300031731 Bacteria 851
475 Ga0307405_10745876 3300031731 Bacteria 815
476 Ga0307405_10990585 3300031731 Bacteria 716
477 Ga0307405_11006616 3300031731 Bacteria 711
478 Ga0307413_10083154 3300031824 Bacteria 2059
479 Ga0307413_10192233 3300031824 Bacteria 1466
480 Ga0307413_10574760 3300031824 Bacteria 918
481 Ga0307413_11024435 3300031824 Bacteria 709
482 Ga0307413_11785523 3300031824 Bacteria 550
483 Ga0307410_10021352 3300031852 Bacteria 3981
484 Ga0307410_10057042 3300031852 Bacteria 2658
485 Ga0307410_10096543 3300031852 Bacteria 2110
486 Ga0307410_10224031 3300031852 Bacteria 1448
487 Ga0307410_10447841 3300031852 Bacteria 1053
488 Ga0307406_10232225 3300031901 Bacteria 1378
489 Ga0307406_10340071 3300031901 Bacteria 1168
490 Ga0307406_10530060 3300031901 Bacteria 960
491 Ga0307406_10847221 3300031901 Bacteria 775
492 Ga0307406_11477273 3300031901 Bacteria 598
493 Ga0307407_10801921 3300031903 Bacteria 716
494 Ga0307412_10000920 3300031911 Bacteria 16793
495 Ga0307412_10059169 3300031911 Bacteria 2566
496 Ga0307412_10083969 3300031911 Bacteria 2210
497 Ga0307412_10085215 3300031911 Bacteria 2195
498 Ga0307412_10092189 3300031911 Bacteria 2122
499 Ga0307412_10123237 3300031911 Bacteria 1870
500 Ga0307412_10194206 3300031911 Bacteria 1537
501 Ga0307412_10224887 3300031911 Bacteria 1441
502 Ga0307412_10311846 3300031911 Bacteria 1248
503 Ga0307412_10501556 3300031911 Bacteria 1010
504 Ga0307412_10877422 3300031911 Bacteria 784
505 Ga0307412_11098409 3300031911 Bacteria 708
506 Ga0307409_100313437 3300031995 Bacteria 1465
507 Ga0307409_101108572 3300031995 Bacteria 813
508 Ga0307416_100037322 3300032002 Bacteria 3737
509 Ga0307416_100072969 3300032002 Bacteria 2859
510 Ga0307416_100208837 3300032002 Bacteria 1860
511 Ga0307416_100374546 3300032002 Bacteria 1451
512 Ga0307416_101144883 3300032002 Bacteria 883
513 Ga0307414_10007116 3300032004 Bacteria 6278
514 Ga0307414_10020591 3300032004 Bacteria 4115
515 Ga0307414_10028547 3300032004 Bacteria 3621
516 Ga0307414_10130503 3300032004 Bacteria 1950
517 Ga0307414_10146234 3300032004 Bacteria 1857
518 Ga0307414_10178431 3300032004 Bacteria 1706
519 Ga0307414_10357598 3300032004 Bacteria 1255
520 Ga0307414_10718681 3300032004 Bacteria 906
521 Ga0307414_10792965 3300032004 Bacteria 863
522 Ga0307414_11104324 3300032004 Bacteria 732
523 Ga0307411_10074536 3300032005 Bacteria 2313
524 Ga0307411_10081800 3300032005 Bacteria 2225
525 Ga0307411_10217148 3300032005 Bacteria 1481
526 Ga0307411_10301996 3300032005 Bacteria 1284
527 Ga0307411_10564030 3300032005 Bacteria 973
528 Ga0307411_10687932 3300032005 Bacteria 889
529 Ga0307415_100061896 3300032126 Bacteria 2593
530 Ga0316583_10004401 3300032133 Bacteria 5023
531 Ga0316583_10219490 3300032133 Bacteria 659
532 Ga0373932_0096501 3300035112 Bacteria 956
533 Ga0373960_0078111 3300035121 Bacteria 1037
534 Ga0316582_0000131 3300036647 Bacteria 21779
535 Ga0316582_0114254 3300036647 Bacteria 1801
536 Ga0316584_0291270 3300036712 Bacteria 1184
537 Ga0451841_0878360 3300041498 Bacteria 1296
538 Ga0451853_0636233 3300041512 Bacteria 707
539 Ga0439431_0086077 3300041997 Bacteria 852
540 Ga0439462_0012070 3300042015 Bacteria 2204
541 Ga0439435_0031583 3300042436 Bacteria 1441
542 Ga0453684_0267103 3300044712 Bacteria 1957
543 Ga0451576_0000017 3300045051 Bacteria 558261
544 Ga0495638_0082949 3300046460 Bacteria 1943
545 Ga0495638_0217303 3300046460 Bacteria 1070
546 Ga0495650_0075932 3300046471 Bacteria 1307
547 Ga0495606_0196315 3300046507 Bacteria 1153
548 Ga0495610_0012788 3300046512 Bacteria 5023
549 Ga0495610_0305485 3300046512 Bacteria 612
550 Ga0495616_0000153 3300046513 Bacteria 60398
551 Ga0495632_0285947 3300046519 Bacteria 733
552 Ga0495643_0010451 3300046522 Bacteria 5713
553 Ga0495643_0097153 3300046522 Bacteria 1514
554 Ga0495644_0155054 3300046523 Bacteria 877
555 Ga0495648_0085235 3300046524 Bacteria 1785
556 Ga0495654_0073172 3300046530 Bacteria 1621
557 Ga0495668_0125585 3300046616 Bacteria 1404
558 Ga0495668_0147719 3300046616 Bacteria 1287
559 Ga0495625_0216745 3300046660 Bacteria 1256
560 Ga0495687_063236 3300047443 Bacteria 1516
561 Ga0495615_0000103 3300048090 Bacteria 23149
562 Ga0495626_0001180 3300048091 Bacteria 21706
563 Ga0496100_0018122 3300048903 Bacteria 4171
564 Ga0496100_0199152 3300048903 Bacteria 1458
565 Ga0496101_0072682 3300048904 Bacteria 2525
566 Ga0496101_0103428 3300048904 Bacteria 2134
567 Ga0496101_0107562 3300048904 Bacteria 2095
568 Ga0496102_0000209 3300048905 Bacteria 78525
569 Ga0496102_0003512 3300048905 Bacteria 13282
570 Ga0496102_0055768 3300048905 Bacteria 3603
571 Ga0496102_0315077 3300048905 Bacteria 1474
572 Ga0496103_0000136 3300048906 Bacteria 76530
573 Ga0496103_0000372 3300048906 Bacteria 40272
574 Ga0496103_0002395 3300048906 Bacteria 11807
575 Ga0496103_0016230 3300048906 Bacteria 4444
576 Ga0496103_0045736 3300048906 Bacteria 2701
577 Ga0496103_0459819 3300048906 Bacteria 816
578 Ga0496104_0142986 3300048907 Bacteria 2298
579 Ga0496104_0229837 3300048907 Bacteria 1767
580 Ga0496105_0006268 3300048908 Bacteria 9135
581 Ga0496105_0009539 3300048908 Bacteria 7596
582 Ga0496105_0040280 3300048908 Bacteria 3851
583 Ga0496105_0203153 3300048908 Bacteria 1617
584 Ga0496105_0302663 3300048908 Bacteria 1285
585 Ga0496105_0319403 3300048908 Bacteria 1245
586 Ga0496105_0426175 3300048908 Bacteria 1050
587 Ga0496106_0004392 3300048909 Bacteria 10469
588 Ga0496106_0270315 3300048909 Bacteria 1361
589 Ga0496107_0005831 3300048910 Bacteria 8432
590 Ga0496107_0483281 3300048910 Bacteria 919
591 Ga0496108_0268966 3300048911 Bacteria 1483
592 Ga0496109_0518126 3300048912 Bacteria 1125
593 Ga0496110_0108760 3300048913 Bacteria 2489
594 Ga0496112_0507864 3300048915 Bacteria 1140
595 Ga0496113_0001214 3300048916 Bacteria 14127
596 Ga0496113_0170703 3300048916 Bacteria 1722
597 Ga0496114_0073823 3300048917 Bacteria 2871
598 Ga0496115_0073073 3300048918 Bacteria 2783
599 Ga0496116_0000149 3300048919 Bacteria 141841
600 Ga0496116_0006619 3300048919 Bacteria 10476
601 Ga0496116_0008522 3300048919 Bacteria 8884
602 Ga0496116_0020693 3300048919 Bacteria 4988
603 Ga0496117_0000526 3300048920 Bacteria 63085
604 Ga0496117_0002288 3300048920 Bacteria 24709
605 Ga0496117_0010660 3300048920 Bacteria 8331
606 Ga0496117_0089427 3300048920 Bacteria 1989
607 Ga0496118_0000097 3300048921 Bacteria 160837
608 Ga0496118_0003002 3300048921 Bacteria 21794
609 Ga0496118_0014990 3300048921 Bacteria 7210
610 Ga0496118_0023491 3300048921 Bacteria 5352
611 Ga0496118_0040884 3300048921 Bacteria 3679
612 Ga0496119_0015446 3300048922 Bacteria 5876
613 Ga0496119_0023742 3300048922 Bacteria 4337
614 Ga0496119_0026561 3300048922 Bacteria 4011
615 Ga0496120_0054075 3300048923 Bacteria 2278
616 Ga0496120_0062436 3300048923 Bacteria 2076
617 Ga0496120_0096447 3300048923 Bacteria 1570
618 Ga0496121_0000024 3300048924 Bacteria 462959
619 Ga0496121_0001586 3300048924 Bacteria 37825
620 Ga0496121_0002667 3300048924 Bacteria 26743
621 Ga0496121_0059551 3300048924 Bacteria 3147
622 Ga0496122_0016758 3300048925 Bacteria 6904
623 Ga0496122_0026317 3300048925 Bacteria 5019
624 Ga0496123_0002495 3300048926 Bacteria 22695
625 Ga0496123_0003182 3300048926 Bacteria 18742
626 Ga0496124_0001077 3300048927 Bacteria 43137
627 Ga0496124_0005279 3300048927 Bacteria 14616
628 Ga0496124_0006606 3300048927 Bacteria 12593
629 Ga0496124_0025322 3300048927 Bacteria 5375
630 Ga0496124_0322015 3300048927 Bacteria 1106
631 Ga0496124_0368197 3300048927 Bacteria 1010
632 Ga0496124_0779675 3300048927 Bacteria 595
633 Ga0496125_0028760 3300048928 Bacteria 5010
634 Ga0496125_0058857 3300048928 Bacteria 3100
635 Ga0496126_0000261 3300048929 Bacteria 112027
636 Ga0496126_0000365 3300048929 Bacteria 93461
637 Ga0496126_0048856 3300048929 Bacteria 3864
638 Ga0501292_000039 3300049515 Bacteria 31662
639 Ga0501294_001148 3300049517 Bacteria 2755
640 Ga0501300_002365 3300049523 Bacteria 2814
641 Ga0501300_012336 3300049523 Bacteria 1246
642 Ga0501031_0183698 3300049568 Bacteria 1366
643 Ga0501032_0031710 3300049569 Bacteria 3623
644 Ga0501033_0793166 3300049570 Bacteria 641
645 Ga0501034_0087683 3300049571 Bacteria 3111
646 Ga0501034_0451467 3300049571 Bacteria 1203
647 Ga0501034_0679696 3300049571 Bacteria 929
648 Ga0501034_0808514 3300049571 Bacteria 830
649 Ga0501036_0982269 3300049572 Bacteria 691
650 Ga0501037_0260032 3300049573 Bacteria 1213
651 Ga0501037_0507351 3300049573 Bacteria 818
652 Ga0501038_0022535 3300049574 Bacteria 5642
653 Ga0501039_0331637 3300049575 Bacteria 1196
654 Ga0501043_0028272 3300049579 Bacteria 4401
655 Ga0501047_0004437 3300049581 Bacteria 13214
656 Ga0501047_0085015 3300049581 Bacteria 3040
657 Ga0501047_0478095 3300049581 Bacteria 1074
658 Ga0501048_0561443 3300049582 Bacteria 819
659 Ga0501071_0629883 3300049587 Bacteria 825
660 Ga0501073_0246433 3300049589 Bacteria 1234
661 Ga0501073_0337364 3300049589 Bacteria 1041
662 Ga0501222_032414 3300049662 Bacteria 721
663 Ga0501223_000706 3300049663 Bacteria 7954
664 Ga0501223_001199 3300049663 Bacteria 6075
665 Ga0501224_000027 3300049664 Bacteria 53610
666 Ga0501224_006232 3300049664 Bacteria 1727
667 Ga0501224_031630 3300049664 Bacteria 793
668 Ga0501227_003259 3300049665 Bacteria 3521
669 Ga0501233_005314 3300049668 Bacteria 2390
670 Ga0501233_025828 3300049668 Bacteria 1294
671 Ga0501235_014042 3300049669 Bacteria 1765
672 Ga0501249_033623 3300049679 Bacteria 1149
673 Ga0501257_000023 3300049686 Bacteria 44305
674 Ga0501257_068078 3300049686 Bacteria 906
675 Ga0501259_001451 3300049688 Bacteria 3944
676 Ga0501261_000013 3300049690 Bacteria 45622
677 Ga0501221_016231 3300049704 Bacteria 1407
678 Ga0501225_0000057 3300049705 Bacteria 37809
679 Ga0501225_0002810 3300049705 Bacteria 5350
680 Ga0501234_021749 3300049707 Bacteria 1022
681 Ga0501276_007674 3300049773 Bacteria 866
682 Ga0501279_000017 3300049775 Bacteria 62448
683 Ga0501280_000015 3300049776 Bacteria 55614
684 Ga0501280_003212 3300049776 Bacteria 2547
685 Ga0501281_00041 3300049777 Bacteria 14782
686 Ga0501282_000300 3300049778 Bacteria 5971
687 Ga0501283_002495 3300049779 Bacteria 2392
688 Ga0501035_0384132 3300049822 Bacteria 1171
689 Ga0501044_0024420 3300049823 Bacteria 6416
690 Ga0501044_0075851 3300049823 Bacteria 3414
691 Ga0501044_0081514 3300049823 Bacteria 3275
692 Ga0501044_0390785 3300049823 Bacteria 1305
693 Ga0501226_000068 3300049853 Bacteria 32699
694 nmdc:mga03683_10563_c1 3300050489 Bacteria 3314
695 nmdc:mga03683_138761_c1 3300050489 Bacteria 1092
696 nmdc:mga03683_164_c1 3300050489 Bacteria 22386
697 nmdc:mga03683_264973_c1 3300050489 Bacteria 800
698 nmdc:mga03683_3_c1 3300050489 Bacteria 285872
699 nmdc:mga03n38_243_c1 3300050490 Bacteria 12887
700 nmdc:mga00v17_145892_c1 3300050491 Bacteria 1519
701 nmdc:mga00v17_357_c1 3300050491 Bacteria 25838
702 nmdc:mga00v17_611975_c1 3300050491 Bacteria 702
703 nmdc:mga00v17_671904_c1 3300050491 Bacteria 665
704 nmdc:mga00v17_79048_c1 3300050491 Bacteria 2051
705 nmdc:mga0yw44_107595_c1 3300050492 Bacteria 1784
706 nmdc:mga0k408_2_c1 3300050493 Bacteria 395671
707 nmdc:mga0k408_45592_c1 3300050493 Bacteria 2530
708 nmdc:mga0k408_653273_c1 3300050493 Bacteria 618
709 nmdc:mga0k408_9510_c1 3300050493 Bacteria 5243
710 nmdc:mga06z11_140_c1 3300050494 Bacteria 28632
711 nmdc:mga04h51_48_c1 3300050495 Bacteria 38959
712 nmdc:mga07m45_118275_c1 3300050496 Bacteria 1530
713 nmdc:mga07m45_18528_c1 3300050496 Bacteria 3760
714 nmdc:mga07m45_1_c1 3300050496 Bacteria 485809
715 nmdc:mga07m45_256_c1 3300050496 Bacteria 2699
716 nmdc:mga07m45_5276_c1 3300050496 Bacteria 6424
717 nmdc:mga07m45_560937_c1 3300050496 Bacteria 660
718 nmdc:mga07m45_9_c1 3300050496 Bacteria 171776
719 nmdc:mga05p37_940997_c1 3300050507 Bacteria 926
720 nmdc:mga08y16_1471492_c1 3300050511 Bacteria 642
721 nmdc:mga08x19_303034_c1 3300050514 Bacteria 1110
722 nmdc:mga0sz30_7685_c1 3300050516 Bacteria 984
723 nmdc:mga0sz30_8482_c1 3300050516 Bacteria 3883
724 Ga0500643_000005 3300053087 Bacteria 539775
725 Ga0500643_000839 3300053087 Bacteria 19704
726 Ga0500643_102818 3300053087 Bacteria 774
727 Ga0500555_139243 3300053103 Bacteria 598
728 Ga0500562_028676 3300053108 Bacteria 1464
729 Ga0500592_035320 3300053116 Bacteria 807
730 Ga0500593_137528 3300053117 Bacteria 966
731 Ga0500595_146246 3300053119 Bacteria 661
732 Ga0500607_000473 3300053121 Bacteria 38991
733 Ga0500607_002009 3300053121 Bacteria 17189
734 Ga0500608_000334 3300053122 Bacteria 18157
735 Ga0500618_002917 3300053125 Bacteria 6123
736 Ga0500618_046270 3300053125 Bacteria 991
737 Ga0500559_0002117 3300053136 Bacteria 10564
738 Ga0500559_0002682 3300053136 Bacteria 9055
739 Ga0500559_0095695 3300053136 Bacteria 1363
740 Ga0500564_060211 3300053138 Bacteria 1723
741 Ga0500568_0105685 3300053139 Bacteria 1055
742 Ga0500588_0077957 3300053146 Bacteria 1102
743 Ga0500590_000767 3300053148 Bacteria 11844
744 Ga0500590_009605 3300053148 Bacteria 4868
745 Ga0500604_0038152 3300053151 Bacteria 1440
746 Ga0500604_0041115 3300053151 Bacteria 1397
747 Ga0500604_0078006 3300053151 Bacteria 1066
748 Ga0500616_0001003 3300053153 Bacteria 30395
749 Ga0500622_0006555 3300053156 Bacteria 6722
750 Ga0500622_0122029 3300053156 Bacteria 1263
751 Ga0500627_0017326 3300053158 Bacteria 2828
752 Ga0500636_0071420 3300053177 Bacteria 2013
753 Ga0500637_0001962 3300053178 Bacteria 8939
754 Ga0500567_000030 3300053723 Bacteria 30021
755 Ga0500625_000027 3300053729 Bacteria 56422
756 Ga0500645_002625 3300053730 Bacteria 7871

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031901 Ga0307406_10232225 Ga0307406_102322252 140
2 3300031852 Ga0307410_10057042 Ga0307410_100570423 141
3 3300031901 Ga0307406_10530060 Ga0307406_105300602 141
4 3300032005 Ga0307411_10687932 Ga0307411_106879322 141
5 3300036647 Ga0316582_0114254 Ga0316582_0114254_729_1232 141
6 3300041512 Ga0451853_0636233 Ga0451853_0636233_84_569 141
7 3300049679 Ga0501249_033623 Ga0501249_033623_668_1093 141
8 3300028800 Ga0265338_10408599 Ga0265338_104085991 143
9 3300048090 Ga0495615_0000103 Ga0495615_0000103_20036_20506 143
10 3300048925 Ga0496122_0016758 Ga0496122_0016758_3810_4280 143
11 3300048926 Ga0496123_0003182 Ga0496123_0003182_14530_15000 143
12 3300048927 Ga0496124_0322015 Ga0496124_0322015_185_655 143
13 3300005336 Ga0070680_100574742 Ga0070680_1005747422 144
14 3300005339 Ga0070660_100251325 Ga0070660_1002513252 144
15 3300005535 Ga0070684_100395541 Ga0070684_1003955412 144
16 3300005539 Ga0068853_100133003 Ga0068853_1001330034 144
17 3300005563 Ga0068855_100000644 Ga0068855_10000064427 144
18 3300005616 Ga0068852_100928346 Ga0068852_1009283462 144
19 3300009093 Ga0105240_10009965 Ga0105240_1000996512 144
20 3300009551 Ga0105238_10593923 Ga0105238_105939232 144
21 3300013100 Ga0157373_11082072 Ga0157373_110820721 144
22 3300013105 Ga0157369_11635110 Ga0157369_116351102 144
23 3300013307 Ga0157372_11692251 Ga0157372_116922511 144
24 3300025912 Ga0207707_11521785 Ga0207707_115217851 144
25 3300025913 Ga0207695_10126665 Ga0207695_101266652 144
26 3300025917 Ga0207660_10089817 Ga0207660_100898172 144
27 3300025924 Ga0207694_10088716 Ga0207694_100887164 144
28 3300025933 Ga0207706_10978789 Ga0207706_109787892 144
29 3300025949 Ga0207667_10001801 Ga0207667_1000180115 144
30 3300026041 Ga0207639_10442825 Ga0207639_104428252 144
31 3300026142 Ga0207698_10115306 Ga0207698_101153061 144
32 3300045051 Ga0451576_0000017 Ga0451576_0000017_125413_125856 144
33 3300049589 Ga0501073_0337364 Ga0501073_0337364_331_768 144
34 3300046523 Ga0495644_0155054 Ga0495644_0155054_421_867 145
35 3300049573 Ga0501037_0507351 Ga0501037_0507351_133_624 145
36 2162886007 SwRhRL2b_contig_3705888 SwRhRL2b_0781.00003740 146
37 3300005289 Ga0065704_10000553 Ga0065704_100005532 146
38 3300005614 Ga0068856_100253791 Ga0068856_1002537912 146
39 3300005616 Ga0068852_100050804 Ga0068852_1000508042 146
40 3300026078 Ga0207702_10111922 Ga0207702_101119222 146
41 3300026116 Ga0207674_11717693 Ga0207674_117176932 146
42 3300031901 Ga0307406_10847221 Ga0307406_108472212 146
43 3300031911 Ga0307412_11098409 Ga0307412_110984092 146
44 3300031731 Ga0307405_10678243 Ga0307405_106782432 147
45 3300036712 Ga0316584_0291270 Ga0316584_0291270_126_629 147
46 3300050489 nmdc:mga03683_264973_c1 nmdc:mga03683_264973_c1_63_557 147
47 3300046616 Ga0495668_0147719 Ga0495668_0147719_162_650 148
48 3300046660 Ga0495625_0216745 Ga0495625_0216745_730_1218 148
49 3300053119 Ga0500595_146246 Ga0500595_146246_85_573 148
50 3300053156 Ga0500622_0006555 Ga0500622_0006555_3740_4228 148
51 iso_pu_bacteria 2512564014 2512642547 148
52 3300005295 Ga0065707_10253023 Ga0065707_102530232 149
53 3300031548 Ga0307408_100733634 Ga0307408_1007336341 149
54 3300031911 Ga0307412_10123237 Ga0307412_101232373 149
55 3300048905 Ga0496102_0003512 Ga0496102_0003512_8795_9247 149
56 3300048906 Ga0496103_0000372 Ga0496103_0000372_1301_1753 149
57 3300048919 Ga0496116_0006619 Ga0496116_0006619_8758_9210 149
58 3300048920 Ga0496117_0002288 Ga0496117_0002288_4199_4651 149
59 3300048921 Ga0496118_0000097 Ga0496118_0000097_121884_122336 149
60 3300048922 Ga0496119_0026561 Ga0496119_0026561_2398_2850 149
61 3300048923 Ga0496120_0054075 Ga0496120_0054075_1299_1751 149
62 3300048927 Ga0496124_0001077 Ga0496124_0001077_38487_38939 149
63 3300049523 Ga0501300_012336 Ga0501300_012336_380_832 149
64 3300049686 Ga0501257_000023 Ga0501257_000023_2673_3125 149
65 3300049776 Ga0501280_003212 Ga0501280_003212_1028_1480 149
66 3300053087 Ga0500643_000839 Ga0500643_000839_18041_18493 149
67 3300031824 Ga0307413_11024435 Ga0307413_110244351 150
68 3300049515 Ga0501292_000039 Ga0501292_000039_3985_4440 150
69 3300049517 Ga0501294_001148 Ga0501294_001148_1608_2063 150
70 3300049523 Ga0501300_002365 Ga0501300_002365_1386_1841 150
71 3300049662 Ga0501222_032414 Ga0501222_032414_198_653 150
72 3300049663 Ga0501223_001199 Ga0501223_001199_3746_4201 150
73 3300049664 Ga0501224_006232 Ga0501224_006232_730_1185 150
74 3300049665 Ga0501227_003259 Ga0501227_003259_2341_2796 150
75 3300049668 Ga0501233_005314 Ga0501233_005314_1430_1885 150
76 3300049669 Ga0501235_014042 Ga0501235_014042_552_1007 150
77 3300049686 Ga0501257_068078 Ga0501257_068078_133_588 150
78 3300049688 Ga0501259_001451 Ga0501259_001451_2293_2748 150
79 3300049690 Ga0501261_000013 Ga0501261_000013_41270_41725 150
80 3300049704 Ga0501221_016231 Ga0501221_016231_487_942 150
81 3300049705 Ga0501225_0002810 Ga0501225_0002810_2594_3049 150
82 3300049773 Ga0501276_007674 Ga0501276_007674_171_626 150
83 3300049775 Ga0501279_000017 Ga0501279_000017_57919_58374 150
84 3300049776 Ga0501280_000015 Ga0501280_000015_764_1219 150
85 3300049777 Ga0501281_00041 Ga0501281_00041_11646_12101 150
86 3300049778 Ga0501282_000300 Ga0501282_000300_1191_1646 150
87 3300049779 Ga0501283_002495 Ga0501283_002495_681_1136 150
88 3300026041 Ga0207639_11268134 Ga0207639_112681341 151
89 3300031548 Ga0307408_100086591 Ga0307408_1000865912 151
90 3300031731 Ga0307405_10990585 Ga0307405_109905852 151
91 3300032002 Ga0307416_100037322 Ga0307416_1000373223 151
92 3300005367 Ga0070667_100000131 Ga0070667_10000013110 152
93 3300005841 Ga0068863_100041563 Ga0068863_1000415632 152
94 3300005843 Ga0068860_100000013 Ga0068860_100000013111 152
95 3300025903 Ga0207680_10280858 Ga0207680_102808581 152
96 3300025986 Ga0207658_10000067 Ga0207658_100000679 152
97 3300026088 Ga0207641_10007053 Ga0207641_100070536 152
98 3300028381 Ga0268264_10000039 Ga0268264_10000039112 152
99 3300031548 Ga0307408_100411890 Ga0307408_1004118902 152
100 3300031731 Ga0307405_10042472 Ga0307405_100424723 152
101 3300031911 Ga0307412_10059169 Ga0307412_100591692 152
102 3300032002 Ga0307416_100374546 Ga0307416_1003745463 152
103 3300046522 Ga0495643_0010451 Ga0495643_0010451_3837_4349 152
104 3300046524 Ga0495648_0085235 Ga0495648_0085235_1169_1642 152
105 3300053151 Ga0500604_0038152 Ga0500604_0038152_883_1344 152
106 iso_pu_bacteria 2738541275 2738710573 152
107 iso_pu_bacteria 2738541301 2738848998 152
108 iso_pu_bacteria 2738541304 2738864727 152
109 iso_pu_bacteria 2738543022 2739297245 152
110 iso_pu_bacteria 2738543033 2739358923 152
111 iso_pu_bacteria 2739367664 2739651017 152
112 iso_pu_bacteria 2739367865 2740029490 152
113 iso_pu_bacteria 2818991438 2819551004 152
114 iso_pu_bacteria 2928100450 2928100672 152
115 iso_pu_bacteria 2928959182 2928960735 152
116 3300005289 Ga0065704_10358848 Ga0065704_103588481 153
117 3300001976 JGI24752J21851_1002192 JGI24752J21851_10021924 154
118 3300002070 JGI24750J21931_1036357 JGI24750J21931_10363572 154
119 3300005331 Ga0070670_100016491 Ga0070670_1000164912 154
120 3300005331 Ga0070670_100032619 Ga0070670_1000326194 154
121 3300005335 Ga0070666_10000067 Ga0070666_1000006720 154
122 3300005340 Ga0070689_101381840 Ga0070689_1013818401 154
123 3300005353 Ga0070669_100000029 Ga0070669_10000002955 154
124 3300005353 Ga0070669_100008611 Ga0070669_1000086113 154
125 3300005353 Ga0070669_100291997 Ga0070669_1002919972 154
126 3300005355 Ga0070671_100000016 Ga0070671_100000016101 154
127 3300005367 Ga0070667_100145492 Ga0070667_1001454922 154
128 3300005445 Ga0070708_100348132 Ga0070708_1003481323 154
129 3300005548 Ga0070665_100149673 Ga0070665_1001496732 154
130 3300005578 Ga0068854_100033054 Ga0068854_1000330543 154
131 3300005617 Ga0068859_100000110 Ga0068859_10000011024 154
132 3300005618 Ga0068864_100005229 Ga0068864_1000052295 154
133 3300005719 Ga0068861_100021448 Ga0068861_1000214481 154
134 3300005841 Ga0068863_100019211 Ga0068863_1000192112 154
135 3300005842 Ga0068858_100007941 Ga0068858_1000079419 154
136 3300005844 Ga0068862_100014001 Ga0068862_1000140015 154
137 3300006931 Ga0097620_100000110 Ga0097620_10000011024 154
138 3300009011 Ga0105251_10008372 Ga0105251_100083727 154
139 3300009101 Ga0105247_10010759 Ga0105247_100107597 154
140 3300009101 Ga0105247_10038204 Ga0105247_100382043 154
141 3300009177 Ga0105248_10083705 Ga0105248_100837053 154
142 3300009553 Ga0105249_10027171 Ga0105249_100271712 154
143 3300013306 Ga0163162_10066747 Ga0163162_100667472 154
144 3300014968 Ga0157379_10089610 Ga0157379_100896102 154
145 3300017792 Ga0163161_10598175 Ga0163161_105981752 154
146 3300025315 Ga0207697_10000295 Ga0207697_100002956 154
147 3300025735 Ga0207713_1044420 Ga0207713_10444202 154
148 3300025900 Ga0207710_10039577 Ga0207710_100395772 154
149 3300025903 Ga0207680_10001445 Ga0207680_100014455 154
150 3300025923 Ga0207681_10000040 Ga0207681_1000004055 154
151 3300025923 Ga0207681_10002113 Ga0207681_100021138 154
152 3300025923 Ga0207681_10037734 Ga0207681_100377344 154
153 3300025925 Ga0207650_10007453 Ga0207650_100074532 154
154 3300025925 Ga0207650_10120978 Ga0207650_101209782 154
155 3300025931 Ga0207644_10000023 Ga0207644_10000023102 154
156 3300025941 Ga0207711_10161377 Ga0207711_101613773 154
157 3300025972 Ga0207668_10058897 Ga0207668_100588972 154
158 3300025981 Ga0207640_10006942 Ga0207640_100069422 154
159 3300025986 Ga0207658_10658224 Ga0207658_106582241 154
160 3300026035 Ga0207703_10001553 Ga0207703_1000155314 154
161 3300026035 Ga0207703_10045631 Ga0207703_100456315 154
162 3300026088 Ga0207641_10029943 Ga0207641_100299431 154
163 3300026095 Ga0207676_10000888 Ga0207676_100008882 154
164 3300026118 Ga0207675_100001359 Ga0207675_1000013595 154
165 3300028379 Ga0268266_10300856 Ga0268266_103008562 154
166 3300028380 Ga0268265_10000098 Ga0268265_1000009887 154
167 3300028381 Ga0268264_10000141 Ga0268264_10000141126 154
168 3300028381 Ga0268264_10001883 Ga0268264_1000188310 154
169 3300031616 Ga0307508_10071375 Ga0307508_100713754 154
170 3300031730 Ga0307516_10248583 Ga0307516_102485832 154
171 iso_pu_bacteria 2643221588 2643951142 154
172 3300001904 JGI24736J21556_1000162 JGI24736J21556_10001622 155
173 3300001976 JGI24752J21851_1000138 JGI24752J21851_10001382 155
174 3300001979 JGI24740J21852_10045219 JGI24740J21852_100452193 155
175 3300001989 JGI24739J22299_10008859 JGI24739J22299_100088592 155
176 3300001990 JGI24737J22298_10030127 JGI24737J22298_100301272 155
177 3300002070 JGI24750J21931_1000338 JGI24750J21931_10003385 155
178 3300002074 JGI24748J21848_1000033 JGI24748J21848_100003341 155
179 3300002075 JGI24738J21930_10024920 JGI24738J21930_100249202 155
180 3300002076 JGI24749J21850_1002743 JGI24749J21850_10027432 155
181 3300002239 JGI24034J26672_10000032 JGI24034J26672_1000003252 155
182 3300005327 Ga0070658_10568577 Ga0070658_105685772 155
183 3300005329 Ga0070683_100500741 Ga0070683_1005007412 155
184 3300005330 Ga0070690_100000011 Ga0070690_10000001116 155
185 3300005331 Ga0070670_101202986 Ga0070670_1012029862 155
186 3300005334 Ga0068869_101094469 Ga0068869_1010944691 155
187 3300005335 Ga0070666_10000035 Ga0070666_1000003540 155
188 3300005337 Ga0070682_100102095 Ga0070682_1001020953 155
189 3300005339 Ga0070660_100208849 Ga0070660_1002088494 155
190 3300005340 Ga0070689_100019644 Ga0070689_1000196442 155
191 3300005347 Ga0070668_100039525 Ga0070668_1000395254 155
192 3300005347 Ga0070668_100178090 Ga0070668_1001780902 155
193 3300005353 Ga0070669_100000074 Ga0070669_10000007446 155
194 3300005353 Ga0070669_100000131 Ga0070669_10000013129 155
195 3300005355 Ga0070671_100000375 Ga0070671_10000037514 155
196 3300005355 Ga0070671_100015960 Ga0070671_1000159607 155
197 3300005365 Ga0070688_100001817 Ga0070688_10000181712 155
198 3300005367 Ga0070667_100001796 Ga0070667_10000179612 155
199 3300005367 Ga0070667_100086305 Ga0070667_1000863054 155
200 3300005440 Ga0070705_101229347 Ga0070705_1012293471 155
201 3300005457 Ga0070662_100044182 Ga0070662_1000441826 155
202 3300005466 Ga0070685_10007591 Ga0070685_100075917 155
203 3300005468 Ga0070707_100863848 Ga0070707_1008638482 155
204 3300005544 Ga0070686_100000035 Ga0070686_10000003575 155
205 3300005548 Ga0070665_100000161 Ga0070665_10000016188 155
206 3300005548 Ga0070665_100001089 Ga0070665_10000108914 155
207 3300005577 Ga0068857_100207427 Ga0068857_1002074272 155
208 3300005578 Ga0068854_100306023 Ga0068854_1003060232 155
209 3300005578 Ga0068854_101665757 Ga0068854_1016657571 155
210 3300005614 Ga0068856_101971128 Ga0068856_1019711281 155
211 3300005616 Ga0068852_100462850 Ga0068852_1004628502 155
212 3300005617 Ga0068859_100039049 Ga0068859_1000390495 155
213 3300005618 Ga0068864_100014687 Ga0068864_1000146878 155
214 3300005719 Ga0068861_100008987 Ga0068861_1000089876 155
215 3300005841 Ga0068863_100000060 Ga0068863_10000006087 155
216 3300005842 Ga0068858_100002514 Ga0068858_1000025143 155
217 3300005843 Ga0068860_100000126 Ga0068860_10000012688 155
218 3300005843 Ga0068860_100006579 Ga0068860_10000657912 155
219 3300005844 Ga0068862_100000146 Ga0068862_10000014625 155
220 3300005844 Ga0068862_100078842 Ga0068862_1000788424 155
221 3300006931 Ga0097620_100039048 Ga0097620_1000390485 155
222 3300009011 Ga0105251_10079527 Ga0105251_100795271 155
223 3300009092 Ga0105250_10018579 Ga0105250_100185793 155
224 3300009093 Ga0105240_11485371 Ga0105240_114853712 155
225 3300009147 Ga0114129_10465210 Ga0114129_104652102 155
226 3300009148 Ga0105243_10116855 Ga0105243_101168551 155
227 3300009177 Ga0105248_10160999 Ga0105248_101609995 155
228 3300009177 Ga0105248_10448293 Ga0105248_104482932 155
229 3300009177 Ga0105248_11072170 Ga0105248_110721702 155
230 3300009545 Ga0105237_11315958 Ga0105237_113159581 155
231 3300009551 Ga0105238_10609350 Ga0105238_106093501 155
232 3300009553 Ga0105249_10000094 Ga0105249_1000009441 155
233 3300009553 Ga0105249_10098910 Ga0105249_100989103 155
234 3300013100 Ga0157373_10141677 Ga0157373_101416773 155
235 3300013102 Ga0157371_10348334 Ga0157371_103483342 155
236 3300013104 Ga0157370_10677540 Ga0157370_106775402 155
237 3300013105 Ga0157369_10026111 Ga0157369_100261114 155
238 3300013306 Ga0163162_10020604 Ga0163162_100206046 155
239 3300013306 Ga0163162_10041921 Ga0163162_100419215 155
240 3300013306 Ga0163162_10279919 Ga0163162_102799192 155
241 3300013307 Ga0157372_10163734 Ga0157372_101637343 155
242 3300014325 Ga0163163_10349797 Ga0163163_103497972 155
243 3300014326 Ga0157380_10007934 Ga0157380_100079345 155
244 3300014968 Ga0157379_10030612 Ga0157379_100306122 155
245 3300017792 Ga0163161_10000195 Ga0163161_1000019518 155
246 3300017792 Ga0163161_10721008 Ga0163161_107210082 155
247 3300025223 Ga0207672_1001676 Ga0207672_10016764 155
248 3300025321 Ga0207656_10052395 Ga0207656_100523952 155
249 3300025711 Ga0207696_1001635 Ga0207696_10016354 155
250 3300025735 Ga0207713_1004070 Ga0207713_100407012 155
251 3300025903 Ga0207680_10000007 Ga0207680_10000007317 155
252 3300025904 Ga0207647_10000444 Ga0207647_1000044430 155
253 3300025909 Ga0207705_10024300 Ga0207705_100243002 155
254 3300025911 Ga0207654_10003992 Ga0207654_100039922 155
255 3300025913 Ga0207695_10399106 Ga0207695_103991062 155
256 3300025914 Ga0207671_10000457 Ga0207671_100004572 155
257 3300025919 Ga0207657_10105319 Ga0207657_101053194 155
258 3300025920 Ga0207649_10492548 Ga0207649_104925482 155
259 3300025922 Ga0207646_10731553 Ga0207646_107315532 155
260 3300025923 Ga0207681_10000053 Ga0207681_1000005377 155
261 3300025923 Ga0207681_10000120 Ga0207681_1000012014 155
262 3300025924 Ga0207694_10274535 Ga0207694_102745352 155
263 3300025924 Ga0207694_10345887 Ga0207694_103458872 155
264 3300025925 Ga0207650_10050238 Ga0207650_100502385 155
265 3300025925 Ga0207650_10855037 Ga0207650_108550371 155
266 3300025931 Ga0207644_10015656 Ga0207644_100156563 155
267 3300025931 Ga0207644_10024648 Ga0207644_100246483 155
268 3300025936 Ga0207670_10011560 Ga0207670_100115607 155
269 3300025941 Ga0207711_10012882 Ga0207711_100128824 155
270 3300025941 Ga0207711_10138634 Ga0207711_101386343 155
271 3300025941 Ga0207711_11159970 Ga0207711_111599701 155
272 3300025949 Ga0207667_10191554 Ga0207667_101915542 155
273 3300025949 Ga0207667_11140759 Ga0207667_111407591 155
274 3300025961 Ga0207712_10000004 Ga0207712_10000004305 155
275 3300025961 Ga0207712_10007583 Ga0207712_100075833 155
276 3300025972 Ga0207668_10028040 Ga0207668_100280404 155
277 3300025972 Ga0207668_10053416 Ga0207668_100534162 155
278 3300025981 Ga0207640_10295914 Ga0207640_102959142 155
279 3300025986 Ga0207658_10000288 Ga0207658_1000028840 155
280 3300025986 Ga0207658_10001427 Ga0207658_1000142715 155
281 3300026035 Ga0207703_10002077 Ga0207703_1000207714 155
282 3300026035 Ga0207703_10077839 Ga0207703_100778392 155
283 3300026041 Ga0207639_10280397 Ga0207639_102803971 155
284 3300026067 Ga0207678_10194657 Ga0207678_101946574 155
285 3300026078 Ga0207702_10464183 Ga0207702_104641832 155
286 3300026088 Ga0207641_10000100 Ga0207641_1000010078 155
287 3300026095 Ga0207676_10004838 Ga0207676_1000483810 155
288 3300026116 Ga0207674_10056465 Ga0207674_100564652 155
289 3300026118 Ga0207675_100002120 Ga0207675_10000212018 155
290 3300026142 Ga0207698_10038950 Ga0207698_100389505 155
291 3300028379 Ga0268266_10000040 Ga0268266_10000040229 155
292 3300028379 Ga0268266_10002543 Ga0268266_1000254310 155
293 3300028380 Ga0268265_10000128 Ga0268265_1000012859 155
294 3300028381 Ga0268264_10000003 Ga0268264_10000003319 155
295 3300028381 Ga0268264_10004589 Ga0268264_1000458912 155
296 3300031548 Ga0307408_100205143 Ga0307408_1002051432 155
297 3300031852 Ga0307410_10447841 Ga0307410_104478412 155
298 3300031911 Ga0307412_10000920 Ga0307412_100009209 155
299 3300032002 Ga0307416_100208837 Ga0307416_1002088373 155
300 3300032004 Ga0307414_10007116 Ga0307414_100071166 155
301 3300032005 Ga0307411_10074536 Ga0307411_100745363 155
302 3300032133 Ga0316583_10219490 Ga0316583_102194901 155
303 3300046471 Ga0495650_0075932 Ga0495650_0075932_443_943 155
304 3300046513 Ga0495616_0000153 Ga0495616_0000153_3746_4219 155
305 3300046616 Ga0495668_0125585 Ga0495668_0125585_572_1045 155
306 3300048903 Ga0496100_0199152 Ga0496100_0199152_469_951 155
307 3300048904 Ga0496101_0072682 Ga0496101_0072682_977_1444 155
308 3300048904 Ga0496101_0103428 Ga0496101_0103428_1626_2108 155
309 3300048905 Ga0496102_0000209 Ga0496102_0000209_52369_52851 155
310 3300048906 Ga0496103_0000136 Ga0496103_0000136_59500_59982 155
311 3300048906 Ga0496103_0002395 Ga0496103_0002395_4715_5188 155
312 3300048908 Ga0496105_0006268 Ga0496105_0006268_3861_4343 155
313 3300048908 Ga0496105_0203153 Ga0496105_0203153_763_1236 155
314 3300048909 Ga0496106_0270315 Ga0496106_0270315_484_966 155
315 3300048910 Ga0496107_0483281 Ga0496107_0483281_370_852 155
316 3300048916 Ga0496113_0170703 Ga0496113_0170703_781_1263 155
317 3300048918 Ga0496115_0073073 Ga0496115_0073073_116_598 155
318 3300048919 Ga0496116_0000149 Ga0496116_0000149_116514_116981 155
319 3300048919 Ga0496116_0008522 Ga0496116_0008522_5966_6448 155
320 3300048920 Ga0496117_0000526 Ga0496117_0000526_9826_10308 155
321 3300048920 Ga0496117_0010660 Ga0496117_0010660_5578_6051 155
322 3300048921 Ga0496118_0003002 Ga0496118_0003002_4858_5340 155
323 3300048921 Ga0496118_0014990 Ga0496118_0014990_1211_1684 155
324 3300048921 Ga0496118_0040884 Ga0496118_0040884_931_1398 155
325 3300048922 Ga0496119_0015446 Ga0496119_0015446_4386_4868 155
326 3300048922 Ga0496119_0023742 Ga0496119_0023742_2297_2770 155
327 3300048923 Ga0496120_0096447 Ga0496120_0096447_1008_1490 155
328 3300048924 Ga0496121_0059551 Ga0496121_0059551_2286_2768 155
329 3300048925 Ga0496122_0026317 Ga0496122_0026317_2683_3150 155
330 3300048926 Ga0496123_0002495 Ga0496123_0002495_4500_4967 155
331 3300048927 Ga0496124_0005279 Ga0496124_0005279_511_978 155
332 3300048927 Ga0496124_0025322 Ga0496124_0025322_2108_2590 155
333 3300048927 Ga0496124_0368197 Ga0496124_0368197_75_548 155
334 3300048928 Ga0496125_0028760 Ga0496125_0028760_2405_2872 155
335 3300048928 Ga0496125_0058857 Ga0496125_0058857_333_815 155
336 3300048929 Ga0496126_0000261 Ga0496126_0000261_24593_25060 155
337 3300048929 Ga0496126_0000365 Ga0496126_0000365_38499_38981 155
338 3300048929 Ga0496126_0048856 Ga0496126_0048856_1234_1713 155
339 3300049568 Ga0501031_0183698 Ga0501031_0183698_653_1144 155
340 3300049571 Ga0501034_0087683 Ga0501034_0087683_590_1063 155
341 3300049571 Ga0501034_0679696 Ga0501034_0679696_182_673 155
342 3300049581 Ga0501047_0085015 Ga0501047_0085015_2172_2663 155
343 3300049587 Ga0501071_0629883 Ga0501071_0629883_54_527 155
344 3300049663 Ga0501223_000706 Ga0501223_000706_5395_5868 155
345 3300049664 Ga0501224_000027 Ga0501224_000027_26247_26720 155
346 3300049668 Ga0501233_025828 Ga0501233_025828_747_1220 155
347 3300049705 Ga0501225_0000057 Ga0501225_0000057_26872_27345 155
348 3300049707 Ga0501234_021749 Ga0501234_021749_503_976 155
349 3300049823 Ga0501044_0075851 Ga0501044_0075851_300_791 155
350 3300049853 Ga0501226_000068 Ga0501226_000068_26875_27348 155
351 3300050507 nmdc:mga05p37_940997_c1 nmdc:mga05p37_940997_c1_194_667 155
352 3300053151 Ga0500604_0078006 Ga0500604_0078006_523_996 155
353 3300053158 Ga0500627_0017326 Ga0500627_0017326_514_987 155
354 3300002459 JGI24751J29686_10013878 JGI24751J29686_100138782 156
355 3300003791 Ga0055530_10061550 Ga0055530_100615501 156
356 3300005347 Ga0070668_100360993 Ga0070668_1003609932 156
357 3300005355 Ga0070671_100412615 Ga0070671_1004126152 156
358 3300005367 Ga0070667_100000513 Ga0070667_10000051317 156
359 3300005468 Ga0070707_100124009 Ga0070707_1001240094 156
360 3300005530 Ga0070679_100120493 Ga0070679_1001204935 156
361 3300005530 Ga0070679_100150339 Ga0070679_1001503395 156
362 3300005530 Ga0070679_101651250 Ga0070679_1016512501 156
363 3300005577 Ga0068857_100165210 Ga0068857_1001652102 156
364 3300005841 Ga0068863_100013913 Ga0068863_1000139136 156
365 3300005843 Ga0068860_100023043 Ga0068860_1000230435 156
366 3300005843 Ga0068860_100048221 Ga0068860_1000482216 156
367 3300006177 Ga0075362_10095994 Ga0075362_100959943 156
368 3300009553 Ga0105249_10147326 Ga0105249_101473263 156
369 3300014326 Ga0157380_10104608 Ga0157380_101046083 156
370 3300014326 Ga0157380_11425757 Ga0157380_114257571 156
371 3300025298 Ga0209050_1000784 Ga0209050_100078427 156
372 3300025921 Ga0207652_10043930 Ga0207652_100439303 156
373 3300025921 Ga0207652_10063665 Ga0207652_100636655 156
374 3300025921 Ga0207652_10987242 Ga0207652_109872421 156
375 3300025922 Ga0207646_10129915 Ga0207646_101299152 156
376 3300025931 Ga0207644_10381592 Ga0207644_103815922 156
377 3300025961 Ga0207712_10156973 Ga0207712_101569733 156
378 3300025972 Ga0207668_10182480 Ga0207668_101824802 156
379 3300025986 Ga0207658_10001126 Ga0207658_100011268 156
380 3300026067 Ga0207678_10099517 Ga0207678_100995172 156
381 3300026088 Ga0207641_10083615 Ga0207641_100836154 156
382 3300026116 Ga0207674_10045876 Ga0207674_100458766 156
383 3300027665 Ga0209983_1028317 Ga0209983_10283172 156
384 3300028381 Ga0268264_10015428 Ga0268264_100154285 156
385 3300028381 Ga0268264_10229401 Ga0268264_102294012 156
386 3300030731 Ga0316177_1166439 Ga0316177_11664392 156
387 3300031731 Ga0307405_10528624 Ga0307405_105286242 156
388 3300031824 Ga0307413_10083154 Ga0307413_100831542 156
389 3300031824 Ga0307413_10192233 Ga0307413_101922332 156
390 3300031824 Ga0307413_10574760 Ga0307413_105747602 156
391 3300031852 Ga0307410_10021352 Ga0307410_100213524 156
392 3300031852 Ga0307410_10096543 Ga0307410_100965432 156
393 3300031852 Ga0307410_10224031 Ga0307410_102240312 156
394 3300031901 Ga0307406_10340071 Ga0307406_103400712 156
395 3300031903 Ga0307407_10801921 Ga0307407_108019212 156
396 3300031911 Ga0307412_10085215 Ga0307412_100852154 156
397 3300031911 Ga0307412_10092189 Ga0307412_100921892 156
398 3300031911 Ga0307412_10194206 Ga0307412_101942063 156
399 3300031911 Ga0307412_10311846 Ga0307412_103118462 156
400 3300031911 Ga0307412_10501556 Ga0307412_105015562 156
401 3300031995 Ga0307409_100313437 Ga0307409_1003134372 156
402 3300031995 Ga0307409_101108572 Ga0307409_1011085722 156
403 3300032002 Ga0307416_100072969 Ga0307416_1000729692 156
404 3300032004 Ga0307414_10130503 Ga0307414_101305034 156
405 3300032004 Ga0307414_10146234 Ga0307414_101462345 156
406 3300032004 Ga0307414_10178431 Ga0307414_101784312 156
407 3300032004 Ga0307414_10718681 Ga0307414_107186811 156
408 3300032004 Ga0307414_10792965 Ga0307414_107929652 156
409 3300032005 Ga0307411_10081800 Ga0307411_100818004 156
410 3300032005 Ga0307411_10301996 Ga0307411_103019963 156
411 3300032005 Ga0307411_10564030 Ga0307411_105640302 156
412 3300032126 Ga0307415_100061896 Ga0307415_1000618962 156
413 3300032133 Ga0316583_10004401 Ga0316583_100044016 156
414 3300042015 Ga0439462_0012070 Ga0439462_0012070_1611_2084 156
415 3300044712 Ga0453684_0267103 Ga0453684_0267103_956_1429 156
416 3300046460 Ga0495638_0217303 Ga0495638_0217303_534_1010 156
417 3300046530 Ga0495654_0073172 Ga0495654_0073172_547_1026 156
418 3300047443 Ga0495687_063236 Ga0495687_063236_167_646 156
419 3300048924 Ga0496121_0001586 Ga0496121_0001586_230_700 156
420 3300048927 Ga0496124_0006606 Ga0496124_0006606_3615_4085 156
421 3300049569 Ga0501032_0031710 Ga0501032_0031710_3066_3560 156
422 3300049572 Ga0501036_0982269 Ga0501036_0982269_107_601 156
423 3300049574 Ga0501038_0022535 Ga0501038_0022535_1798_2298 156
424 3300049579 Ga0501043_0028272 Ga0501043_0028272_3318_3812 156
425 3300049581 Ga0501047_0004437 Ga0501047_0004437_3300_3794 156
426 3300049582 Ga0501048_0561443 Ga0501048_0561443_141_635 156
427 3300049664 Ga0501224_031630 Ga0501224_031630_57_569 156
428 3300049823 Ga0501044_0081514 Ga0501044_0081514_372_866 156
429 3300053116 Ga0500592_035320 Ga0500592_035320_118_591 156
430 3300053117 Ga0500593_137528 Ga0500593_137528_400_873 156
431 3300053122 Ga0500608_000334 Ga0500608_000334_5647_6126 156
432 3300053125 Ga0500618_046270 Ga0500618_046270_356_859 156
433 3300053136 Ga0500559_0095695 Ga0500559_0095695_273_752 156
434 3300053138 Ga0500564_060211 Ga0500564_060211_835_1314 156
435 3300053139 Ga0500568_0105685 Ga0500568_0105685_391_864 156
436 3300053148 Ga0500590_000767 Ga0500590_000767_1080_1583 156
437 3300053177 Ga0500636_0071420 Ga0500636_0071420_1516_1995 156
438 3300053723 Ga0500567_000030 Ga0500567_000030_16573_17052 156
439 3300053729 Ga0500625_000027 Ga0500625_000027_52450_52929 156
440 iso_pu_bacteria 2643221541 2643730806 156
441 iso_pu_bacteria 2643221606 2644044541 156
442 iso_pu_bacteria 2643221671 2644391534 156
443 3300005353 Ga0070669_100470863 Ga0070669_1004708632 157
444 3300005355 Ga0070671_100291002 Ga0070671_1002910022 157
445 3300005367 Ga0070667_100004694 Ga0070667_1000046944 157
446 3300005466 Ga0070685_10086499 Ga0070685_100864992 157
447 3300005548 Ga0070665_100005502 Ga0070665_1000055029 157
448 3300005548 Ga0070665_100966929 Ga0070665_1009669292 157
449 3300005563 Ga0068855_100137624 Ga0068855_1001376244 157
450 3300005616 Ga0068852_100464695 Ga0068852_1004646952 157
451 3300005618 Ga0068864_100163743 Ga0068864_1001637431 157
452 3300005841 Ga0068863_100000466 Ga0068863_10000046615 157
453 3300005842 Ga0068858_100009946 Ga0068858_1000099466 157
454 3300005843 Ga0068860_100000473 Ga0068860_10000047329 157
455 3300005844 Ga0068862_100005381 Ga0068862_1000053816 157
456 3300005844 Ga0068862_100013808 Ga0068862_1000138084 157
457 3300006038 Ga0075365_10001463 Ga0075365_1000146314 157
458 3300006042 Ga0075368_10000287 Ga0075368_1000028716 157
459 3300006048 Ga0075363_100000904 Ga0075363_1000009042 157
460 3300006051 Ga0075364_10055359 Ga0075364_100553594 157
461 3300006051 Ga0075364_10334942 Ga0075364_103349422 157
462 3300006177 Ga0075362_10001875 Ga0075362_100018754 157
463 3300006177 Ga0075362_10157457 Ga0075362_101574572 157
464 3300006178 Ga0075367_10000871 Ga0075367_1000087115 157
465 3300006178 Ga0075367_10863251 Ga0075367_108632511 157
466 3300006195 Ga0075366_10079432 Ga0075366_100794322 157
467 3300006353 Ga0075370_10017854 Ga0075370_100178544 157
468 3300006353 Ga0075370_10122011 Ga0075370_101220112 157
469 3300006946 Ga0079104_1046047 Ga0079104_10460472 157
470 3300009011 Ga0105251_10272905 Ga0105251_102729052 157
471 3300009092 Ga0105250_10151833 Ga0105250_101518332 157
472 3300009092 Ga0105250_10171932 Ga0105250_101719322 157
473 3300009177 Ga0105248_10230722 Ga0105248_102307223 157
474 3300025903 Ga0207680_10502387 Ga0207680_105023872 157
475 3300025923 Ga0207681_10409780 Ga0207681_104097802 157
476 3300025941 Ga0207711_10124221 Ga0207711_101242213 157
477 3300025949 Ga0207667_11406901 Ga0207667_114069011 157
478 3300025972 Ga0207668_10906167 Ga0207668_109061672 157
479 3300025986 Ga0207658_10003756 Ga0207658_1000375610 157
480 3300026035 Ga0207703_10003308 Ga0207703_100033089 157
481 3300026088 Ga0207641_10000098 Ga0207641_1000009839 157
482 3300026095 Ga0207676_10141458 Ga0207676_101414584 157
483 3300027866 Ga0209813_10000027 Ga0209813_1000002753 157
484 3300028379 Ga0268266_10008044 Ga0268266_100080446 157
485 3300028379 Ga0268266_10583339 Ga0268266_105833391 157
486 3300028380 Ga0268265_10003510 Ga0268265_1000351013 157
487 3300028380 Ga0268265_10005291 Ga0268265_100052918 157
488 3300028381 Ga0268264_10000224 Ga0268264_1000022480 157
489 3300031731 Ga0307405_10745876 Ga0307405_107458761 157
490 3300031824 Ga0307413_11785523 Ga0307413_117855231 157
491 3300031911 Ga0307412_10083969 Ga0307412_100839692 157
492 3300041997 Ga0439431_0086077 Ga0439431_0086077_280_759 157
493 3300042436 Ga0439435_0031583 Ga0439435_0031583_792_1271 157
494 3300048906 Ga0496103_0459819 Ga0496103_0459819_213_692 157
495 3300048908 Ga0496105_0009539 Ga0496105_0009539_3705_4181 157
496 3300048908 Ga0496105_0426175 Ga0496105_0426175_481_957 157
497 3300048920 Ga0496117_0089427 Ga0496117_0089427_1228_1704 157
498 3300048923 Ga0496120_0062436 Ga0496120_0062436_1118_1594 157
499 3300048924 Ga0496121_0002667 Ga0496121_0002667_22152_22628 157
500 3300049571 Ga0501034_0808514 Ga0501034_0808514_248_733 157
501 3300049573 Ga0501037_0260032 Ga0501037_0260032_556_1032 157
502 3300049575 Ga0501039_0331637 Ga0501039_0331637_700_1176 157
503 3300049581 Ga0501047_0478095 Ga0501047_0478095_338_826 157
504 3300049589 Ga0501073_0246433 Ga0501073_0246433_256_741 157
505 3300049822 Ga0501035_0384132 Ga0501035_0384132_115_597 157
506 3300049823 Ga0501044_0024420 Ga0501044_0024420_2159_2635 157
507 3300049823 Ga0501044_0390785 Ga0501044_0390785_121_600 157
508 3300050489 nmdc:mga03683_138761_c1 nmdc:mga03683_138761_c1_406_912 157
509 3300050489 nmdc:mga03683_164_c1 nmdc:mga03683_164_c1_12268_12747 157
510 3300050491 nmdc:mga00v17_671904_c1 nmdc:mga00v17_671904_c1_80_559 157
511 3300050491 nmdc:mga00v17_79048_c1 nmdc:mga00v17_79048_c1_742_1221 157
512 3300050492 nmdc:mga0yw44_107595_c1 nmdc:mga0yw44_107595_c1_564_1043 157
513 3300050493 nmdc:mga0k408_45592_c1 nmdc:mga0k408_45592_c1_742_1221 157
514 3300050493 nmdc:mga0k408_9510_c1 nmdc:mga0k408_9510_c1_580_1056 157
515 3300050494 nmdc:mga06z11_140_c1 nmdc:mga06z11_140_c1_10501_10980 157
516 3300050495 nmdc:mga04h51_48_c1 nmdc:mga04h51_48_c1_13207_13686 157
517 3300050496 nmdc:mga07m45_118275_c1 nmdc:mga07m45_118275_c1_625_1104 157
518 3300050496 nmdc:mga07m45_9_c1 nmdc:mga07m45_9_c1_163570_164049 157
519 3300050516 nmdc:mga0sz30_8482_c1 nmdc:mga0sz30_8482_c1_2663_3142 157
520 3300053087 Ga0500643_000005 Ga0500643_000005_298961_299434 157
521 3300053121 Ga0500607_002009 Ga0500607_002009_14033_14515 157
522 3300053146 Ga0500588_0077957 Ga0500588_0077957_155_646 157
523 3300053151 Ga0500604_0041115 Ga0500604_0041115_712_1185 157
524 3300053153 Ga0500616_0001003 Ga0500616_0001003_4249_4722 157
525 3300053156 Ga0500622_0122029 Ga0500622_0122029_263_754 157
526 3300001915 JGI24741J21665_1030381 JGI24741J21665_10303811 158
527 3300001979 JGI24740J21852_10104351 JGI24740J21852_101043512 158
528 3300002239 JGI24034J26672_10049767 JGI24034J26672_100497671 158
529 3300005327 Ga0070658_10005850 Ga0070658_100058507 158
530 3300005327 Ga0070658_10061342 Ga0070658_100613423 158
531 3300005328 Ga0070676_10163105 Ga0070676_101631052 158
532 3300005329 Ga0070683_100065348 Ga0070683_1000653484 158
533 3300005335 Ga0070666_10033802 Ga0070666_100338024 158
534 3300005336 Ga0070680_100050345 Ga0070680_1000503452 158
535 3300005336 Ga0070680_100186823 Ga0070680_1001868233 158
536 3300005337 Ga0070682_100632998 Ga0070682_1006329982 158
537 3300005339 Ga0070660_100042448 Ga0070660_1000424482 158
538 3300005339 Ga0070660_100051571 Ga0070660_1000515714 158
539 3300005344 Ga0070661_100001389 Ga0070661_10000138917 158
540 3300005345 Ga0070692_10175896 Ga0070692_101758962 158
541 3300005353 Ga0070669_100000280 Ga0070669_10000028014 158
542 3300005355 Ga0070671_100000005 Ga0070671_100000005106 158
543 3300005366 Ga0070659_100039475 Ga0070659_1000394752 158
544 3300005367 Ga0070667_100093007 Ga0070667_1000930072 158
545 3300005455 Ga0070663_101619535 Ga0070663_1016195351 158
546 3300005456 Ga0070678_100126175 Ga0070678_1001261752 158
547 3300005457 Ga0070662_100007379 Ga0070662_1000073796 158
548 3300005457 Ga0070662_100011103 Ga0070662_1000111034 158
549 3300005457 Ga0070662_100107279 Ga0070662_1001072795 158
550 3300005458 Ga0070681_10003398 Ga0070681_100033982 158
551 3300005530 Ga0070679_100007479 Ga0070679_1000074799 158
552 3300005535 Ga0070684_100203640 Ga0070684_1002036402 158
553 3300005539 Ga0068853_100040907 Ga0068853_1000409072 158
554 3300005539 Ga0068853_100462054 Ga0068853_1004620541 158
555 3300005539 Ga0068853_100560360 Ga0068853_1005603602 158
556 3300005544 Ga0070686_100014214 Ga0070686_1000142146 158
557 3300005548 Ga0070665_100635539 Ga0070665_1006355392 158
558 3300005563 Ga0068855_100005378 Ga0068855_1000053782 158
559 3300005563 Ga0068855_100007675 Ga0068855_1000076757 158
560 3300005563 Ga0068855_100273237 Ga0068855_1002732372 158
561 3300005564 Ga0070664_100016187 Ga0070664_1000161877 158
562 3300005564 Ga0070664_100063041 Ga0070664_1000630415 158
563 3300005577 Ga0068857_101374411 Ga0068857_1013744112 158
564 3300005578 Ga0068854_100053631 Ga0068854_1000536313 158
565 3300005614 Ga0068856_100011950 Ga0068856_1000119502 158
566 3300005618 Ga0068864_100018960 Ga0068864_1000189602 158
567 3300005842 Ga0068858_100060889 Ga0068858_1000608893 158
568 3300005843 Ga0068860_100776938 Ga0068860_1007769381 158
569 3300005844 Ga0068862_102018123 Ga0068862_1020181231 158
570 3300006051 Ga0075364_10002645 Ga0075364_100026457 158
571 3300006353 Ga0075370_10542908 Ga0075370_105429082 158
572 3300009101 Ga0105247_10487528 Ga0105247_104875282 158
573 3300009177 Ga0105248_10070601 Ga0105248_100706012 158
574 3300010375 Ga0105239_10204978 Ga0105239_102049782 158
575 3300011119 Ga0105246_10001552 Ga0105246_1000155210 158
576 3300013100 Ga0157373_10006736 Ga0157373_100067363 158
577 3300013100 Ga0157373_10036270 Ga0157373_100362703 158
578 3300013100 Ga0157373_10340324 Ga0157373_103403242 158
579 3300013102 Ga0157371_10000785 Ga0157371_1000078518 158
580 3300013104 Ga0157370_10001694 Ga0157370_1000169411 158
581 3300013105 Ga0157369_10012283 Ga0157369_1001228311 158
582 3300013306 Ga0163162_11761576 Ga0163162_117615762 158
583 3300013307 Ga0157372_10029102 Ga0157372_100291027 158
584 3300013307 Ga0157372_10705751 Ga0157372_107057512 158
585 3300013308 Ga0157375_10144108 Ga0157375_101441082 158
586 3300013308 Ga0157375_10179481 Ga0157375_101794812 158
587 3300014745 Ga0157377_10024862 Ga0157377_100248622 158
588 3300025315 Ga0207697_10115308 Ga0207697_101153082 158
589 3300025900 Ga0207710_10294186 Ga0207710_102941861 158
590 3300025903 Ga0207680_10038091 Ga0207680_100380913 158
591 3300025909 Ga0207705_10004092 Ga0207705_100040926 158
592 3300025909 Ga0207705_10010322 Ga0207705_100103225 158
593 3300025909 Ga0207705_10013576 Ga0207705_100135765 158
594 3300025912 Ga0207707_10042051 Ga0207707_100420513 158
595 3300025917 Ga0207660_10097427 Ga0207660_100974272 158
596 3300025919 Ga0207657_10000156 Ga0207657_1000015651 158
597 3300025920 Ga0207649_10049011 Ga0207649_100490114 158
598 3300025921 Ga0207652_10029192 Ga0207652_100291925 158
599 3300025921 Ga0207652_10232045 Ga0207652_102320452 158
600 3300025921 Ga0207652_11156991 Ga0207652_111569912 158
601 3300025923 Ga0207681_10000096 Ga0207681_1000009618 158
602 3300025931 Ga0207644_10000008 Ga0207644_10000008219 158
603 3300025932 Ga0207690_10010558 Ga0207690_100105585 158
604 3300025932 Ga0207690_10041541 Ga0207690_100415416 158
605 3300025932 Ga0207690_10712426 Ga0207690_107124262 158
606 3300025932 Ga0207690_10782312 Ga0207690_107823122 158
607 3300025933 Ga0207706_10001803 Ga0207706_1000180317 158
608 3300025933 Ga0207706_10012286 Ga0207706_100122867 158
609 3300025933 Ga0207706_10072887 Ga0207706_100728875 158
610 3300025941 Ga0207711_11398261 Ga0207711_113982612 158
611 3300025944 Ga0207661_10025722 Ga0207661_100257227 158
612 3300025944 Ga0207661_10432261 Ga0207661_104322612 158
613 3300025945 Ga0207679_10050397 Ga0207679_100503972 158
614 3300025945 Ga0207679_10681731 Ga0207679_106817312 158
615 3300025949 Ga0207667_10002631 Ga0207667_100026315 158
616 3300025949 Ga0207667_10008785 Ga0207667_100087857 158
617 3300025949 Ga0207667_10246079 Ga0207667_102460792 158
618 3300025981 Ga0207640_10035619 Ga0207640_100356193 158
619 3300025986 Ga0207658_10275454 Ga0207658_102754541 158
620 3300026041 Ga0207639_10001184 Ga0207639_100011845 158
621 3300026041 Ga0207639_10474822 Ga0207639_104748222 158
622 3300026067 Ga0207678_10007056 Ga0207678_100070562 158
623 3300026067 Ga0207678_10143527 Ga0207678_101435273 158
624 3300026078 Ga0207702_10235282 Ga0207702_102352822 158
625 3300026078 Ga0207702_10894557 Ga0207702_108945572 158
626 3300026095 Ga0207676_10026680 Ga0207676_100266802 158
627 3300026116 Ga0207674_10009464 Ga0207674_100094645 158
628 3300026116 Ga0207674_10049173 Ga0207674_100491732 158
629 3300026121 Ga0207683_10248083 Ga0207683_102480831 158
630 3300026142 Ga0207698_10397518 Ga0207698_103975181 158
631 3300028379 Ga0268266_10269197 Ga0268266_102691972 158
632 3300028381 Ga0268264_10036868 Ga0268264_100368685 158
633 3300031548 Ga0307408_101257004 Ga0307408_1012570041 158
634 3300031691 Ga0316579_10032772 Ga0316579_100327723 158
635 3300031731 Ga0307405_10272817 Ga0307405_102728172 158
636 3300031901 Ga0307406_11477273 Ga0307406_114772731 158
637 3300031911 Ga0307412_10224887 Ga0307412_102248871 158
638 3300031911 Ga0307412_10877422 Ga0307412_108774222 158
639 3300032002 Ga0307416_101144883 Ga0307416_1011448831 158
640 3300032004 Ga0307414_10020591 Ga0307414_100205916 158
641 3300032004 Ga0307414_10028547 Ga0307414_100285472 158
642 3300032004 Ga0307414_10357598 Ga0307414_103575982 158
643 3300032004 Ga0307414_11104324 Ga0307414_111043241 158
644 3300032005 Ga0307411_10217148 Ga0307411_102171483 158
645 3300036647 Ga0316582_0000131 Ga0316582_0000131_3397_3918 158
646 3300041498 Ga0451841_0878360 Ga0451841_0878360_375_851 158
647 3300046512 Ga0495610_0305485 Ga0495610_0305485_95_592 158
648 3300048903 Ga0496100_0018122 Ga0496100_0018122_430_927 158
649 3300048904 Ga0496101_0107562 Ga0496101_0107562_689_1186 158
650 3300048905 Ga0496102_0055768 Ga0496102_0055768_946_1443 158
651 3300048906 Ga0496103_0016230 Ga0496103_0016230_2537_3034 158
652 3300048907 Ga0496104_0142986 Ga0496104_0142986_426_923 158
653 3300048908 Ga0496105_0040280 Ga0496105_0040280_876_1373 158
654 3300048908 Ga0496105_0302663 Ga0496105_0302663_761_1243 158
655 3300048909 Ga0496106_0004392 Ga0496106_0004392_1686_2183 158
656 3300048910 Ga0496107_0005831 Ga0496107_0005831_4314_4811 158
657 3300048911 Ga0496108_0268966 Ga0496108_0268966_206_703 158
658 3300048912 Ga0496109_0518126 Ga0496109_0518126_559_1056 158
659 3300048913 Ga0496110_0108760 Ga0496110_0108760_1921_2418 158
660 3300048915 Ga0496112_0507864 Ga0496112_0507864_203_700 158
661 3300048916 Ga0496113_0001214 Ga0496113_0001214_10255_10752 158
662 3300048917 Ga0496114_0073823 Ga0496114_0073823_855_1337 158
663 3300048924 Ga0496121_0000024 Ga0496121_0000024_143212_143706 158
664 3300049571 Ga0501034_0451467 Ga0501034_0451467_82_579 158
665 3300050489 nmdc:mga03683_10563_c1 nmdc:mga03683_10563_c1_1976_2464 158
666 3300050491 nmdc:mga00v17_357_c1 nmdc:mga00v17_357_c1_537_1025 158
667 3300050491 nmdc:mga00v17_611975_c1 nmdc:mga00v17_611975_c1_15_509 158
668 3300050496 nmdc:mga07m45_560937_c1 nmdc:mga07m45_560937_c1_150_635 158
669 3300050516 nmdc:mga0sz30_7685_c1 nmdc:mga0sz30_7685_c1_344_832 158
670 iso_pu_bacteria 2882806704 2882809244 158
671 3300005289 Ga0065704_10084844 Ga0065704_100848442 159
672 3300005327 Ga0070658_10001686 Ga0070658_1000168612 159
673 3300005539 Ga0068853_100843839 Ga0068853_1008438392 159
674 3300005563 Ga0068855_101280560 Ga0068855_1012805601 159
675 3300005577 Ga0068857_100273739 Ga0068857_1002737392 159
676 3300005578 Ga0068854_100014709 Ga0068854_1000147094 159
677 3300005578 Ga0068854_100909848 Ga0068854_1009098482 159
678 3300005614 Ga0068856_100027069 Ga0068856_1000270693 159
679 3300005616 Ga0068852_100000174 Ga0068852_10000017429 159
680 3300005834 Ga0068851_10183448 Ga0068851_101834482 159
681 3300006048 Ga0075363_100000629 Ga0075363_1000006298 159
682 3300006051 Ga0075364_10151124 Ga0075364_101511242 159
683 3300006177 Ga0075362_10000043 Ga0075362_1000004324 159
684 3300006178 Ga0075367_10255167 Ga0075367_102551672 159
685 3300006195 Ga0075366_10000830 Ga0075366_1000083014 159
686 3300006353 Ga0075370_10000002 Ga0075370_10000002140 159
687 3300006353 Ga0075370_10055104 Ga0075370_100551043 159
688 3300006946 Ga0079104_1031823 Ga0079104_10318232 159
689 3300009093 Ga0105240_10002147 Ga0105240_1000214721 159
690 3300009094 Ga0111539_11919351 Ga0111539_119193512 159
691 3300009174 Ga0105241_10545035 Ga0105241_105450352 159
692 3300009177 Ga0105248_10340473 Ga0105248_103404732 159
693 3300009545 Ga0105237_10884958 Ga0105237_108849582 159
694 3300017792 Ga0163161_10075125 Ga0163161_100751253 159
695 3300025315 Ga0207697_10307810 Ga0207697_103078102 159
696 3300025321 Ga0207656_10408355 Ga0207656_104083551 159
697 3300025904 Ga0207647_10016274 Ga0207647_100162745 159
698 3300025909 Ga0207705_10000007 Ga0207705_10000007530 159
699 3300025913 Ga0207695_10001471 Ga0207695_1000147110 159
700 3300025914 Ga0207671_10260172 Ga0207671_102601722 159
701 3300025949 Ga0207667_10352524 Ga0207667_103525241 159
702 3300025949 Ga0207667_10533107 Ga0207667_105331072 159
703 3300025972 Ga0207668_10054318 Ga0207668_100543182 159
704 3300025981 Ga0207640_10002520 Ga0207640_100025209 159
705 3300025986 Ga0207658_11224592 Ga0207658_112245922 159
706 3300026041 Ga0207639_10200615 Ga0207639_102006152 159
707 3300026078 Ga0207702_10011176 Ga0207702_100111763 159
708 3300026116 Ga0207674_10135300 Ga0207674_101353003 159
709 3300026142 Ga0207698_10000098 Ga0207698_1000009824 159
710 3300028379 Ga0268266_10569806 Ga0268266_105698063 159
711 3300035112 Ga0373932_0096501 Ga0373932_0096501_38_562 159
712 3300035121 Ga0373960_0078111 Ga0373960_0078111_352_876 159
713 3300048907 Ga0496104_0229837 Ga0496104_0229837_640_1131 159
714 3300048908 Ga0496105_0319403 Ga0496105_0319403_667_1158 159
715 3300048927 Ga0496124_0779675 Ga0496124_0779675_38_526 159
716 3300050489 nmdc:mga03683_3_c1 nmdc:mga03683_3_c1_186475_187002 159
717 3300050490 nmdc:mga03n38_243_c1 nmdc:mga03n38_243_c1_4027_4554 159
718 3300050491 nmdc:mga00v17_145892_c1 nmdc:mga00v17_145892_c1_379_906 159
719 3300050493 nmdc:mga0k408_2_c1 nmdc:mga0k408_2_c1_363717_364244 159
720 3300050496 nmdc:mga07m45_1_c1 nmdc:mga07m45_1_c1_258645_259169 159
721 3300050496 nmdc:mga07m45_256_c1 nmdc:mga07m45_256_c1_907_1392 159
722 3300050511 nmdc:mga08y16_1471492_c1 nmdc:mga08y16_1471492_c1_38_565 159
723 3300053125 Ga0500618_002917 Ga0500618_002917_3089_3586 159
724 2162886007 SwRhRL2b_contig_2375226 SwRhRL2b_0484.00006300 160
725 3300005289 Ga0065704_10070157 Ga0065704_1007015729 160
726 3300005327 Ga0070658_10249434 Ga0070658_102494342 160
727 3300005563 Ga0068855_100069885 Ga0068855_1000698853 160
728 3300005618 Ga0068864_100222879 Ga0068864_1002228792 160
729 3300005841 Ga0068863_101380064 Ga0068863_1013800642 160
730 3300005844 Ga0068862_100247202 Ga0068862_1002472023 160
731 3300006058 Ga0075432_10000636 Ga0075432_1000063610 160
732 3300006195 Ga0075366_10087476 Ga0075366_100874762 160
733 3300006195 Ga0075366_10628441 Ga0075366_106284411 160
734 3300006353 Ga0075370_10009387 Ga0075370_100093873 160
735 3300006353 Ga0075370_10056327 Ga0075370_100563273 160
736 3300009177 Ga0105248_10047334 Ga0105248_100473343 160
737 3300013102 Ga0157371_10067925 Ga0157371_100679253 160
738 3300025903 Ga0207680_10420056 Ga0207680_104200562 160
739 3300025931 Ga0207644_10002058 Ga0207644_100020584 160
740 3300025941 Ga0207711_10155432 Ga0207711_101554323 160
741 3300025949 Ga0207667_10056598 Ga0207667_100565984 160
742 3300025949 Ga0207667_10102292 Ga0207667_101022921 160
743 3300026095 Ga0207676_10483568 Ga0207676_104835682 160
744 3300026142 Ga0207698_10054747 Ga0207698_100547473 160
745 3300026142 Ga0207698_11417413 Ga0207698_114174131 160
746 3300027907 Ga0207428_10021045 Ga0207428_100210455 160
747 3300028380 Ga0268265_10262033 Ga0268265_102620332 160
748 3300031731 Ga0307405_11006616 Ga0307405_110066162 160
749 3300046460 Ga0495638_0082949 Ga0495638_0082949_476_964 160
750 3300046507 Ga0495606_0196315 Ga0495606_0196315_306_809 160
751 3300046512 Ga0495610_0012788 Ga0495610_0012788_1043_1546 160
752 3300046519 Ga0495632_0285947 Ga0495632_0285947_39_527 160
753 3300046522 Ga0495643_0097153 Ga0495643_0097153_838_1341 160
754 3300048091 Ga0495626_0001180 Ga0495626_0001180_4494_4997 160
755 3300048905 Ga0496102_0315077 Ga0496102_0315077_85_591 160
756 3300048906 Ga0496103_0045736 Ga0496103_0045736_136_642 160
757 3300048919 Ga0496116_0020693 Ga0496116_0020693_919_1425 160
758 3300048921 Ga0496118_0023491 Ga0496118_0023491_1681_2187 160
759 3300049570 Ga0501033_0793166 Ga0501033_0793166_54_557 160
760 3300050493 nmdc:mga0k408_653273_c1 nmdc:mga0k408_653273_c1_58_549 160
761 3300050496 nmdc:mga07m45_18528_c1 nmdc:mga07m45_18528_c1_1207_1701 160
762 3300050496 nmdc:mga07m45_5276_c1 nmdc:mga07m45_5276_c1_4003_4494 160
763 3300050514 nmdc:mga08x19_303034_c1 nmdc:mga08x19_303034_c1_470_964 160
764 3300053087 Ga0500643_102818 Ga0500643_102818_106_594 160
765 3300053103 Ga0500555_139243 Ga0500555_139243_34_525 160
766 3300053108 Ga0500562_028676 Ga0500562_028676_69_560 160
767 3300053121 Ga0500607_000473 Ga0500607_000473_34532_35023 160
768 3300053136 Ga0500559_0002117 Ga0500559_0002117_3849_4340 160
769 3300053136 Ga0500559_0002682 Ga0500559_0002682_2294_2785 160
770 3300053148 Ga0500590_009605 Ga0500590_009605_3007_3498 160
771 3300053178 Ga0500637_0001962 Ga0500637_0001962_6215_6706 160
772 3300053730 Ga0500645_002625 Ga0500645_002625_3827_4318 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01883

FeS_assembly_P

Iron-sulfur cluster assembly protein

60

125

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cu6-assembly1.cif.gz_A crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 0.7714 63 153
2cu6-assembly1.cif.gz_A crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 0.7568 63 153
1wcj-assembly1.cif.gz_A conserved hypothetical protein tm0487 from thermotoga maritima 0.7471 65 158
3lno-assembly1.cif.gz_A crystal structure of domain of unknown function duf59 from bacillus anthracis 0.7417 62 160
4qq0-assembly1.cif.gz_A cdsd - the structural protein of the type iii secretion system of chlamydia trachomatis: c-terminal domain 0.7344 63 142
ID Description Score Start End Superfamily
af_Q0JJS8_71_163_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8827 64 149 3.30.300.130
af_Q0JJS8_71_163_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8136 64 149 3.30.300.130
af_Q8II78_18_117_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8075 64 151 3.30.300.130
af_P0AFH8_57_122_3.30.1340.30 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;; 0.7958 61 141 3.30.1340.30
af_P0AFH8_57_122_3.30.1340.30 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;; 0.7853 61 141 3.30.1340.30
ID Description Score Start End GO Terms
AF-A0A1G0VN27-F1-model_v4 FeS assembly SUF system protein 0.9573 63 142
AF-A0A497GU73-F1-model_v4 Aromatic ring hydroxylase 0.9489 65 140
AF-A0A3A1MLC0-F1-model_v4 DUF59 domain-containing protein 0.9445 62 139
AF-A0A523XVX3-F1-model_v4 DUF59 domain-containing protein 0.9403 63 139
AF-A0A496LTY7-F1-model_v4 Metal-sulfur cluster assembly factor 0.933 65 139

Feature Viewer

pLDDT pTM Quality
79.64 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map