F480123
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 772 | 308 | 756 | 158 |
Family's Representative Sequence
| Representative Sequence | 3300031731|Ga0307405_10678243|Ga0307405_106782432 |
| Length | 147 |
| Sequence | MSEGSNIRIEEVEGVAPPPRARVDESPQAKLERKRDYLDGFLAQKPAEVPAGEPGGPLYDGVIDALKEIYDPEIPVNIYELGLIYGVDVSDDADTPHCPVAESMPGEVELRVGAVPGVRDAEVNLVWDPPWDPAKMSDEARLELGML |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 3 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 4 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 5 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 6 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 7 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 8 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 9 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 10 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 11 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 12 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 13 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 14 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 15 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 16 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 17 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 18 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 19 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 20 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 21 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 22 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 23 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 24 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 25 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 26 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 27 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 28 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 29 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 30 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 39 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 84 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 85 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 90 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 168 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 169 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 170 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 171 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 172 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 173 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 174 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 175 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 176 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 177 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 178 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 179 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 180 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 181 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 182 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 183 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 184 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 186 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 187 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 188 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 189 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 190 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 191 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 192 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 193 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 194 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 195 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 213 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 214 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 215 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 216 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 217 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 218 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 221 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 222 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 223 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 224 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 225 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 226 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 227 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 228 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 229 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 230 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 231 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 232 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 233 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 234 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 235 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 236 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 237 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 238 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 239 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 253 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 254 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 255 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 256 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 257 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 258 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 259 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 260 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 261 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 262 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 263 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 264 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 265 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 266 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 267 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 268 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 269 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 270 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 271 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 274 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 275 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 276 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 277 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 278 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 279 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 280 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 281 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 282 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 286 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 287 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 288 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 289 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 290 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 291 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 292 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 293 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 294 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 295 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 296 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 297 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 298 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 299 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 300 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 301 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 302 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 303 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 304 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 305 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 306 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 307 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 308 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.93 |
| Metatranscriptomes | 0 |
| Isolates | 2.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.53 |
| Nodule | 0.26 |
| Rhizoplane | 4.66 |
| Rhizosphere | 76.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2375226 | 2162886007 | Bacteria | 9321 |
| 2 | SwRhRL2b_contig_3705888 | 2162886007 | Bacteria | 2379 |
| 3 | JGI24736J21556_1000162 | 3300001904 | Bacteria | 11868 |
| 4 | JGI24741J21665_1030381 | 3300001915 | Bacteria | 810 |
| 5 | JGI24752J21851_1000138 | 3300001976 | Bacteria | 9836 |
| 6 | JGI24752J21851_1002192 | 3300001976 | Bacteria | 2608 |
| 7 | JGI24740J21852_10045219 | 3300001979 | Bacteria | 1301 |
| 8 | JGI24740J21852_10104351 | 3300001979 | Bacteria | 719 |
| 9 | JGI24739J22299_10008859 | 3300001989 | Bacteria | 3751 |
| 10 | JGI24737J22298_10030127 | 3300001990 | Bacteria | 1699 |
| 11 | JGI24750J21931_1000338 | 3300002070 | Bacteria | 7951 |
| 12 | JGI24750J21931_1036357 | 3300002070 | Bacteria | 737 |
| 13 | JGI24748J21848_1000033 | 3300002074 | Bacteria | 78443 |
| 14 | JGI24738J21930_10024920 | 3300002075 | Bacteria | 1230 |
| 15 | JGI24749J21850_1002743 | 3300002076 | Bacteria | 2467 |
| 16 | JGI24034J26672_10000032 | 3300002239 | Bacteria | 89175 |
| 17 | JGI24034J26672_10049767 | 3300002239 | Bacteria | 719 |
| 18 | JGI24751J29686_10013878 | 3300002459 | Bacteria | 1663 |
| 19 | Ga0055530_10061550 | 3300003791 | Bacteria | 836 |
| 20 | Ga0065704_10000553 | 3300005289 | Bacteria | 24228 |
| 21 | Ga0065704_10070157 | 3300005289 | Bacteria | 211668 |
| 22 | Ga0065704_10084844 | 3300005289 | Bacteria | 3289 |
| 23 | Ga0065704_10358848 | 3300005289 | Bacteria | 800 |
| 24 | Ga0065707_10253023 | 3300005295 | Bacteria | 1119 |
| 25 | Ga0070658_10001686 | 3300005327 | Bacteria | 18655 |
| 26 | Ga0070658_10005850 | 3300005327 | Bacteria | 9970 |
| 27 | Ga0070658_10061342 | 3300005327 | Bacteria | 3063 |
| 28 | Ga0070658_10249434 | 3300005327 | Bacteria | 1506 |
| 29 | Ga0070658_10568577 | 3300005327 | Bacteria | 981 |
| 30 | Ga0070676_10163105 | 3300005328 | Bacteria | 1436 |
| 31 | Ga0070683_100065348 | 3300005329 | Bacteria | 3387 |
| 32 | Ga0070683_100500741 | 3300005329 | Bacteria | 1160 |
| 33 | Ga0070690_100000011 | 3300005330 | Bacteria | 95472 |
| 34 | Ga0070670_100016491 | 3300005331 | Bacteria | 6343 |
| 35 | Ga0070670_100032619 | 3300005331 | Bacteria | 4486 |
| 36 | Ga0070670_101202986 | 3300005331 | Bacteria | 692 |
| 37 | Ga0068869_101094469 | 3300005334 | Bacteria | 697 |
| 38 | Ga0070666_10000035 | 3300005335 | Bacteria | 121458 |
| 39 | Ga0070666_10000067 | 3300005335 | Bacteria | 76560 |
| 40 | Ga0070666_10033802 | 3300005335 | Bacteria | 3386 |
| 41 | Ga0070680_100050345 | 3300005336 | Bacteria | 3397 |
| 42 | Ga0070680_100186823 | 3300005336 | Bacteria | 1746 |
| 43 | Ga0070680_100574742 | 3300005336 | Bacteria | 967 |
| 44 | Ga0070682_100102095 | 3300005337 | Bacteria | 1895 |
| 45 | Ga0070682_100632998 | 3300005337 | Bacteria | 849 |
| 46 | Ga0070660_100042448 | 3300005339 | Bacteria | 3471 |
| 47 | Ga0070660_100051571 | 3300005339 | Bacteria | 3169 |
| 48 | Ga0070660_100208849 | 3300005339 | Bacteria | 1584 |
| 49 | Ga0070660_100251325 | 3300005339 | Bacteria | 1442 |
| 50 | Ga0070689_100019644 | 3300005340 | Bacteria | 4997 |
| 51 | Ga0070689_101381840 | 3300005340 | Bacteria | 636 |
| 52 | Ga0070661_100001389 | 3300005344 | Bacteria | 16919 |
| 53 | Ga0070692_10175896 | 3300005345 | Bacteria | 1237 |
| 54 | Ga0070668_100039525 | 3300005347 | Bacteria | 3607 |
| 55 | Ga0070668_100178090 | 3300005347 | Bacteria | 1735 |
| 56 | Ga0070668_100360993 | 3300005347 | Bacteria | 1232 |
| 57 | Ga0070669_100000029 | 3300005353 | Bacteria | 163005 |
| 58 | Ga0070669_100000074 | 3300005353 | Bacteria | 99054 |
| 59 | Ga0070669_100000131 | 3300005353 | Bacteria | 68114 |
| 60 | Ga0070669_100000280 | 3300005353 | Bacteria | 40554 |
| 61 | Ga0070669_100008611 | 3300005353 | Bacteria | 7280 |
| 62 | Ga0070669_100291997 | 3300005353 | Bacteria | 1309 |
| 63 | Ga0070669_100470863 | 3300005353 | Bacteria | 1038 |
| 64 | Ga0070671_100000005 | 3300005355 | Bacteria | 256547 |
| 65 | Ga0070671_100000016 | 3300005355 | Bacteria | 156166 |
| 66 | Ga0070671_100000375 | 3300005355 | Bacteria | 30813 |
| 67 | Ga0070671_100015960 | 3300005355 | Bacteria | 6068 |
| 68 | Ga0070671_100291002 | 3300005355 | Bacteria | 1390 |
| 69 | Ga0070671_100412615 | 3300005355 | Bacteria | 1156 |
| 70 | Ga0070688_100001817 | 3300005365 | Bacteria | 10703 |
| 71 | Ga0070659_100039475 | 3300005366 | Bacteria | 3685 |
| 72 | Ga0070667_100000131 | 3300005367 | Bacteria | 94986 |
| 73 | Ga0070667_100000513 | 3300005367 | Bacteria | 39042 |
| 74 | Ga0070667_100001796 | 3300005367 | Bacteria | 19107 |
| 75 | Ga0070667_100004694 | 3300005367 | Bacteria | 11465 |
| 76 | Ga0070667_100086305 | 3300005367 | Bacteria | 2692 |
| 77 | Ga0070667_100093007 | 3300005367 | Bacteria | 2596 |
| 78 | Ga0070667_100145492 | 3300005367 | Bacteria | 2078 |
| 79 | Ga0070705_101229347 | 3300005440 | Bacteria | 618 |
| 80 | Ga0070708_100348132 | 3300005445 | Bacteria | 1396 |
| 81 | Ga0070663_101619535 | 3300005455 | Bacteria | 577 |
| 82 | Ga0070678_100126175 | 3300005456 | Bacteria | 2026 |
| 83 | Ga0070662_100007379 | 3300005457 | Bacteria | 7124 |
| 84 | Ga0070662_100011103 | 3300005457 | Bacteria | 5930 |
| 85 | Ga0070662_100044182 | 3300005457 | Bacteria | 3190 |
| 86 | Ga0070662_100107279 | 3300005457 | Bacteria | 2123 |
| 87 | Ga0070681_10003398 | 3300005458 | Bacteria | 14901 |
| 88 | Ga0070685_10007591 | 3300005466 | Bacteria | 5547 |
| 89 | Ga0070685_10086499 | 3300005466 | Bacteria | 1890 |
| 90 | Ga0070707_100124009 | 3300005468 | Bacteria | 2509 |
| 91 | Ga0070707_100863848 | 3300005468 | Bacteria | 869 |
| 92 | Ga0070679_100007479 | 3300005530 | Bacteria | 10213 |
| 93 | Ga0070679_100120493 | 3300005530 | Bacteria | 2608 |
| 94 | Ga0070679_100150339 | 3300005530 | Bacteria | 2305 |
| 95 | Ga0070679_101651250 | 3300005530 | Bacteria | 588 |
| 96 | Ga0070684_100203640 | 3300005535 | Bacteria | 1803 |
| 97 | Ga0070684_100395541 | 3300005535 | Bacteria | 1274 |
| 98 | Ga0068853_100040907 | 3300005539 | Bacteria | 3957 |
| 99 | Ga0068853_100133003 | 3300005539 | Bacteria | 2228 |
| 100 | Ga0068853_100462054 | 3300005539 | Bacteria | 1195 |
| 101 | Ga0068853_100560360 | 3300005539 | Bacteria | 1083 |
| 102 | Ga0068853_100843839 | 3300005539 | Bacteria | 878 |
| 103 | Ga0070686_100000035 | 3300005544 | Bacteria | 108191 |
| 104 | Ga0070686_100014214 | 3300005544 | Bacteria | 4583 |
| 105 | Ga0070665_100000161 | 3300005548 | Bacteria | 122088 |
| 106 | Ga0070665_100001089 | 3300005548 | Bacteria | 33704 |
| 107 | Ga0070665_100005502 | 3300005548 | Bacteria | 13039 |
| 108 | Ga0070665_100149673 | 3300005548 | Bacteria | 2337 |
| 109 | Ga0070665_100635539 | 3300005548 | Bacteria | 1080 |
| 110 | Ga0070665_100966929 | 3300005548 | Bacteria | 864 |
| 111 | Ga0068855_100000644 | 3300005563 | Bacteria | 42733 |
| 112 | Ga0068855_100005378 | 3300005563 | Bacteria | 15619 |
| 113 | Ga0068855_100007675 | 3300005563 | Bacteria | 13033 |
| 114 | Ga0068855_100069885 | 3300005563 | Bacteria | 4086 |
| 115 | Ga0068855_100137624 | 3300005563 | Bacteria | 2785 |
| 116 | Ga0068855_100273237 | 3300005563 | Bacteria | 1879 |
| 117 | Ga0068855_101280560 | 3300005563 | Bacteria | 759 |
| 118 | Ga0070664_100016187 | 3300005564 | Bacteria | 6111 |
| 119 | Ga0070664_100063041 | 3300005564 | Bacteria | 3161 |
| 120 | Ga0068857_100165210 | 3300005577 | Bacteria | 2010 |
| 121 | Ga0068857_100207427 | 3300005577 | Bacteria | 1787 |
| 122 | Ga0068857_100273739 | 3300005577 | Bacteria | 1552 |
| 123 | Ga0068857_101374411 | 3300005577 | Bacteria | 686 |
| 124 | Ga0068854_100014709 | 3300005578 | Bacteria | 5164 |
| 125 | Ga0068854_100033054 | 3300005578 | Bacteria | 3604 |
| 126 | Ga0068854_100053631 | 3300005578 | Bacteria | 2896 |
| 127 | Ga0068854_100306023 | 3300005578 | Bacteria | 1287 |
| 128 | Ga0068854_100909848 | 3300005578 | Bacteria | 774 |
| 129 | Ga0068854_101665757 | 3300005578 | Bacteria | 582 |
| 130 | Ga0068856_100011950 | 3300005614 | Bacteria | 8407 |
| 131 | Ga0068856_100027069 | 3300005614 | Bacteria | 5594 |
| 132 | Ga0068856_100253791 | 3300005614 | Bacteria | 1774 |
| 133 | Ga0068856_101971128 | 3300005614 | Bacteria | 594 |
| 134 | Ga0068852_100000174 | 3300005616 | Bacteria | 43394 |
| 135 | Ga0068852_100050804 | 3300005616 | Bacteria | 3555 |
| 136 | Ga0068852_100462850 | 3300005616 | Bacteria | 1257 |
| 137 | Ga0068852_100464695 | 3300005616 | Bacteria | 1255 |
| 138 | Ga0068852_100928346 | 3300005616 | Bacteria | 888 |
| 139 | Ga0068859_100000110 | 3300005617 | Bacteria | 77515 |
| 140 | Ga0068859_100039049 | 3300005617 | Bacteria | 4761 |
| 141 | Ga0068864_100005229 | 3300005618 | Bacteria | 10639 |
| 142 | Ga0068864_100014687 | 3300005618 | Bacteria | 6505 |
| 143 | Ga0068864_100018960 | 3300005618 | Bacteria | 5752 |
| 144 | Ga0068864_100163743 | 3300005618 | Bacteria | 2023 |
| 145 | Ga0068864_100222879 | 3300005618 | Bacteria | 1740 |
| 146 | Ga0068861_100008987 | 3300005719 | Bacteria | 6887 |
| 147 | Ga0068861_100021448 | 3300005719 | Bacteria | 4642 |
| 148 | Ga0068851_10183448 | 3300005834 | Bacteria | 1160 |
| 149 | Ga0068863_100000060 | 3300005841 | Bacteria | 122123 |
| 150 | Ga0068863_100000466 | 3300005841 | Bacteria | 41328 |
| 151 | Ga0068863_100013913 | 3300005841 | Bacteria | 7758 |
| 152 | Ga0068863_100019211 | 3300005841 | Bacteria | 6540 |
| 153 | Ga0068863_100041563 | 3300005841 | Bacteria | 4372 |
| 154 | Ga0068863_101380064 | 3300005841 | Bacteria | 712 |
| 155 | Ga0068858_100002514 | 3300005842 | Bacteria | 18483 |
| 156 | Ga0068858_100007941 | 3300005842 | Bacteria | 10226 |
| 157 | Ga0068858_100009946 | 3300005842 | Bacteria | 9036 |
| 158 | Ga0068858_100060889 | 3300005842 | Bacteria | 3489 |
| 159 | Ga0068860_100000013 | 3300005843 | Bacteria | 323055 |
| 160 | Ga0068860_100000126 | 3300005843 | Bacteria | 122923 |
| 161 | Ga0068860_100000473 | 3300005843 | Bacteria | 49993 |
| 162 | Ga0068860_100006579 | 3300005843 | Bacteria | 11669 |
| 163 | Ga0068860_100023043 | 3300005843 | Bacteria | 6022 |
| 164 | Ga0068860_100048221 | 3300005843 | Bacteria | 4059 |
| 165 | Ga0068860_100776938 | 3300005843 | Bacteria | 970 |
| 166 | Ga0068862_100000146 | 3300005844 | Bacteria | 80138 |
| 167 | Ga0068862_100005381 | 3300005844 | Bacteria | 10712 |
| 168 | Ga0068862_100013808 | 3300005844 | Bacteria | 6694 |
| 169 | Ga0068862_100014001 | 3300005844 | Bacteria | 6651 |
| 170 | Ga0068862_100078842 | 3300005844 | Bacteria | 2854 |
| 171 | Ga0068862_100247202 | 3300005844 | Bacteria | 1624 |
| 172 | Ga0068862_102018123 | 3300005844 | Bacteria | 587 |
| 173 | Ga0075365_10001463 | 3300006038 | Bacteria | 10723 |
| 174 | Ga0075368_10000287 | 3300006042 | Bacteria | 14467 |
| 175 | Ga0075363_100000629 | 3300006048 | Bacteria | 11673 |
| 176 | Ga0075363_100000904 | 3300006048 | Bacteria | 10461 |
| 177 | Ga0075364_10002645 | 3300006051 | Bacteria | 10055 |
| 178 | Ga0075364_10055359 | 3300006051 | Bacteria | 2595 |
| 179 | Ga0075364_10151124 | 3300006051 | Bacteria | 1565 |
| 180 | Ga0075364_10334942 | 3300006051 | Bacteria | 1031 |
| 181 | Ga0075432_10000636 | 3300006058 | Bacteria | 10713 |
| 182 | Ga0075362_10000043 | 3300006177 | Bacteria | 44587 |
| 183 | Ga0075362_10001875 | 3300006177 | Bacteria | 6889 |
| 184 | Ga0075362_10095994 | 3300006177 | Bacteria | 1381 |
| 185 | Ga0075362_10157457 | 3300006177 | Bacteria | 1092 |
| 186 | Ga0075367_10000871 | 3300006178 | Bacteria | 12080 |
| 187 | Ga0075367_10255167 | 3300006178 | Bacteria | 1100 |
| 188 | Ga0075367_10863251 | 3300006178 | Bacteria | 577 |
| 189 | Ga0075366_10000830 | 3300006195 | Bacteria | 14848 |
| 190 | Ga0075366_10079432 | 3300006195 | Bacteria | 1958 |
| 191 | Ga0075366_10087476 | 3300006195 | Bacteria | 1865 |
| 192 | Ga0075366_10628441 | 3300006195 | Bacteria | 666 |
| 193 | Ga0075370_10000002 | 3300006353 | Bacteria | 142637 |
| 194 | Ga0075370_10009387 | 3300006353 | Bacteria | 5077 |
| 195 | Ga0075370_10017854 | 3300006353 | Bacteria | 3839 |
| 196 | Ga0075370_10055104 | 3300006353 | Bacteria | 2259 |
| 197 | Ga0075370_10056327 | 3300006353 | Bacteria | 2234 |
| 198 | Ga0075370_10122011 | 3300006353 | Bacteria | 1518 |
| 199 | Ga0075370_10542908 | 3300006353 | Bacteria | 703 |
| 200 | Ga0097620_100000110 | 3300006931 | Bacteria | 77515 |
| 201 | Ga0097620_100039048 | 3300006931 | Bacteria | 4761 |
| 202 | Ga0079104_1031823 | 3300006946 | Bacteria | 1305 |
| 203 | Ga0079104_1046047 | 3300006946 | Bacteria | 993 |
| 204 | Ga0105251_10008372 | 3300009011 | Bacteria | 6235 |
| 205 | Ga0105251_10079527 | 3300009011 | Bacteria | 1517 |
| 206 | Ga0105251_10272905 | 3300009011 | Bacteria | 764 |
| 207 | Ga0105250_10018579 | 3300009092 | Bacteria | 2815 |
| 208 | Ga0105250_10151833 | 3300009092 | Bacteria | 964 |
| 209 | Ga0105250_10171932 | 3300009092 | Bacteria | 907 |
| 210 | Ga0105240_10002147 | 3300009093 | Bacteria | 32213 |
| 211 | Ga0105240_10009965 | 3300009093 | Bacteria | 13394 |
| 212 | Ga0105240_11485371 | 3300009093 | Bacteria | 711 |
| 213 | Ga0111539_11919351 | 3300009094 | Bacteria | 687 |
| 214 | Ga0105247_10010759 | 3300009101 | Bacteria | 5527 |
| 215 | Ga0105247_10038204 | 3300009101 | Bacteria | 2930 |
| 216 | Ga0105247_10487528 | 3300009101 | Bacteria | 896 |
| 217 | Ga0114129_10465210 | 3300009147 | Bacteria | 1657 |
| 218 | Ga0105243_10116855 | 3300009148 | Bacteria | 2241 |
| 219 | Ga0105241_10545035 | 3300009174 | Bacteria | 1041 |
| 220 | Ga0105248_10047334 | 3300009177 | Bacteria | 4822 |
| 221 | Ga0105248_10070601 | 3300009177 | Bacteria | 3922 |
| 222 | Ga0105248_10083705 | 3300009177 | Bacteria | 3588 |
| 223 | Ga0105248_10160999 | 3300009177 | Bacteria | 2531 |
| 224 | Ga0105248_10230722 | 3300009177 | Bacteria | 2084 |
| 225 | Ga0105248_10340473 | 3300009177 | Bacteria | 1689 |
| 226 | Ga0105248_10448293 | 3300009177 | Bacteria | 1454 |
| 227 | Ga0105248_11072170 | 3300009177 | Bacteria | 910 |
| 228 | Ga0105237_10884958 | 3300009545 | Bacteria | 900 |
| 229 | Ga0105237_11315958 | 3300009545 | Bacteria | 729 |
| 230 | Ga0105238_10593923 | 3300009551 | Bacteria | 1115 |
| 231 | Ga0105238_10609350 | 3300009551 | Bacteria | 1100 |
| 232 | Ga0105249_10000094 | 3300009553 | Bacteria | 122611 |
| 233 | Ga0105249_10027171 | 3300009553 | Bacteria | 5162 |
| 234 | Ga0105249_10098910 | 3300009553 | Bacteria | 2741 |
| 235 | Ga0105249_10147326 | 3300009553 | Bacteria | 2263 |
| 236 | Ga0105239_10204978 | 3300010375 | Bacteria | 2210 |
| 237 | Ga0105246_10001552 | 3300011119 | Bacteria | 13642 |
| 238 | Ga0157373_10006736 | 3300013100 | Bacteria | 8552 |
| 239 | Ga0157373_10036270 | 3300013100 | Bacteria | 3540 |
| 240 | Ga0157373_10141677 | 3300013100 | Bacteria | 1691 |
| 241 | Ga0157373_10340324 | 3300013100 | Bacteria | 1069 |
| 242 | Ga0157373_11082072 | 3300013100 | Bacteria | 601 |
| 243 | Ga0157371_10000785 | 3300013102 | Bacteria | 36569 |
| 244 | Ga0157371_10067925 | 3300013102 | Bacteria | 2523 |
| 245 | Ga0157371_10348334 | 3300013102 | Bacteria | 1078 |
| 246 | Ga0157370_10001694 | 3300013104 | Bacteria | 27128 |
| 247 | Ga0157370_10677540 | 3300013104 | Bacteria | 942 |
| 248 | Ga0157369_10012283 | 3300013105 | Bacteria | 9726 |
| 249 | Ga0157369_10026111 | 3300013105 | Bacteria | 6480 |
| 250 | Ga0157369_11635110 | 3300013105 | Bacteria | 655 |
| 251 | Ga0163162_10020604 | 3300013306 | Bacteria | 6479 |
| 252 | Ga0163162_10041921 | 3300013306 | Bacteria | 4580 |
| 253 | Ga0163162_10066747 | 3300013306 | Bacteria | 3647 |
| 254 | Ga0163162_10279919 | 3300013306 | Bacteria | 1800 |
| 255 | Ga0163162_11761576 | 3300013306 | Bacteria | 708 |
| 256 | Ga0157372_10029102 | 3300013307 | Bacteria | 6028 |
| 257 | Ga0157372_10163734 | 3300013307 | Bacteria | 2571 |
| 258 | Ga0157372_10705751 | 3300013307 | Bacteria | 1174 |
| 259 | Ga0157372_11692251 | 3300013307 | Bacteria | 728 |
| 260 | Ga0157375_10144108 | 3300013308 | Bacteria | 2512 |
| 261 | Ga0157375_10179481 | 3300013308 | Bacteria | 2268 |
| 262 | Ga0163163_10349797 | 3300014325 | Bacteria | 1534 |
| 263 | Ga0157380_10007934 | 3300014326 | Bacteria | 7556 |
| 264 | Ga0157380_10104608 | 3300014326 | Bacteria | 2365 |
| 265 | Ga0157380_11425757 | 3300014326 | Bacteria | 744 |
| 266 | Ga0157377_10024862 | 3300014745 | Bacteria | 3188 |
| 267 | Ga0157379_10030612 | 3300014968 | Bacteria | 4792 |
| 268 | Ga0157379_10089610 | 3300014968 | Bacteria | 2759 |
| 269 | Ga0163161_10000195 | 3300017792 | Bacteria | 55605 |
| 270 | Ga0163161_10075125 | 3300017792 | Bacteria | 2480 |
| 271 | Ga0163161_10598175 | 3300017792 | Bacteria | 909 |
| 272 | Ga0163161_10721008 | 3300017792 | Bacteria | 832 |
| 273 | Ga0207672_1001676 | 3300025223 | Bacteria | 1569 |
| 274 | Ga0209050_1000784 | 3300025298 | Bacteria | 45231 |
| 275 | Ga0207697_10000295 | 3300025315 | Bacteria | 27867 |
| 276 | Ga0207697_10115308 | 3300025315 | Bacteria | 1153 |
| 277 | Ga0207697_10307810 | 3300025315 | Bacteria | 703 |
| 278 | Ga0207656_10052395 | 3300025321 | Bacteria | 1767 |
| 279 | Ga0207656_10408355 | 3300025321 | Bacteria | 683 |
| 280 | Ga0207696_1001635 | 3300025711 | Bacteria | 11807 |
| 281 | Ga0207713_1004070 | 3300025735 | Bacteria | 9645 |
| 282 | Ga0207713_1044420 | 3300025735 | Bacteria | 1825 |
| 283 | Ga0207710_10039577 | 3300025900 | Bacteria | 2087 |
| 284 | Ga0207710_10294186 | 3300025900 | Bacteria | 819 |
| 285 | Ga0207680_10000007 | 3300025903 | Bacteria | 623574 |
| 286 | Ga0207680_10001445 | 3300025903 | Bacteria | 11267 |
| 287 | Ga0207680_10038091 | 3300025903 | Bacteria | 2781 |
| 288 | Ga0207680_10280858 | 3300025903 | Bacteria | 1157 |
| 289 | Ga0207680_10420056 | 3300025903 | Bacteria | 947 |
| 290 | Ga0207680_10502387 | 3300025903 | Bacteria | 864 |
| 291 | Ga0207647_10000444 | 3300025904 | Bacteria | 33672 |
| 292 | Ga0207647_10016274 | 3300025904 | Bacteria | 5077 |
| 293 | Ga0207705_10000007 | 3300025909 | Bacteria | 597387 |
| 294 | Ga0207705_10004092 | 3300025909 | Bacteria | 11063 |
| 295 | Ga0207705_10010322 | 3300025909 | Bacteria | 6793 |
| 296 | Ga0207705_10013576 | 3300025909 | Bacteria | 5880 |
| 297 | Ga0207705_10024300 | 3300025909 | Bacteria | 4326 |
| 298 | Ga0207654_10003992 | 3300025911 | Bacteria | 7431 |
| 299 | Ga0207707_10042051 | 3300025912 | Bacteria | 3990 |
| 300 | Ga0207707_11521785 | 3300025912 | Bacteria | 529 |
| 301 | Ga0207695_10001471 | 3300025913 | Bacteria | 39463 |
| 302 | Ga0207695_10126665 | 3300025913 | Bacteria | 2515 |
| 303 | Ga0207695_10399106 | 3300025913 | Bacteria | 1260 |
| 304 | Ga0207671_10000457 | 3300025914 | Bacteria | 56223 |
| 305 | Ga0207671_10260172 | 3300025914 | Bacteria | 1366 |
| 306 | Ga0207660_10089817 | 3300025917 | Bacteria | 2275 |
| 307 | Ga0207660_10097427 | 3300025917 | Bacteria | 2191 |
| 308 | Ga0207657_10000156 | 3300025919 | Bacteria | 69892 |
| 309 | Ga0207657_10105319 | 3300025919 | Bacteria | 2335 |
| 310 | Ga0207649_10049011 | 3300025920 | Bacteria | 2607 |
| 311 | Ga0207649_10492548 | 3300025920 | Bacteria | 931 |
| 312 | Ga0207652_10029192 | 3300025921 | Bacteria | 4608 |
| 313 | Ga0207652_10043930 | 3300025921 | Bacteria | 3806 |
| 314 | Ga0207652_10063665 | 3300025921 | Bacteria | 3190 |
| 315 | Ga0207652_10232045 | 3300025921 | Bacteria | 1663 |
| 316 | Ga0207652_10987242 | 3300025921 | Bacteria | 741 |
| 317 | Ga0207652_11156991 | 3300025921 | Bacteria | 675 |
| 318 | Ga0207646_10129915 | 3300025922 | Bacteria | 2267 |
| 319 | Ga0207646_10731553 | 3300025922 | Bacteria | 884 |
| 320 | Ga0207681_10000040 | 3300025923 | Bacteria | 147547 |
| 321 | Ga0207681_10000053 | 3300025923 | Bacteria | 110626 |
| 322 | Ga0207681_10000096 | 3300025923 | Bacteria | 74995 |
| 323 | Ga0207681_10000120 | 3300025923 | Bacteria | 66235 |
| 324 | Ga0207681_10002113 | 3300025923 | Bacteria | 12733 |
| 325 | Ga0207681_10037734 | 3300025923 | Bacteria | 3196 |
| 326 | Ga0207681_10409780 | 3300025923 | Bacteria | 1096 |
| 327 | Ga0207694_10088716 | 3300025924 | Bacteria | 2438 |
| 328 | Ga0207694_10274535 | 3300025924 | Bacteria | 1383 |
| 329 | Ga0207694_10345887 | 3300025924 | Bacteria | 1230 |
| 330 | Ga0207650_10007453 | 3300025925 | Bacteria | 7458 |
| 331 | Ga0207650_10050238 | 3300025925 | Bacteria | 3083 |
| 332 | Ga0207650_10120978 | 3300025925 | Bacteria | 2038 |
| 333 | Ga0207650_10855037 | 3300025925 | Bacteria | 772 |
| 334 | Ga0207644_10000008 | 3300025931 | Bacteria | 354219 |
| 335 | Ga0207644_10000023 | 3300025931 | Bacteria | 156180 |
| 336 | Ga0207644_10002058 | 3300025931 | Bacteria | 13020 |
| 337 | Ga0207644_10015656 | 3300025931 | Bacteria | 5094 |
| 338 | Ga0207644_10024648 | 3300025931 | Bacteria | 4131 |
| 339 | Ga0207644_10381592 | 3300025931 | Bacteria | 1149 |
| 340 | Ga0207690_10010558 | 3300025932 | Bacteria | 5495 |
| 341 | Ga0207690_10041541 | 3300025932 | Bacteria | 3014 |
| 342 | Ga0207690_10712426 | 3300025932 | Bacteria | 826 |
| 343 | Ga0207690_10782312 | 3300025932 | Bacteria | 788 |
| 344 | Ga0207706_10001803 | 3300025933 | Bacteria | 21030 |
| 345 | Ga0207706_10012286 | 3300025933 | Bacteria | 7803 |
| 346 | Ga0207706_10072887 | 3300025933 | Bacteria | 3020 |
| 347 | Ga0207706_10978789 | 3300025933 | Bacteria | 712 |
| 348 | Ga0207670_10011560 | 3300025936 | Bacteria | 5130 |
| 349 | Ga0207711_10012882 | 3300025941 | Bacteria | 6947 |
| 350 | Ga0207711_10124221 | 3300025941 | Bacteria | 2307 |
| 351 | Ga0207711_10138634 | 3300025941 | Bacteria | 2187 |
| 352 | Ga0207711_10155432 | 3300025941 | Bacteria | 2067 |
| 353 | Ga0207711_10161377 | 3300025941 | Bacteria | 2029 |
| 354 | Ga0207711_11159970 | 3300025941 | Bacteria | 714 |
| 355 | Ga0207711_11398261 | 3300025941 | Bacteria | 642 |
| 356 | Ga0207661_10025722 | 3300025944 | Bacteria | 4478 |
| 357 | Ga0207661_10432261 | 3300025944 | Bacteria | 1197 |
| 358 | Ga0207679_10050397 | 3300025945 | Bacteria | 3042 |
| 359 | Ga0207679_10681731 | 3300025945 | Bacteria | 931 |
| 360 | Ga0207667_10001801 | 3300025949 | Bacteria | 26994 |
| 361 | Ga0207667_10002631 | 3300025949 | Bacteria | 22203 |
| 362 | Ga0207667_10008785 | 3300025949 | Bacteria | 11963 |
| 363 | Ga0207667_10056598 | 3300025949 | Bacteria | 4119 |
| 364 | Ga0207667_10102292 | 3300025949 | Bacteria | 2956 |
| 365 | Ga0207667_10191554 | 3300025949 | Bacteria | 2098 |
| 366 | Ga0207667_10246079 | 3300025949 | Bacteria | 1830 |
| 367 | Ga0207667_10352524 | 3300025949 | Bacteria | 1501 |
| 368 | Ga0207667_10533107 | 3300025949 | Bacteria | 1189 |
| 369 | Ga0207667_11140759 | 3300025949 | Bacteria | 761 |
| 370 | Ga0207667_11406901 | 3300025949 | Bacteria | 671 |
| 371 | Ga0207712_10000004 | 3300025961 | Bacteria | 614655 |
| 372 | Ga0207712_10007583 | 3300025961 | Bacteria | 6856 |
| 373 | Ga0207712_10156973 | 3300025961 | Bacteria | 1763 |
| 374 | Ga0207668_10028040 | 3300025972 | Bacteria | 3676 |
| 375 | Ga0207668_10053416 | 3300025972 | Bacteria | 2800 |
| 376 | Ga0207668_10054318 | 3300025972 | Bacteria | 2780 |
| 377 | Ga0207668_10058897 | 3300025972 | Bacteria | 2687 |
| 378 | Ga0207668_10182480 | 3300025972 | Bacteria | 1657 |
| 379 | Ga0207668_10906167 | 3300025972 | Bacteria | 785 |
| 380 | Ga0207640_10002520 | 3300025981 | Bacteria | 9822 |
| 381 | Ga0207640_10006942 | 3300025981 | Bacteria | 6229 |
| 382 | Ga0207640_10035619 | 3300025981 | Bacteria | 3116 |
| 383 | Ga0207640_10295914 | 3300025981 | Bacteria | 1278 |
| 384 | Ga0207658_10000067 | 3300025986 | Bacteria | 116584 |
| 385 | Ga0207658_10000288 | 3300025986 | Bacteria | 52709 |
| 386 | Ga0207658_10001126 | 3300025986 | Bacteria | 21549 |
| 387 | Ga0207658_10001427 | 3300025986 | Bacteria | 18634 |
| 388 | Ga0207658_10003756 | 3300025986 | Bacteria | 10693 |
| 389 | Ga0207658_10275454 | 3300025986 | Bacteria | 1440 |
| 390 | Ga0207658_10658224 | 3300025986 | Bacteria | 944 |
| 391 | Ga0207658_11224592 | 3300025986 | Bacteria | 686 |
| 392 | Ga0207703_10001553 | 3300026035 | Bacteria | 20823 |
| 393 | Ga0207703_10002077 | 3300026035 | Bacteria | 17605 |
| 394 | Ga0207703_10003308 | 3300026035 | Bacteria | 13528 |
| 395 | Ga0207703_10045631 | 3300026035 | Bacteria | 3526 |
| 396 | Ga0207703_10077839 | 3300026035 | Bacteria | 2754 |
| 397 | Ga0207639_10001184 | 3300026041 | Bacteria | 17717 |
| 398 | Ga0207639_10200615 | 3300026041 | Bacteria | 1711 |
| 399 | Ga0207639_10280397 | 3300026041 | Bacteria | 1465 |
| 400 | Ga0207639_10442825 | 3300026041 | Bacteria | 1178 |
| 401 | Ga0207639_10474822 | 3300026041 | Bacteria | 1139 |
| 402 | Ga0207639_11268134 | 3300026041 | Bacteria | 692 |
| 403 | Ga0207678_10007056 | 3300026067 | Bacteria | 9976 |
| 404 | Ga0207678_10099517 | 3300026067 | Bacteria | 2484 |
| 405 | Ga0207678_10143527 | 3300026067 | Bacteria | 2038 |
| 406 | Ga0207678_10194657 | 3300026067 | Bacteria | 1733 |
| 407 | Ga0207702_10011176 | 3300026078 | Bacteria | 7488 |
| 408 | Ga0207702_10111922 | 3300026078 | Bacteria | 2429 |
| 409 | Ga0207702_10235282 | 3300026078 | Bacteria | 1714 |
| 410 | Ga0207702_10464183 | 3300026078 | Bacteria | 1230 |
| 411 | Ga0207702_10894557 | 3300026078 | Bacteria | 880 |
| 412 | Ga0207641_10000098 | 3300026088 | Bacteria | 123514 |
| 413 | Ga0207641_10000100 | 3300026088 | Bacteria | 122664 |
| 414 | Ga0207641_10007053 | 3300026088 | Bacteria | 9388 |
| 415 | Ga0207641_10029943 | 3300026088 | Bacteria | 4503 |
| 416 | Ga0207641_10083615 | 3300026088 | Bacteria | 2776 |
| 417 | Ga0207676_10000888 | 3300026095 | Bacteria | 23213 |
| 418 | Ga0207676_10004838 | 3300026095 | Bacteria | 9546 |
| 419 | Ga0207676_10026680 | 3300026095 | Bacteria | 4297 |
| 420 | Ga0207676_10141458 | 3300026095 | Bacteria | 2060 |
| 421 | Ga0207676_10483568 | 3300026095 | Bacteria | 1173 |
| 422 | Ga0207674_10009464 | 3300026116 | Bacteria | 11130 |
| 423 | Ga0207674_10045876 | 3300026116 | Bacteria | 4492 |
| 424 | Ga0207674_10049173 | 3300026116 | Bacteria | 4314 |
| 425 | Ga0207674_10056465 | 3300026116 | Bacteria | 3987 |
| 426 | Ga0207674_10135300 | 3300026116 | Bacteria | 2426 |
| 427 | Ga0207674_11717693 | 3300026116 | Bacteria | 596 |
| 428 | Ga0207675_100001359 | 3300026118 | Bacteria | 24514 |
| 429 | Ga0207675_100002120 | 3300026118 | Bacteria | 19658 |
| 430 | Ga0207683_10248083 | 3300026121 | Bacteria | 1624 |
| 431 | Ga0207698_10000098 | 3300026142 | Bacteria | 55118 |
| 432 | Ga0207698_10038950 | 3300026142 | Bacteria | 3517 |
| 433 | Ga0207698_10054747 | 3300026142 | Bacteria | 3071 |
| 434 | Ga0207698_10115306 | 3300026142 | Bacteria | 2262 |
| 435 | Ga0207698_10397518 | 3300026142 | Bacteria | 1316 |
| 436 | Ga0207698_11417413 | 3300026142 | Bacteria | 710 |
| 437 | Ga0209983_1028317 | 3300027665 | Bacteria | 1188 |
| 438 | Ga0209813_10000027 | 3300027866 | Bacteria | 69637 |
| 439 | Ga0207428_10021045 | 3300027907 | Bacteria | 5528 |
| 440 | Ga0268266_10000040 | 3300028379 | Bacteria | 323843 |
| 441 | Ga0268266_10002543 | 3300028379 | Bacteria | 19369 |
| 442 | Ga0268266_10008044 | 3300028379 | Bacteria | 9424 |
| 443 | Ga0268266_10269197 | 3300028379 | Bacteria | 1581 |
| 444 | Ga0268266_10300856 | 3300028379 | Bacteria | 1496 |
| 445 | Ga0268266_10569806 | 3300028379 | Bacteria | 1086 |
| 446 | Ga0268266_10583339 | 3300028379 | Bacteria | 1073 |
| 447 | Ga0268265_10000098 | 3300028380 | Bacteria | 110108 |
| 448 | Ga0268265_10000128 | 3300028380 | Bacteria | 96118 |
| 449 | Ga0268265_10003510 | 3300028380 | Bacteria | 11222 |
| 450 | Ga0268265_10005291 | 3300028380 | Bacteria | 8839 |
| 451 | Ga0268265_10262033 | 3300028380 | Bacteria | 1537 |
| 452 | Ga0268264_10000003 | 3300028381 | Bacteria | 1141976 |
| 453 | Ga0268264_10000039 | 3300028381 | Bacteria | 376641 |
| 454 | Ga0268264_10000141 | 3300028381 | Bacteria | 170966 |
| 455 | Ga0268264_10000224 | 3300028381 | Bacteria | 110355 |
| 456 | Ga0268264_10001883 | 3300028381 | Bacteria | 19050 |
| 457 | Ga0268264_10004589 | 3300028381 | Bacteria | 11744 |
| 458 | Ga0268264_10015428 | 3300028381 | Bacteria | 6265 |
| 459 | Ga0268264_10036868 | 3300028381 | Bacteria | 4029 |
| 460 | Ga0268264_10229401 | 3300028381 | Bacteria | 1714 |
| 461 | Ga0265338_10408599 | 3300028800 | Bacteria | 967 |
| 462 | Ga0316177_1166439 | 3300030731 | Bacteria | 2112 |
| 463 | Ga0307408_100086591 | 3300031548 | Bacteria | 2355 |
| 464 | Ga0307408_100205143 | 3300031548 | Bacteria | 1598 |
| 465 | Ga0307408_100411890 | 3300031548 | Bacteria | 1163 |
| 466 | Ga0307408_100733634 | 3300031548 | Bacteria | 891 |
| 467 | Ga0307408_101257004 | 3300031548 | Bacteria | 692 |
| 468 | Ga0307508_10071375 | 3300031616 | Bacteria | 3046 |
| 469 | Ga0316579_10032772 | 3300031691 | Bacteria | 2384 |
| 470 | Ga0307516_10248583 | 3300031730 | Bacteria | 1474 |
| 471 | Ga0307405_10042472 | 3300031731 | Bacteria | 2768 |
| 472 | Ga0307405_10272817 | 3300031731 | Bacteria | 1269 |
| 473 | Ga0307405_10528624 | 3300031731 | Bacteria | 950 |
| 474 | Ga0307405_10678243 | 3300031731 | Bacteria | 851 |
| 475 | Ga0307405_10745876 | 3300031731 | Bacteria | 815 |
| 476 | Ga0307405_10990585 | 3300031731 | Bacteria | 716 |
| 477 | Ga0307405_11006616 | 3300031731 | Bacteria | 711 |
| 478 | Ga0307413_10083154 | 3300031824 | Bacteria | 2059 |
| 479 | Ga0307413_10192233 | 3300031824 | Bacteria | 1466 |
| 480 | Ga0307413_10574760 | 3300031824 | Bacteria | 918 |
| 481 | Ga0307413_11024435 | 3300031824 | Bacteria | 709 |
| 482 | Ga0307413_11785523 | 3300031824 | Bacteria | 550 |
| 483 | Ga0307410_10021352 | 3300031852 | Bacteria | 3981 |
| 484 | Ga0307410_10057042 | 3300031852 | Bacteria | 2658 |
| 485 | Ga0307410_10096543 | 3300031852 | Bacteria | 2110 |
| 486 | Ga0307410_10224031 | 3300031852 | Bacteria | 1448 |
| 487 | Ga0307410_10447841 | 3300031852 | Bacteria | 1053 |
| 488 | Ga0307406_10232225 | 3300031901 | Bacteria | 1378 |
| 489 | Ga0307406_10340071 | 3300031901 | Bacteria | 1168 |
| 490 | Ga0307406_10530060 | 3300031901 | Bacteria | 960 |
| 491 | Ga0307406_10847221 | 3300031901 | Bacteria | 775 |
| 492 | Ga0307406_11477273 | 3300031901 | Bacteria | 598 |
| 493 | Ga0307407_10801921 | 3300031903 | Bacteria | 716 |
| 494 | Ga0307412_10000920 | 3300031911 | Bacteria | 16793 |
| 495 | Ga0307412_10059169 | 3300031911 | Bacteria | 2566 |
| 496 | Ga0307412_10083969 | 3300031911 | Bacteria | 2210 |
| 497 | Ga0307412_10085215 | 3300031911 | Bacteria | 2195 |
| 498 | Ga0307412_10092189 | 3300031911 | Bacteria | 2122 |
| 499 | Ga0307412_10123237 | 3300031911 | Bacteria | 1870 |
| 500 | Ga0307412_10194206 | 3300031911 | Bacteria | 1537 |
| 501 | Ga0307412_10224887 | 3300031911 | Bacteria | 1441 |
| 502 | Ga0307412_10311846 | 3300031911 | Bacteria | 1248 |
| 503 | Ga0307412_10501556 | 3300031911 | Bacteria | 1010 |
| 504 | Ga0307412_10877422 | 3300031911 | Bacteria | 784 |
| 505 | Ga0307412_11098409 | 3300031911 | Bacteria | 708 |
| 506 | Ga0307409_100313437 | 3300031995 | Bacteria | 1465 |
| 507 | Ga0307409_101108572 | 3300031995 | Bacteria | 813 |
| 508 | Ga0307416_100037322 | 3300032002 | Bacteria | 3737 |
| 509 | Ga0307416_100072969 | 3300032002 | Bacteria | 2859 |
| 510 | Ga0307416_100208837 | 3300032002 | Bacteria | 1860 |
| 511 | Ga0307416_100374546 | 3300032002 | Bacteria | 1451 |
| 512 | Ga0307416_101144883 | 3300032002 | Bacteria | 883 |
| 513 | Ga0307414_10007116 | 3300032004 | Bacteria | 6278 |
| 514 | Ga0307414_10020591 | 3300032004 | Bacteria | 4115 |
| 515 | Ga0307414_10028547 | 3300032004 | Bacteria | 3621 |
| 516 | Ga0307414_10130503 | 3300032004 | Bacteria | 1950 |
| 517 | Ga0307414_10146234 | 3300032004 | Bacteria | 1857 |
| 518 | Ga0307414_10178431 | 3300032004 | Bacteria | 1706 |
| 519 | Ga0307414_10357598 | 3300032004 | Bacteria | 1255 |
| 520 | Ga0307414_10718681 | 3300032004 | Bacteria | 906 |
| 521 | Ga0307414_10792965 | 3300032004 | Bacteria | 863 |
| 522 | Ga0307414_11104324 | 3300032004 | Bacteria | 732 |
| 523 | Ga0307411_10074536 | 3300032005 | Bacteria | 2313 |
| 524 | Ga0307411_10081800 | 3300032005 | Bacteria | 2225 |
| 525 | Ga0307411_10217148 | 3300032005 | Bacteria | 1481 |
| 526 | Ga0307411_10301996 | 3300032005 | Bacteria | 1284 |
| 527 | Ga0307411_10564030 | 3300032005 | Bacteria | 973 |
| 528 | Ga0307411_10687932 | 3300032005 | Bacteria | 889 |
| 529 | Ga0307415_100061896 | 3300032126 | Bacteria | 2593 |
| 530 | Ga0316583_10004401 | 3300032133 | Bacteria | 5023 |
| 531 | Ga0316583_10219490 | 3300032133 | Bacteria | 659 |
| 532 | Ga0373932_0096501 | 3300035112 | Bacteria | 956 |
| 533 | Ga0373960_0078111 | 3300035121 | Bacteria | 1037 |
| 534 | Ga0316582_0000131 | 3300036647 | Bacteria | 21779 |
| 535 | Ga0316582_0114254 | 3300036647 | Bacteria | 1801 |
| 536 | Ga0316584_0291270 | 3300036712 | Bacteria | 1184 |
| 537 | Ga0451841_0878360 | 3300041498 | Bacteria | 1296 |
| 538 | Ga0451853_0636233 | 3300041512 | Bacteria | 707 |
| 539 | Ga0439431_0086077 | 3300041997 | Bacteria | 852 |
| 540 | Ga0439462_0012070 | 3300042015 | Bacteria | 2204 |
| 541 | Ga0439435_0031583 | 3300042436 | Bacteria | 1441 |
| 542 | Ga0453684_0267103 | 3300044712 | Bacteria | 1957 |
| 543 | Ga0451576_0000017 | 3300045051 | Bacteria | 558261 |
| 544 | Ga0495638_0082949 | 3300046460 | Bacteria | 1943 |
| 545 | Ga0495638_0217303 | 3300046460 | Bacteria | 1070 |
| 546 | Ga0495650_0075932 | 3300046471 | Bacteria | 1307 |
| 547 | Ga0495606_0196315 | 3300046507 | Bacteria | 1153 |
| 548 | Ga0495610_0012788 | 3300046512 | Bacteria | 5023 |
| 549 | Ga0495610_0305485 | 3300046512 | Bacteria | 612 |
| 550 | Ga0495616_0000153 | 3300046513 | Bacteria | 60398 |
| 551 | Ga0495632_0285947 | 3300046519 | Bacteria | 733 |
| 552 | Ga0495643_0010451 | 3300046522 | Bacteria | 5713 |
| 553 | Ga0495643_0097153 | 3300046522 | Bacteria | 1514 |
| 554 | Ga0495644_0155054 | 3300046523 | Bacteria | 877 |
| 555 | Ga0495648_0085235 | 3300046524 | Bacteria | 1785 |
| 556 | Ga0495654_0073172 | 3300046530 | Bacteria | 1621 |
| 557 | Ga0495668_0125585 | 3300046616 | Bacteria | 1404 |
| 558 | Ga0495668_0147719 | 3300046616 | Bacteria | 1287 |
| 559 | Ga0495625_0216745 | 3300046660 | Bacteria | 1256 |
| 560 | Ga0495687_063236 | 3300047443 | Bacteria | 1516 |
| 561 | Ga0495615_0000103 | 3300048090 | Bacteria | 23149 |
| 562 | Ga0495626_0001180 | 3300048091 | Bacteria | 21706 |
| 563 | Ga0496100_0018122 | 3300048903 | Bacteria | 4171 |
| 564 | Ga0496100_0199152 | 3300048903 | Bacteria | 1458 |
| 565 | Ga0496101_0072682 | 3300048904 | Bacteria | 2525 |
| 566 | Ga0496101_0103428 | 3300048904 | Bacteria | 2134 |
| 567 | Ga0496101_0107562 | 3300048904 | Bacteria | 2095 |
| 568 | Ga0496102_0000209 | 3300048905 | Bacteria | 78525 |
| 569 | Ga0496102_0003512 | 3300048905 | Bacteria | 13282 |
| 570 | Ga0496102_0055768 | 3300048905 | Bacteria | 3603 |
| 571 | Ga0496102_0315077 | 3300048905 | Bacteria | 1474 |
| 572 | Ga0496103_0000136 | 3300048906 | Bacteria | 76530 |
| 573 | Ga0496103_0000372 | 3300048906 | Bacteria | 40272 |
| 574 | Ga0496103_0002395 | 3300048906 | Bacteria | 11807 |
| 575 | Ga0496103_0016230 | 3300048906 | Bacteria | 4444 |
| 576 | Ga0496103_0045736 | 3300048906 | Bacteria | 2701 |
| 577 | Ga0496103_0459819 | 3300048906 | Bacteria | 816 |
| 578 | Ga0496104_0142986 | 3300048907 | Bacteria | 2298 |
| 579 | Ga0496104_0229837 | 3300048907 | Bacteria | 1767 |
| 580 | Ga0496105_0006268 | 3300048908 | Bacteria | 9135 |
| 581 | Ga0496105_0009539 | 3300048908 | Bacteria | 7596 |
| 582 | Ga0496105_0040280 | 3300048908 | Bacteria | 3851 |
| 583 | Ga0496105_0203153 | 3300048908 | Bacteria | 1617 |
| 584 | Ga0496105_0302663 | 3300048908 | Bacteria | 1285 |
| 585 | Ga0496105_0319403 | 3300048908 | Bacteria | 1245 |
| 586 | Ga0496105_0426175 | 3300048908 | Bacteria | 1050 |
| 587 | Ga0496106_0004392 | 3300048909 | Bacteria | 10469 |
| 588 | Ga0496106_0270315 | 3300048909 | Bacteria | 1361 |
| 589 | Ga0496107_0005831 | 3300048910 | Bacteria | 8432 |
| 590 | Ga0496107_0483281 | 3300048910 | Bacteria | 919 |
| 591 | Ga0496108_0268966 | 3300048911 | Bacteria | 1483 |
| 592 | Ga0496109_0518126 | 3300048912 | Bacteria | 1125 |
| 593 | Ga0496110_0108760 | 3300048913 | Bacteria | 2489 |
| 594 | Ga0496112_0507864 | 3300048915 | Bacteria | 1140 |
| 595 | Ga0496113_0001214 | 3300048916 | Bacteria | 14127 |
| 596 | Ga0496113_0170703 | 3300048916 | Bacteria | 1722 |
| 597 | Ga0496114_0073823 | 3300048917 | Bacteria | 2871 |
| 598 | Ga0496115_0073073 | 3300048918 | Bacteria | 2783 |
| 599 | Ga0496116_0000149 | 3300048919 | Bacteria | 141841 |
| 600 | Ga0496116_0006619 | 3300048919 | Bacteria | 10476 |
| 601 | Ga0496116_0008522 | 3300048919 | Bacteria | 8884 |
| 602 | Ga0496116_0020693 | 3300048919 | Bacteria | 4988 |
| 603 | Ga0496117_0000526 | 3300048920 | Bacteria | 63085 |
| 604 | Ga0496117_0002288 | 3300048920 | Bacteria | 24709 |
| 605 | Ga0496117_0010660 | 3300048920 | Bacteria | 8331 |
| 606 | Ga0496117_0089427 | 3300048920 | Bacteria | 1989 |
| 607 | Ga0496118_0000097 | 3300048921 | Bacteria | 160837 |
| 608 | Ga0496118_0003002 | 3300048921 | Bacteria | 21794 |
| 609 | Ga0496118_0014990 | 3300048921 | Bacteria | 7210 |
| 610 | Ga0496118_0023491 | 3300048921 | Bacteria | 5352 |
| 611 | Ga0496118_0040884 | 3300048921 | Bacteria | 3679 |
| 612 | Ga0496119_0015446 | 3300048922 | Bacteria | 5876 |
| 613 | Ga0496119_0023742 | 3300048922 | Bacteria | 4337 |
| 614 | Ga0496119_0026561 | 3300048922 | Bacteria | 4011 |
| 615 | Ga0496120_0054075 | 3300048923 | Bacteria | 2278 |
| 616 | Ga0496120_0062436 | 3300048923 | Bacteria | 2076 |
| 617 | Ga0496120_0096447 | 3300048923 | Bacteria | 1570 |
| 618 | Ga0496121_0000024 | 3300048924 | Bacteria | 462959 |
| 619 | Ga0496121_0001586 | 3300048924 | Bacteria | 37825 |
| 620 | Ga0496121_0002667 | 3300048924 | Bacteria | 26743 |
| 621 | Ga0496121_0059551 | 3300048924 | Bacteria | 3147 |
| 622 | Ga0496122_0016758 | 3300048925 | Bacteria | 6904 |
| 623 | Ga0496122_0026317 | 3300048925 | Bacteria | 5019 |
| 624 | Ga0496123_0002495 | 3300048926 | Bacteria | 22695 |
| 625 | Ga0496123_0003182 | 3300048926 | Bacteria | 18742 |
| 626 | Ga0496124_0001077 | 3300048927 | Bacteria | 43137 |
| 627 | Ga0496124_0005279 | 3300048927 | Bacteria | 14616 |
| 628 | Ga0496124_0006606 | 3300048927 | Bacteria | 12593 |
| 629 | Ga0496124_0025322 | 3300048927 | Bacteria | 5375 |
| 630 | Ga0496124_0322015 | 3300048927 | Bacteria | 1106 |
| 631 | Ga0496124_0368197 | 3300048927 | Bacteria | 1010 |
| 632 | Ga0496124_0779675 | 3300048927 | Bacteria | 595 |
| 633 | Ga0496125_0028760 | 3300048928 | Bacteria | 5010 |
| 634 | Ga0496125_0058857 | 3300048928 | Bacteria | 3100 |
| 635 | Ga0496126_0000261 | 3300048929 | Bacteria | 112027 |
| 636 | Ga0496126_0000365 | 3300048929 | Bacteria | 93461 |
| 637 | Ga0496126_0048856 | 3300048929 | Bacteria | 3864 |
| 638 | Ga0501292_000039 | 3300049515 | Bacteria | 31662 |
| 639 | Ga0501294_001148 | 3300049517 | Bacteria | 2755 |
| 640 | Ga0501300_002365 | 3300049523 | Bacteria | 2814 |
| 641 | Ga0501300_012336 | 3300049523 | Bacteria | 1246 |
| 642 | Ga0501031_0183698 | 3300049568 | Bacteria | 1366 |
| 643 | Ga0501032_0031710 | 3300049569 | Bacteria | 3623 |
| 644 | Ga0501033_0793166 | 3300049570 | Bacteria | 641 |
| 645 | Ga0501034_0087683 | 3300049571 | Bacteria | 3111 |
| 646 | Ga0501034_0451467 | 3300049571 | Bacteria | 1203 |
| 647 | Ga0501034_0679696 | 3300049571 | Bacteria | 929 |
| 648 | Ga0501034_0808514 | 3300049571 | Bacteria | 830 |
| 649 | Ga0501036_0982269 | 3300049572 | Bacteria | 691 |
| 650 | Ga0501037_0260032 | 3300049573 | Bacteria | 1213 |
| 651 | Ga0501037_0507351 | 3300049573 | Bacteria | 818 |
| 652 | Ga0501038_0022535 | 3300049574 | Bacteria | 5642 |
| 653 | Ga0501039_0331637 | 3300049575 | Bacteria | 1196 |
| 654 | Ga0501043_0028272 | 3300049579 | Bacteria | 4401 |
| 655 | Ga0501047_0004437 | 3300049581 | Bacteria | 13214 |
| 656 | Ga0501047_0085015 | 3300049581 | Bacteria | 3040 |
| 657 | Ga0501047_0478095 | 3300049581 | Bacteria | 1074 |
| 658 | Ga0501048_0561443 | 3300049582 | Bacteria | 819 |
| 659 | Ga0501071_0629883 | 3300049587 | Bacteria | 825 |
| 660 | Ga0501073_0246433 | 3300049589 | Bacteria | 1234 |
| 661 | Ga0501073_0337364 | 3300049589 | Bacteria | 1041 |
| 662 | Ga0501222_032414 | 3300049662 | Bacteria | 721 |
| 663 | Ga0501223_000706 | 3300049663 | Bacteria | 7954 |
| 664 | Ga0501223_001199 | 3300049663 | Bacteria | 6075 |
| 665 | Ga0501224_000027 | 3300049664 | Bacteria | 53610 |
| 666 | Ga0501224_006232 | 3300049664 | Bacteria | 1727 |
| 667 | Ga0501224_031630 | 3300049664 | Bacteria | 793 |
| 668 | Ga0501227_003259 | 3300049665 | Bacteria | 3521 |
| 669 | Ga0501233_005314 | 3300049668 | Bacteria | 2390 |
| 670 | Ga0501233_025828 | 3300049668 | Bacteria | 1294 |
| 671 | Ga0501235_014042 | 3300049669 | Bacteria | 1765 |
| 672 | Ga0501249_033623 | 3300049679 | Bacteria | 1149 |
| 673 | Ga0501257_000023 | 3300049686 | Bacteria | 44305 |
| 674 | Ga0501257_068078 | 3300049686 | Bacteria | 906 |
| 675 | Ga0501259_001451 | 3300049688 | Bacteria | 3944 |
| 676 | Ga0501261_000013 | 3300049690 | Bacteria | 45622 |
| 677 | Ga0501221_016231 | 3300049704 | Bacteria | 1407 |
| 678 | Ga0501225_0000057 | 3300049705 | Bacteria | 37809 |
| 679 | Ga0501225_0002810 | 3300049705 | Bacteria | 5350 |
| 680 | Ga0501234_021749 | 3300049707 | Bacteria | 1022 |
| 681 | Ga0501276_007674 | 3300049773 | Bacteria | 866 |
| 682 | Ga0501279_000017 | 3300049775 | Bacteria | 62448 |
| 683 | Ga0501280_000015 | 3300049776 | Bacteria | 55614 |
| 684 | Ga0501280_003212 | 3300049776 | Bacteria | 2547 |
| 685 | Ga0501281_00041 | 3300049777 | Bacteria | 14782 |
| 686 | Ga0501282_000300 | 3300049778 | Bacteria | 5971 |
| 687 | Ga0501283_002495 | 3300049779 | Bacteria | 2392 |
| 688 | Ga0501035_0384132 | 3300049822 | Bacteria | 1171 |
| 689 | Ga0501044_0024420 | 3300049823 | Bacteria | 6416 |
| 690 | Ga0501044_0075851 | 3300049823 | Bacteria | 3414 |
| 691 | Ga0501044_0081514 | 3300049823 | Bacteria | 3275 |
| 692 | Ga0501044_0390785 | 3300049823 | Bacteria | 1305 |
| 693 | Ga0501226_000068 | 3300049853 | Bacteria | 32699 |
| 694 | nmdc:mga03683_10563_c1 | 3300050489 | Bacteria | 3314 |
| 695 | nmdc:mga03683_138761_c1 | 3300050489 | Bacteria | 1092 |
| 696 | nmdc:mga03683_164_c1 | 3300050489 | Bacteria | 22386 |
| 697 | nmdc:mga03683_264973_c1 | 3300050489 | Bacteria | 800 |
| 698 | nmdc:mga03683_3_c1 | 3300050489 | Bacteria | 285872 |
| 699 | nmdc:mga03n38_243_c1 | 3300050490 | Bacteria | 12887 |
| 700 | nmdc:mga00v17_145892_c1 | 3300050491 | Bacteria | 1519 |
| 701 | nmdc:mga00v17_357_c1 | 3300050491 | Bacteria | 25838 |
| 702 | nmdc:mga00v17_611975_c1 | 3300050491 | Bacteria | 702 |
| 703 | nmdc:mga00v17_671904_c1 | 3300050491 | Bacteria | 665 |
| 704 | nmdc:mga00v17_79048_c1 | 3300050491 | Bacteria | 2051 |
| 705 | nmdc:mga0yw44_107595_c1 | 3300050492 | Bacteria | 1784 |
| 706 | nmdc:mga0k408_2_c1 | 3300050493 | Bacteria | 395671 |
| 707 | nmdc:mga0k408_45592_c1 | 3300050493 | Bacteria | 2530 |
| 708 | nmdc:mga0k408_653273_c1 | 3300050493 | Bacteria | 618 |
| 709 | nmdc:mga0k408_9510_c1 | 3300050493 | Bacteria | 5243 |
| 710 | nmdc:mga06z11_140_c1 | 3300050494 | Bacteria | 28632 |
| 711 | nmdc:mga04h51_48_c1 | 3300050495 | Bacteria | 38959 |
| 712 | nmdc:mga07m45_118275_c1 | 3300050496 | Bacteria | 1530 |
| 713 | nmdc:mga07m45_18528_c1 | 3300050496 | Bacteria | 3760 |
| 714 | nmdc:mga07m45_1_c1 | 3300050496 | Bacteria | 485809 |
| 715 | nmdc:mga07m45_256_c1 | 3300050496 | Bacteria | 2699 |
| 716 | nmdc:mga07m45_5276_c1 | 3300050496 | Bacteria | 6424 |
| 717 | nmdc:mga07m45_560937_c1 | 3300050496 | Bacteria | 660 |
| 718 | nmdc:mga07m45_9_c1 | 3300050496 | Bacteria | 171776 |
| 719 | nmdc:mga05p37_940997_c1 | 3300050507 | Bacteria | 926 |
| 720 | nmdc:mga08y16_1471492_c1 | 3300050511 | Bacteria | 642 |
| 721 | nmdc:mga08x19_303034_c1 | 3300050514 | Bacteria | 1110 |
| 722 | nmdc:mga0sz30_7685_c1 | 3300050516 | Bacteria | 984 |
| 723 | nmdc:mga0sz30_8482_c1 | 3300050516 | Bacteria | 3883 |
| 724 | Ga0500643_000005 | 3300053087 | Bacteria | 539775 |
| 725 | Ga0500643_000839 | 3300053087 | Bacteria | 19704 |
| 726 | Ga0500643_102818 | 3300053087 | Bacteria | 774 |
| 727 | Ga0500555_139243 | 3300053103 | Bacteria | 598 |
| 728 | Ga0500562_028676 | 3300053108 | Bacteria | 1464 |
| 729 | Ga0500592_035320 | 3300053116 | Bacteria | 807 |
| 730 | Ga0500593_137528 | 3300053117 | Bacteria | 966 |
| 731 | Ga0500595_146246 | 3300053119 | Bacteria | 661 |
| 732 | Ga0500607_000473 | 3300053121 | Bacteria | 38991 |
| 733 | Ga0500607_002009 | 3300053121 | Bacteria | 17189 |
| 734 | Ga0500608_000334 | 3300053122 | Bacteria | 18157 |
| 735 | Ga0500618_002917 | 3300053125 | Bacteria | 6123 |
| 736 | Ga0500618_046270 | 3300053125 | Bacteria | 991 |
| 737 | Ga0500559_0002117 | 3300053136 | Bacteria | 10564 |
| 738 | Ga0500559_0002682 | 3300053136 | Bacteria | 9055 |
| 739 | Ga0500559_0095695 | 3300053136 | Bacteria | 1363 |
| 740 | Ga0500564_060211 | 3300053138 | Bacteria | 1723 |
| 741 | Ga0500568_0105685 | 3300053139 | Bacteria | 1055 |
| 742 | Ga0500588_0077957 | 3300053146 | Bacteria | 1102 |
| 743 | Ga0500590_000767 | 3300053148 | Bacteria | 11844 |
| 744 | Ga0500590_009605 | 3300053148 | Bacteria | 4868 |
| 745 | Ga0500604_0038152 | 3300053151 | Bacteria | 1440 |
| 746 | Ga0500604_0041115 | 3300053151 | Bacteria | 1397 |
| 747 | Ga0500604_0078006 | 3300053151 | Bacteria | 1066 |
| 748 | Ga0500616_0001003 | 3300053153 | Bacteria | 30395 |
| 749 | Ga0500622_0006555 | 3300053156 | Bacteria | 6722 |
| 750 | Ga0500622_0122029 | 3300053156 | Bacteria | 1263 |
| 751 | Ga0500627_0017326 | 3300053158 | Bacteria | 2828 |
| 752 | Ga0500636_0071420 | 3300053177 | Bacteria | 2013 |
| 753 | Ga0500637_0001962 | 3300053178 | Bacteria | 8939 |
| 754 | Ga0500567_000030 | 3300053723 | Bacteria | 30021 |
| 755 | Ga0500625_000027 | 3300053729 | Bacteria | 56422 |
| 756 | Ga0500645_002625 | 3300053730 | Bacteria | 7871 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031901 | Ga0307406_10232225 | Ga0307406_102322252 | 140 |
| 2 | 3300031852 | Ga0307410_10057042 | Ga0307410_100570423 | 141 |
| 3 | 3300031901 | Ga0307406_10530060 | Ga0307406_105300602 | 141 |
| 4 | 3300032005 | Ga0307411_10687932 | Ga0307411_106879322 | 141 |
| 5 | 3300036647 | Ga0316582_0114254 | Ga0316582_0114254_729_1232 | 141 |
| 6 | 3300041512 | Ga0451853_0636233 | Ga0451853_0636233_84_569 | 141 |
| 7 | 3300049679 | Ga0501249_033623 | Ga0501249_033623_668_1093 | 141 |
| 8 | 3300028800 | Ga0265338_10408599 | Ga0265338_104085991 | 143 |
| 9 | 3300048090 | Ga0495615_0000103 | Ga0495615_0000103_20036_20506 | 143 |
| 10 | 3300048925 | Ga0496122_0016758 | Ga0496122_0016758_3810_4280 | 143 |
| 11 | 3300048926 | Ga0496123_0003182 | Ga0496123_0003182_14530_15000 | 143 |
| 12 | 3300048927 | Ga0496124_0322015 | Ga0496124_0322015_185_655 | 143 |
| 13 | 3300005336 | Ga0070680_100574742 | Ga0070680_1005747422 | 144 |
| 14 | 3300005339 | Ga0070660_100251325 | Ga0070660_1002513252 | 144 |
| 15 | 3300005535 | Ga0070684_100395541 | Ga0070684_1003955412 | 144 |
| 16 | 3300005539 | Ga0068853_100133003 | Ga0068853_1001330034 | 144 |
| 17 | 3300005563 | Ga0068855_100000644 | Ga0068855_10000064427 | 144 |
| 18 | 3300005616 | Ga0068852_100928346 | Ga0068852_1009283462 | 144 |
| 19 | 3300009093 | Ga0105240_10009965 | Ga0105240_1000996512 | 144 |
| 20 | 3300009551 | Ga0105238_10593923 | Ga0105238_105939232 | 144 |
| 21 | 3300013100 | Ga0157373_11082072 | Ga0157373_110820721 | 144 |
| 22 | 3300013105 | Ga0157369_11635110 | Ga0157369_116351102 | 144 |
| 23 | 3300013307 | Ga0157372_11692251 | Ga0157372_116922511 | 144 |
| 24 | 3300025912 | Ga0207707_11521785 | Ga0207707_115217851 | 144 |
| 25 | 3300025913 | Ga0207695_10126665 | Ga0207695_101266652 | 144 |
| 26 | 3300025917 | Ga0207660_10089817 | Ga0207660_100898172 | 144 |
| 27 | 3300025924 | Ga0207694_10088716 | Ga0207694_100887164 | 144 |
| 28 | 3300025933 | Ga0207706_10978789 | Ga0207706_109787892 | 144 |
| 29 | 3300025949 | Ga0207667_10001801 | Ga0207667_1000180115 | 144 |
| 30 | 3300026041 | Ga0207639_10442825 | Ga0207639_104428252 | 144 |
| 31 | 3300026142 | Ga0207698_10115306 | Ga0207698_101153061 | 144 |
| 32 | 3300045051 | Ga0451576_0000017 | Ga0451576_0000017_125413_125856 | 144 |
| 33 | 3300049589 | Ga0501073_0337364 | Ga0501073_0337364_331_768 | 144 |
| 34 | 3300046523 | Ga0495644_0155054 | Ga0495644_0155054_421_867 | 145 |
| 35 | 3300049573 | Ga0501037_0507351 | Ga0501037_0507351_133_624 | 145 |
| 36 | 2162886007 | SwRhRL2b_contig_3705888 | SwRhRL2b_0781.00003740 | 146 |
| 37 | 3300005289 | Ga0065704_10000553 | Ga0065704_100005532 | 146 |
| 38 | 3300005614 | Ga0068856_100253791 | Ga0068856_1002537912 | 146 |
| 39 | 3300005616 | Ga0068852_100050804 | Ga0068852_1000508042 | 146 |
| 40 | 3300026078 | Ga0207702_10111922 | Ga0207702_101119222 | 146 |
| 41 | 3300026116 | Ga0207674_11717693 | Ga0207674_117176932 | 146 |
| 42 | 3300031901 | Ga0307406_10847221 | Ga0307406_108472212 | 146 |
| 43 | 3300031911 | Ga0307412_11098409 | Ga0307412_110984092 | 146 |
| 44 | 3300031731 | Ga0307405_10678243 | Ga0307405_106782432 | 147 |
| 45 | 3300036712 | Ga0316584_0291270 | Ga0316584_0291270_126_629 | 147 |
| 46 | 3300050489 | nmdc:mga03683_264973_c1 | nmdc:mga03683_264973_c1_63_557 | 147 |
| 47 | 3300046616 | Ga0495668_0147719 | Ga0495668_0147719_162_650 | 148 |
| 48 | 3300046660 | Ga0495625_0216745 | Ga0495625_0216745_730_1218 | 148 |
| 49 | 3300053119 | Ga0500595_146246 | Ga0500595_146246_85_573 | 148 |
| 50 | 3300053156 | Ga0500622_0006555 | Ga0500622_0006555_3740_4228 | 148 |
| 51 | iso_pu_bacteria | 2512564014 | 2512642547 | 148 |
| 52 | 3300005295 | Ga0065707_10253023 | Ga0065707_102530232 | 149 |
| 53 | 3300031548 | Ga0307408_100733634 | Ga0307408_1007336341 | 149 |
| 54 | 3300031911 | Ga0307412_10123237 | Ga0307412_101232373 | 149 |
| 55 | 3300048905 | Ga0496102_0003512 | Ga0496102_0003512_8795_9247 | 149 |
| 56 | 3300048906 | Ga0496103_0000372 | Ga0496103_0000372_1301_1753 | 149 |
| 57 | 3300048919 | Ga0496116_0006619 | Ga0496116_0006619_8758_9210 | 149 |
| 58 | 3300048920 | Ga0496117_0002288 | Ga0496117_0002288_4199_4651 | 149 |
| 59 | 3300048921 | Ga0496118_0000097 | Ga0496118_0000097_121884_122336 | 149 |
| 60 | 3300048922 | Ga0496119_0026561 | Ga0496119_0026561_2398_2850 | 149 |
| 61 | 3300048923 | Ga0496120_0054075 | Ga0496120_0054075_1299_1751 | 149 |
| 62 | 3300048927 | Ga0496124_0001077 | Ga0496124_0001077_38487_38939 | 149 |
| 63 | 3300049523 | Ga0501300_012336 | Ga0501300_012336_380_832 | 149 |
| 64 | 3300049686 | Ga0501257_000023 | Ga0501257_000023_2673_3125 | 149 |
| 65 | 3300049776 | Ga0501280_003212 | Ga0501280_003212_1028_1480 | 149 |
| 66 | 3300053087 | Ga0500643_000839 | Ga0500643_000839_18041_18493 | 149 |
| 67 | 3300031824 | Ga0307413_11024435 | Ga0307413_110244351 | 150 |
| 68 | 3300049515 | Ga0501292_000039 | Ga0501292_000039_3985_4440 | 150 |
| 69 | 3300049517 | Ga0501294_001148 | Ga0501294_001148_1608_2063 | 150 |
| 70 | 3300049523 | Ga0501300_002365 | Ga0501300_002365_1386_1841 | 150 |
| 71 | 3300049662 | Ga0501222_032414 | Ga0501222_032414_198_653 | 150 |
| 72 | 3300049663 | Ga0501223_001199 | Ga0501223_001199_3746_4201 | 150 |
| 73 | 3300049664 | Ga0501224_006232 | Ga0501224_006232_730_1185 | 150 |
| 74 | 3300049665 | Ga0501227_003259 | Ga0501227_003259_2341_2796 | 150 |
| 75 | 3300049668 | Ga0501233_005314 | Ga0501233_005314_1430_1885 | 150 |
| 76 | 3300049669 | Ga0501235_014042 | Ga0501235_014042_552_1007 | 150 |
| 77 | 3300049686 | Ga0501257_068078 | Ga0501257_068078_133_588 | 150 |
| 78 | 3300049688 | Ga0501259_001451 | Ga0501259_001451_2293_2748 | 150 |
| 79 | 3300049690 | Ga0501261_000013 | Ga0501261_000013_41270_41725 | 150 |
| 80 | 3300049704 | Ga0501221_016231 | Ga0501221_016231_487_942 | 150 |
| 81 | 3300049705 | Ga0501225_0002810 | Ga0501225_0002810_2594_3049 | 150 |
| 82 | 3300049773 | Ga0501276_007674 | Ga0501276_007674_171_626 | 150 |
| 83 | 3300049775 | Ga0501279_000017 | Ga0501279_000017_57919_58374 | 150 |
| 84 | 3300049776 | Ga0501280_000015 | Ga0501280_000015_764_1219 | 150 |
| 85 | 3300049777 | Ga0501281_00041 | Ga0501281_00041_11646_12101 | 150 |
| 86 | 3300049778 | Ga0501282_000300 | Ga0501282_000300_1191_1646 | 150 |
| 87 | 3300049779 | Ga0501283_002495 | Ga0501283_002495_681_1136 | 150 |
| 88 | 3300026041 | Ga0207639_11268134 | Ga0207639_112681341 | 151 |
| 89 | 3300031548 | Ga0307408_100086591 | Ga0307408_1000865912 | 151 |
| 90 | 3300031731 | Ga0307405_10990585 | Ga0307405_109905852 | 151 |
| 91 | 3300032002 | Ga0307416_100037322 | Ga0307416_1000373223 | 151 |
| 92 | 3300005367 | Ga0070667_100000131 | Ga0070667_10000013110 | 152 |
| 93 | 3300005841 | Ga0068863_100041563 | Ga0068863_1000415632 | 152 |
| 94 | 3300005843 | Ga0068860_100000013 | Ga0068860_100000013111 | 152 |
| 95 | 3300025903 | Ga0207680_10280858 | Ga0207680_102808581 | 152 |
| 96 | 3300025986 | Ga0207658_10000067 | Ga0207658_100000679 | 152 |
| 97 | 3300026088 | Ga0207641_10007053 | Ga0207641_100070536 | 152 |
| 98 | 3300028381 | Ga0268264_10000039 | Ga0268264_10000039112 | 152 |
| 99 | 3300031548 | Ga0307408_100411890 | Ga0307408_1004118902 | 152 |
| 100 | 3300031731 | Ga0307405_10042472 | Ga0307405_100424723 | 152 |
| 101 | 3300031911 | Ga0307412_10059169 | Ga0307412_100591692 | 152 |
| 102 | 3300032002 | Ga0307416_100374546 | Ga0307416_1003745463 | 152 |
| 103 | 3300046522 | Ga0495643_0010451 | Ga0495643_0010451_3837_4349 | 152 |
| 104 | 3300046524 | Ga0495648_0085235 | Ga0495648_0085235_1169_1642 | 152 |
| 105 | 3300053151 | Ga0500604_0038152 | Ga0500604_0038152_883_1344 | 152 |
| 106 | iso_pu_bacteria | 2738541275 | 2738710573 | 152 |
| 107 | iso_pu_bacteria | 2738541301 | 2738848998 | 152 |
| 108 | iso_pu_bacteria | 2738541304 | 2738864727 | 152 |
| 109 | iso_pu_bacteria | 2738543022 | 2739297245 | 152 |
| 110 | iso_pu_bacteria | 2738543033 | 2739358923 | 152 |
| 111 | iso_pu_bacteria | 2739367664 | 2739651017 | 152 |
| 112 | iso_pu_bacteria | 2739367865 | 2740029490 | 152 |
| 113 | iso_pu_bacteria | 2818991438 | 2819551004 | 152 |
| 114 | iso_pu_bacteria | 2928100450 | 2928100672 | 152 |
| 115 | iso_pu_bacteria | 2928959182 | 2928960735 | 152 |
| 116 | 3300005289 | Ga0065704_10358848 | Ga0065704_103588481 | 153 |
| 117 | 3300001976 | JGI24752J21851_1002192 | JGI24752J21851_10021924 | 154 |
| 118 | 3300002070 | JGI24750J21931_1036357 | JGI24750J21931_10363572 | 154 |
| 119 | 3300005331 | Ga0070670_100016491 | Ga0070670_1000164912 | 154 |
| 120 | 3300005331 | Ga0070670_100032619 | Ga0070670_1000326194 | 154 |
| 121 | 3300005335 | Ga0070666_10000067 | Ga0070666_1000006720 | 154 |
| 122 | 3300005340 | Ga0070689_101381840 | Ga0070689_1013818401 | 154 |
| 123 | 3300005353 | Ga0070669_100000029 | Ga0070669_10000002955 | 154 |
| 124 | 3300005353 | Ga0070669_100008611 | Ga0070669_1000086113 | 154 |
| 125 | 3300005353 | Ga0070669_100291997 | Ga0070669_1002919972 | 154 |
| 126 | 3300005355 | Ga0070671_100000016 | Ga0070671_100000016101 | 154 |
| 127 | 3300005367 | Ga0070667_100145492 | Ga0070667_1001454922 | 154 |
| 128 | 3300005445 | Ga0070708_100348132 | Ga0070708_1003481323 | 154 |
| 129 | 3300005548 | Ga0070665_100149673 | Ga0070665_1001496732 | 154 |
| 130 | 3300005578 | Ga0068854_100033054 | Ga0068854_1000330543 | 154 |
| 131 | 3300005617 | Ga0068859_100000110 | Ga0068859_10000011024 | 154 |
| 132 | 3300005618 | Ga0068864_100005229 | Ga0068864_1000052295 | 154 |
| 133 | 3300005719 | Ga0068861_100021448 | Ga0068861_1000214481 | 154 |
| 134 | 3300005841 | Ga0068863_100019211 | Ga0068863_1000192112 | 154 |
| 135 | 3300005842 | Ga0068858_100007941 | Ga0068858_1000079419 | 154 |
| 136 | 3300005844 | Ga0068862_100014001 | Ga0068862_1000140015 | 154 |
| 137 | 3300006931 | Ga0097620_100000110 | Ga0097620_10000011024 | 154 |
| 138 | 3300009011 | Ga0105251_10008372 | Ga0105251_100083727 | 154 |
| 139 | 3300009101 | Ga0105247_10010759 | Ga0105247_100107597 | 154 |
| 140 | 3300009101 | Ga0105247_10038204 | Ga0105247_100382043 | 154 |
| 141 | 3300009177 | Ga0105248_10083705 | Ga0105248_100837053 | 154 |
| 142 | 3300009553 | Ga0105249_10027171 | Ga0105249_100271712 | 154 |
| 143 | 3300013306 | Ga0163162_10066747 | Ga0163162_100667472 | 154 |
| 144 | 3300014968 | Ga0157379_10089610 | Ga0157379_100896102 | 154 |
| 145 | 3300017792 | Ga0163161_10598175 | Ga0163161_105981752 | 154 |
| 146 | 3300025315 | Ga0207697_10000295 | Ga0207697_100002956 | 154 |
| 147 | 3300025735 | Ga0207713_1044420 | Ga0207713_10444202 | 154 |
| 148 | 3300025900 | Ga0207710_10039577 | Ga0207710_100395772 | 154 |
| 149 | 3300025903 | Ga0207680_10001445 | Ga0207680_100014455 | 154 |
| 150 | 3300025923 | Ga0207681_10000040 | Ga0207681_1000004055 | 154 |
| 151 | 3300025923 | Ga0207681_10002113 | Ga0207681_100021138 | 154 |
| 152 | 3300025923 | Ga0207681_10037734 | Ga0207681_100377344 | 154 |
| 153 | 3300025925 | Ga0207650_10007453 | Ga0207650_100074532 | 154 |
| 154 | 3300025925 | Ga0207650_10120978 | Ga0207650_101209782 | 154 |
| 155 | 3300025931 | Ga0207644_10000023 | Ga0207644_10000023102 | 154 |
| 156 | 3300025941 | Ga0207711_10161377 | Ga0207711_101613773 | 154 |
| 157 | 3300025972 | Ga0207668_10058897 | Ga0207668_100588972 | 154 |
| 158 | 3300025981 | Ga0207640_10006942 | Ga0207640_100069422 | 154 |
| 159 | 3300025986 | Ga0207658_10658224 | Ga0207658_106582241 | 154 |
| 160 | 3300026035 | Ga0207703_10001553 | Ga0207703_1000155314 | 154 |
| 161 | 3300026035 | Ga0207703_10045631 | Ga0207703_100456315 | 154 |
| 162 | 3300026088 | Ga0207641_10029943 | Ga0207641_100299431 | 154 |
| 163 | 3300026095 | Ga0207676_10000888 | Ga0207676_100008882 | 154 |
| 164 | 3300026118 | Ga0207675_100001359 | Ga0207675_1000013595 | 154 |
| 165 | 3300028379 | Ga0268266_10300856 | Ga0268266_103008562 | 154 |
| 166 | 3300028380 | Ga0268265_10000098 | Ga0268265_1000009887 | 154 |
| 167 | 3300028381 | Ga0268264_10000141 | Ga0268264_10000141126 | 154 |
| 168 | 3300028381 | Ga0268264_10001883 | Ga0268264_1000188310 | 154 |
| 169 | 3300031616 | Ga0307508_10071375 | Ga0307508_100713754 | 154 |
| 170 | 3300031730 | Ga0307516_10248583 | Ga0307516_102485832 | 154 |
| 171 | iso_pu_bacteria | 2643221588 | 2643951142 | 154 |
| 172 | 3300001904 | JGI24736J21556_1000162 | JGI24736J21556_10001622 | 155 |
| 173 | 3300001976 | JGI24752J21851_1000138 | JGI24752J21851_10001382 | 155 |
| 174 | 3300001979 | JGI24740J21852_10045219 | JGI24740J21852_100452193 | 155 |
| 175 | 3300001989 | JGI24739J22299_10008859 | JGI24739J22299_100088592 | 155 |
| 176 | 3300001990 | JGI24737J22298_10030127 | JGI24737J22298_100301272 | 155 |
| 177 | 3300002070 | JGI24750J21931_1000338 | JGI24750J21931_10003385 | 155 |
| 178 | 3300002074 | JGI24748J21848_1000033 | JGI24748J21848_100003341 | 155 |
| 179 | 3300002075 | JGI24738J21930_10024920 | JGI24738J21930_100249202 | 155 |
| 180 | 3300002076 | JGI24749J21850_1002743 | JGI24749J21850_10027432 | 155 |
| 181 | 3300002239 | JGI24034J26672_10000032 | JGI24034J26672_1000003252 | 155 |
| 182 | 3300005327 | Ga0070658_10568577 | Ga0070658_105685772 | 155 |
| 183 | 3300005329 | Ga0070683_100500741 | Ga0070683_1005007412 | 155 |
| 184 | 3300005330 | Ga0070690_100000011 | Ga0070690_10000001116 | 155 |
| 185 | 3300005331 | Ga0070670_101202986 | Ga0070670_1012029862 | 155 |
| 186 | 3300005334 | Ga0068869_101094469 | Ga0068869_1010944691 | 155 |
| 187 | 3300005335 | Ga0070666_10000035 | Ga0070666_1000003540 | 155 |
| 188 | 3300005337 | Ga0070682_100102095 | Ga0070682_1001020953 | 155 |
| 189 | 3300005339 | Ga0070660_100208849 | Ga0070660_1002088494 | 155 |
| 190 | 3300005340 | Ga0070689_100019644 | Ga0070689_1000196442 | 155 |
| 191 | 3300005347 | Ga0070668_100039525 | Ga0070668_1000395254 | 155 |
| 192 | 3300005347 | Ga0070668_100178090 | Ga0070668_1001780902 | 155 |
| 193 | 3300005353 | Ga0070669_100000074 | Ga0070669_10000007446 | 155 |
| 194 | 3300005353 | Ga0070669_100000131 | Ga0070669_10000013129 | 155 |
| 195 | 3300005355 | Ga0070671_100000375 | Ga0070671_10000037514 | 155 |
| 196 | 3300005355 | Ga0070671_100015960 | Ga0070671_1000159607 | 155 |
| 197 | 3300005365 | Ga0070688_100001817 | Ga0070688_10000181712 | 155 |
| 198 | 3300005367 | Ga0070667_100001796 | Ga0070667_10000179612 | 155 |
| 199 | 3300005367 | Ga0070667_100086305 | Ga0070667_1000863054 | 155 |
| 200 | 3300005440 | Ga0070705_101229347 | Ga0070705_1012293471 | 155 |
| 201 | 3300005457 | Ga0070662_100044182 | Ga0070662_1000441826 | 155 |
| 202 | 3300005466 | Ga0070685_10007591 | Ga0070685_100075917 | 155 |
| 203 | 3300005468 | Ga0070707_100863848 | Ga0070707_1008638482 | 155 |
| 204 | 3300005544 | Ga0070686_100000035 | Ga0070686_10000003575 | 155 |
| 205 | 3300005548 | Ga0070665_100000161 | Ga0070665_10000016188 | 155 |
| 206 | 3300005548 | Ga0070665_100001089 | Ga0070665_10000108914 | 155 |
| 207 | 3300005577 | Ga0068857_100207427 | Ga0068857_1002074272 | 155 |
| 208 | 3300005578 | Ga0068854_100306023 | Ga0068854_1003060232 | 155 |
| 209 | 3300005578 | Ga0068854_101665757 | Ga0068854_1016657571 | 155 |
| 210 | 3300005614 | Ga0068856_101971128 | Ga0068856_1019711281 | 155 |
| 211 | 3300005616 | Ga0068852_100462850 | Ga0068852_1004628502 | 155 |
| 212 | 3300005617 | Ga0068859_100039049 | Ga0068859_1000390495 | 155 |
| 213 | 3300005618 | Ga0068864_100014687 | Ga0068864_1000146878 | 155 |
| 214 | 3300005719 | Ga0068861_100008987 | Ga0068861_1000089876 | 155 |
| 215 | 3300005841 | Ga0068863_100000060 | Ga0068863_10000006087 | 155 |
| 216 | 3300005842 | Ga0068858_100002514 | Ga0068858_1000025143 | 155 |
| 217 | 3300005843 | Ga0068860_100000126 | Ga0068860_10000012688 | 155 |
| 218 | 3300005843 | Ga0068860_100006579 | Ga0068860_10000657912 | 155 |
| 219 | 3300005844 | Ga0068862_100000146 | Ga0068862_10000014625 | 155 |
| 220 | 3300005844 | Ga0068862_100078842 | Ga0068862_1000788424 | 155 |
| 221 | 3300006931 | Ga0097620_100039048 | Ga0097620_1000390485 | 155 |
| 222 | 3300009011 | Ga0105251_10079527 | Ga0105251_100795271 | 155 |
| 223 | 3300009092 | Ga0105250_10018579 | Ga0105250_100185793 | 155 |
| 224 | 3300009093 | Ga0105240_11485371 | Ga0105240_114853712 | 155 |
| 225 | 3300009147 | Ga0114129_10465210 | Ga0114129_104652102 | 155 |
| 226 | 3300009148 | Ga0105243_10116855 | Ga0105243_101168551 | 155 |
| 227 | 3300009177 | Ga0105248_10160999 | Ga0105248_101609995 | 155 |
| 228 | 3300009177 | Ga0105248_10448293 | Ga0105248_104482932 | 155 |
| 229 | 3300009177 | Ga0105248_11072170 | Ga0105248_110721702 | 155 |
| 230 | 3300009545 | Ga0105237_11315958 | Ga0105237_113159581 | 155 |
| 231 | 3300009551 | Ga0105238_10609350 | Ga0105238_106093501 | 155 |
| 232 | 3300009553 | Ga0105249_10000094 | Ga0105249_1000009441 | 155 |
| 233 | 3300009553 | Ga0105249_10098910 | Ga0105249_100989103 | 155 |
| 234 | 3300013100 | Ga0157373_10141677 | Ga0157373_101416773 | 155 |
| 235 | 3300013102 | Ga0157371_10348334 | Ga0157371_103483342 | 155 |
| 236 | 3300013104 | Ga0157370_10677540 | Ga0157370_106775402 | 155 |
| 237 | 3300013105 | Ga0157369_10026111 | Ga0157369_100261114 | 155 |
| 238 | 3300013306 | Ga0163162_10020604 | Ga0163162_100206046 | 155 |
| 239 | 3300013306 | Ga0163162_10041921 | Ga0163162_100419215 | 155 |
| 240 | 3300013306 | Ga0163162_10279919 | Ga0163162_102799192 | 155 |
| 241 | 3300013307 | Ga0157372_10163734 | Ga0157372_101637343 | 155 |
| 242 | 3300014325 | Ga0163163_10349797 | Ga0163163_103497972 | 155 |
| 243 | 3300014326 | Ga0157380_10007934 | Ga0157380_100079345 | 155 |
| 244 | 3300014968 | Ga0157379_10030612 | Ga0157379_100306122 | 155 |
| 245 | 3300017792 | Ga0163161_10000195 | Ga0163161_1000019518 | 155 |
| 246 | 3300017792 | Ga0163161_10721008 | Ga0163161_107210082 | 155 |
| 247 | 3300025223 | Ga0207672_1001676 | Ga0207672_10016764 | 155 |
| 248 | 3300025321 | Ga0207656_10052395 | Ga0207656_100523952 | 155 |
| 249 | 3300025711 | Ga0207696_1001635 | Ga0207696_10016354 | 155 |
| 250 | 3300025735 | Ga0207713_1004070 | Ga0207713_100407012 | 155 |
| 251 | 3300025903 | Ga0207680_10000007 | Ga0207680_10000007317 | 155 |
| 252 | 3300025904 | Ga0207647_10000444 | Ga0207647_1000044430 | 155 |
| 253 | 3300025909 | Ga0207705_10024300 | Ga0207705_100243002 | 155 |
| 254 | 3300025911 | Ga0207654_10003992 | Ga0207654_100039922 | 155 |
| 255 | 3300025913 | Ga0207695_10399106 | Ga0207695_103991062 | 155 |
| 256 | 3300025914 | Ga0207671_10000457 | Ga0207671_100004572 | 155 |
| 257 | 3300025919 | Ga0207657_10105319 | Ga0207657_101053194 | 155 |
| 258 | 3300025920 | Ga0207649_10492548 | Ga0207649_104925482 | 155 |
| 259 | 3300025922 | Ga0207646_10731553 | Ga0207646_107315532 | 155 |
| 260 | 3300025923 | Ga0207681_10000053 | Ga0207681_1000005377 | 155 |
| 261 | 3300025923 | Ga0207681_10000120 | Ga0207681_1000012014 | 155 |
| 262 | 3300025924 | Ga0207694_10274535 | Ga0207694_102745352 | 155 |
| 263 | 3300025924 | Ga0207694_10345887 | Ga0207694_103458872 | 155 |
| 264 | 3300025925 | Ga0207650_10050238 | Ga0207650_100502385 | 155 |
| 265 | 3300025925 | Ga0207650_10855037 | Ga0207650_108550371 | 155 |
| 266 | 3300025931 | Ga0207644_10015656 | Ga0207644_100156563 | 155 |
| 267 | 3300025931 | Ga0207644_10024648 | Ga0207644_100246483 | 155 |
| 268 | 3300025936 | Ga0207670_10011560 | Ga0207670_100115607 | 155 |
| 269 | 3300025941 | Ga0207711_10012882 | Ga0207711_100128824 | 155 |
| 270 | 3300025941 | Ga0207711_10138634 | Ga0207711_101386343 | 155 |
| 271 | 3300025941 | Ga0207711_11159970 | Ga0207711_111599701 | 155 |
| 272 | 3300025949 | Ga0207667_10191554 | Ga0207667_101915542 | 155 |
| 273 | 3300025949 | Ga0207667_11140759 | Ga0207667_111407591 | 155 |
| 274 | 3300025961 | Ga0207712_10000004 | Ga0207712_10000004305 | 155 |
| 275 | 3300025961 | Ga0207712_10007583 | Ga0207712_100075833 | 155 |
| 276 | 3300025972 | Ga0207668_10028040 | Ga0207668_100280404 | 155 |
| 277 | 3300025972 | Ga0207668_10053416 | Ga0207668_100534162 | 155 |
| 278 | 3300025981 | Ga0207640_10295914 | Ga0207640_102959142 | 155 |
| 279 | 3300025986 | Ga0207658_10000288 | Ga0207658_1000028840 | 155 |
| 280 | 3300025986 | Ga0207658_10001427 | Ga0207658_1000142715 | 155 |
| 281 | 3300026035 | Ga0207703_10002077 | Ga0207703_1000207714 | 155 |
| 282 | 3300026035 | Ga0207703_10077839 | Ga0207703_100778392 | 155 |
| 283 | 3300026041 | Ga0207639_10280397 | Ga0207639_102803971 | 155 |
| 284 | 3300026067 | Ga0207678_10194657 | Ga0207678_101946574 | 155 |
| 285 | 3300026078 | Ga0207702_10464183 | Ga0207702_104641832 | 155 |
| 286 | 3300026088 | Ga0207641_10000100 | Ga0207641_1000010078 | 155 |
| 287 | 3300026095 | Ga0207676_10004838 | Ga0207676_1000483810 | 155 |
| 288 | 3300026116 | Ga0207674_10056465 | Ga0207674_100564652 | 155 |
| 289 | 3300026118 | Ga0207675_100002120 | Ga0207675_10000212018 | 155 |
| 290 | 3300026142 | Ga0207698_10038950 | Ga0207698_100389505 | 155 |
| 291 | 3300028379 | Ga0268266_10000040 | Ga0268266_10000040229 | 155 |
| 292 | 3300028379 | Ga0268266_10002543 | Ga0268266_1000254310 | 155 |
| 293 | 3300028380 | Ga0268265_10000128 | Ga0268265_1000012859 | 155 |
| 294 | 3300028381 | Ga0268264_10000003 | Ga0268264_10000003319 | 155 |
| 295 | 3300028381 | Ga0268264_10004589 | Ga0268264_1000458912 | 155 |
| 296 | 3300031548 | Ga0307408_100205143 | Ga0307408_1002051432 | 155 |
| 297 | 3300031852 | Ga0307410_10447841 | Ga0307410_104478412 | 155 |
| 298 | 3300031911 | Ga0307412_10000920 | Ga0307412_100009209 | 155 |
| 299 | 3300032002 | Ga0307416_100208837 | Ga0307416_1002088373 | 155 |
| 300 | 3300032004 | Ga0307414_10007116 | Ga0307414_100071166 | 155 |
| 301 | 3300032005 | Ga0307411_10074536 | Ga0307411_100745363 | 155 |
| 302 | 3300032133 | Ga0316583_10219490 | Ga0316583_102194901 | 155 |
| 303 | 3300046471 | Ga0495650_0075932 | Ga0495650_0075932_443_943 | 155 |
| 304 | 3300046513 | Ga0495616_0000153 | Ga0495616_0000153_3746_4219 | 155 |
| 305 | 3300046616 | Ga0495668_0125585 | Ga0495668_0125585_572_1045 | 155 |
| 306 | 3300048903 | Ga0496100_0199152 | Ga0496100_0199152_469_951 | 155 |
| 307 | 3300048904 | Ga0496101_0072682 | Ga0496101_0072682_977_1444 | 155 |
| 308 | 3300048904 | Ga0496101_0103428 | Ga0496101_0103428_1626_2108 | 155 |
| 309 | 3300048905 | Ga0496102_0000209 | Ga0496102_0000209_52369_52851 | 155 |
| 310 | 3300048906 | Ga0496103_0000136 | Ga0496103_0000136_59500_59982 | 155 |
| 311 | 3300048906 | Ga0496103_0002395 | Ga0496103_0002395_4715_5188 | 155 |
| 312 | 3300048908 | Ga0496105_0006268 | Ga0496105_0006268_3861_4343 | 155 |
| 313 | 3300048908 | Ga0496105_0203153 | Ga0496105_0203153_763_1236 | 155 |
| 314 | 3300048909 | Ga0496106_0270315 | Ga0496106_0270315_484_966 | 155 |
| 315 | 3300048910 | Ga0496107_0483281 | Ga0496107_0483281_370_852 | 155 |
| 316 | 3300048916 | Ga0496113_0170703 | Ga0496113_0170703_781_1263 | 155 |
| 317 | 3300048918 | Ga0496115_0073073 | Ga0496115_0073073_116_598 | 155 |
| 318 | 3300048919 | Ga0496116_0000149 | Ga0496116_0000149_116514_116981 | 155 |
| 319 | 3300048919 | Ga0496116_0008522 | Ga0496116_0008522_5966_6448 | 155 |
| 320 | 3300048920 | Ga0496117_0000526 | Ga0496117_0000526_9826_10308 | 155 |
| 321 | 3300048920 | Ga0496117_0010660 | Ga0496117_0010660_5578_6051 | 155 |
| 322 | 3300048921 | Ga0496118_0003002 | Ga0496118_0003002_4858_5340 | 155 |
| 323 | 3300048921 | Ga0496118_0014990 | Ga0496118_0014990_1211_1684 | 155 |
| 324 | 3300048921 | Ga0496118_0040884 | Ga0496118_0040884_931_1398 | 155 |
| 325 | 3300048922 | Ga0496119_0015446 | Ga0496119_0015446_4386_4868 | 155 |
| 326 | 3300048922 | Ga0496119_0023742 | Ga0496119_0023742_2297_2770 | 155 |
| 327 | 3300048923 | Ga0496120_0096447 | Ga0496120_0096447_1008_1490 | 155 |
| 328 | 3300048924 | Ga0496121_0059551 | Ga0496121_0059551_2286_2768 | 155 |
| 329 | 3300048925 | Ga0496122_0026317 | Ga0496122_0026317_2683_3150 | 155 |
| 330 | 3300048926 | Ga0496123_0002495 | Ga0496123_0002495_4500_4967 | 155 |
| 331 | 3300048927 | Ga0496124_0005279 | Ga0496124_0005279_511_978 | 155 |
| 332 | 3300048927 | Ga0496124_0025322 | Ga0496124_0025322_2108_2590 | 155 |
| 333 | 3300048927 | Ga0496124_0368197 | Ga0496124_0368197_75_548 | 155 |
| 334 | 3300048928 | Ga0496125_0028760 | Ga0496125_0028760_2405_2872 | 155 |
| 335 | 3300048928 | Ga0496125_0058857 | Ga0496125_0058857_333_815 | 155 |
| 336 | 3300048929 | Ga0496126_0000261 | Ga0496126_0000261_24593_25060 | 155 |
| 337 | 3300048929 | Ga0496126_0000365 | Ga0496126_0000365_38499_38981 | 155 |
| 338 | 3300048929 | Ga0496126_0048856 | Ga0496126_0048856_1234_1713 | 155 |
| 339 | 3300049568 | Ga0501031_0183698 | Ga0501031_0183698_653_1144 | 155 |
| 340 | 3300049571 | Ga0501034_0087683 | Ga0501034_0087683_590_1063 | 155 |
| 341 | 3300049571 | Ga0501034_0679696 | Ga0501034_0679696_182_673 | 155 |
| 342 | 3300049581 | Ga0501047_0085015 | Ga0501047_0085015_2172_2663 | 155 |
| 343 | 3300049587 | Ga0501071_0629883 | Ga0501071_0629883_54_527 | 155 |
| 344 | 3300049663 | Ga0501223_000706 | Ga0501223_000706_5395_5868 | 155 |
| 345 | 3300049664 | Ga0501224_000027 | Ga0501224_000027_26247_26720 | 155 |
| 346 | 3300049668 | Ga0501233_025828 | Ga0501233_025828_747_1220 | 155 |
| 347 | 3300049705 | Ga0501225_0000057 | Ga0501225_0000057_26872_27345 | 155 |
| 348 | 3300049707 | Ga0501234_021749 | Ga0501234_021749_503_976 | 155 |
| 349 | 3300049823 | Ga0501044_0075851 | Ga0501044_0075851_300_791 | 155 |
| 350 | 3300049853 | Ga0501226_000068 | Ga0501226_000068_26875_27348 | 155 |
| 351 | 3300050507 | nmdc:mga05p37_940997_c1 | nmdc:mga05p37_940997_c1_194_667 | 155 |
| 352 | 3300053151 | Ga0500604_0078006 | Ga0500604_0078006_523_996 | 155 |
| 353 | 3300053158 | Ga0500627_0017326 | Ga0500627_0017326_514_987 | 155 |
| 354 | 3300002459 | JGI24751J29686_10013878 | JGI24751J29686_100138782 | 156 |
| 355 | 3300003791 | Ga0055530_10061550 | Ga0055530_100615501 | 156 |
| 356 | 3300005347 | Ga0070668_100360993 | Ga0070668_1003609932 | 156 |
| 357 | 3300005355 | Ga0070671_100412615 | Ga0070671_1004126152 | 156 |
| 358 | 3300005367 | Ga0070667_100000513 | Ga0070667_10000051317 | 156 |
| 359 | 3300005468 | Ga0070707_100124009 | Ga0070707_1001240094 | 156 |
| 360 | 3300005530 | Ga0070679_100120493 | Ga0070679_1001204935 | 156 |
| 361 | 3300005530 | Ga0070679_100150339 | Ga0070679_1001503395 | 156 |
| 362 | 3300005530 | Ga0070679_101651250 | Ga0070679_1016512501 | 156 |
| 363 | 3300005577 | Ga0068857_100165210 | Ga0068857_1001652102 | 156 |
| 364 | 3300005841 | Ga0068863_100013913 | Ga0068863_1000139136 | 156 |
| 365 | 3300005843 | Ga0068860_100023043 | Ga0068860_1000230435 | 156 |
| 366 | 3300005843 | Ga0068860_100048221 | Ga0068860_1000482216 | 156 |
| 367 | 3300006177 | Ga0075362_10095994 | Ga0075362_100959943 | 156 |
| 368 | 3300009553 | Ga0105249_10147326 | Ga0105249_101473263 | 156 |
| 369 | 3300014326 | Ga0157380_10104608 | Ga0157380_101046083 | 156 |
| 370 | 3300014326 | Ga0157380_11425757 | Ga0157380_114257571 | 156 |
| 371 | 3300025298 | Ga0209050_1000784 | Ga0209050_100078427 | 156 |
| 372 | 3300025921 | Ga0207652_10043930 | Ga0207652_100439303 | 156 |
| 373 | 3300025921 | Ga0207652_10063665 | Ga0207652_100636655 | 156 |
| 374 | 3300025921 | Ga0207652_10987242 | Ga0207652_109872421 | 156 |
| 375 | 3300025922 | Ga0207646_10129915 | Ga0207646_101299152 | 156 |
| 376 | 3300025931 | Ga0207644_10381592 | Ga0207644_103815922 | 156 |
| 377 | 3300025961 | Ga0207712_10156973 | Ga0207712_101569733 | 156 |
| 378 | 3300025972 | Ga0207668_10182480 | Ga0207668_101824802 | 156 |
| 379 | 3300025986 | Ga0207658_10001126 | Ga0207658_100011268 | 156 |
| 380 | 3300026067 | Ga0207678_10099517 | Ga0207678_100995172 | 156 |
| 381 | 3300026088 | Ga0207641_10083615 | Ga0207641_100836154 | 156 |
| 382 | 3300026116 | Ga0207674_10045876 | Ga0207674_100458766 | 156 |
| 383 | 3300027665 | Ga0209983_1028317 | Ga0209983_10283172 | 156 |
| 384 | 3300028381 | Ga0268264_10015428 | Ga0268264_100154285 | 156 |
| 385 | 3300028381 | Ga0268264_10229401 | Ga0268264_102294012 | 156 |
| 386 | 3300030731 | Ga0316177_1166439 | Ga0316177_11664392 | 156 |
| 387 | 3300031731 | Ga0307405_10528624 | Ga0307405_105286242 | 156 |
| 388 | 3300031824 | Ga0307413_10083154 | Ga0307413_100831542 | 156 |
| 389 | 3300031824 | Ga0307413_10192233 | Ga0307413_101922332 | 156 |
| 390 | 3300031824 | Ga0307413_10574760 | Ga0307413_105747602 | 156 |
| 391 | 3300031852 | Ga0307410_10021352 | Ga0307410_100213524 | 156 |
| 392 | 3300031852 | Ga0307410_10096543 | Ga0307410_100965432 | 156 |
| 393 | 3300031852 | Ga0307410_10224031 | Ga0307410_102240312 | 156 |
| 394 | 3300031901 | Ga0307406_10340071 | Ga0307406_103400712 | 156 |
| 395 | 3300031903 | Ga0307407_10801921 | Ga0307407_108019212 | 156 |
| 396 | 3300031911 | Ga0307412_10085215 | Ga0307412_100852154 | 156 |
| 397 | 3300031911 | Ga0307412_10092189 | Ga0307412_100921892 | 156 |
| 398 | 3300031911 | Ga0307412_10194206 | Ga0307412_101942063 | 156 |
| 399 | 3300031911 | Ga0307412_10311846 | Ga0307412_103118462 | 156 |
| 400 | 3300031911 | Ga0307412_10501556 | Ga0307412_105015562 | 156 |
| 401 | 3300031995 | Ga0307409_100313437 | Ga0307409_1003134372 | 156 |
| 402 | 3300031995 | Ga0307409_101108572 | Ga0307409_1011085722 | 156 |
| 403 | 3300032002 | Ga0307416_100072969 | Ga0307416_1000729692 | 156 |
| 404 | 3300032004 | Ga0307414_10130503 | Ga0307414_101305034 | 156 |
| 405 | 3300032004 | Ga0307414_10146234 | Ga0307414_101462345 | 156 |
| 406 | 3300032004 | Ga0307414_10178431 | Ga0307414_101784312 | 156 |
| 407 | 3300032004 | Ga0307414_10718681 | Ga0307414_107186811 | 156 |
| 408 | 3300032004 | Ga0307414_10792965 | Ga0307414_107929652 | 156 |
| 409 | 3300032005 | Ga0307411_10081800 | Ga0307411_100818004 | 156 |
| 410 | 3300032005 | Ga0307411_10301996 | Ga0307411_103019963 | 156 |
| 411 | 3300032005 | Ga0307411_10564030 | Ga0307411_105640302 | 156 |
| 412 | 3300032126 | Ga0307415_100061896 | Ga0307415_1000618962 | 156 |
| 413 | 3300032133 | Ga0316583_10004401 | Ga0316583_100044016 | 156 |
| 414 | 3300042015 | Ga0439462_0012070 | Ga0439462_0012070_1611_2084 | 156 |
| 415 | 3300044712 | Ga0453684_0267103 | Ga0453684_0267103_956_1429 | 156 |
| 416 | 3300046460 | Ga0495638_0217303 | Ga0495638_0217303_534_1010 | 156 |
| 417 | 3300046530 | Ga0495654_0073172 | Ga0495654_0073172_547_1026 | 156 |
| 418 | 3300047443 | Ga0495687_063236 | Ga0495687_063236_167_646 | 156 |
| 419 | 3300048924 | Ga0496121_0001586 | Ga0496121_0001586_230_700 | 156 |
| 420 | 3300048927 | Ga0496124_0006606 | Ga0496124_0006606_3615_4085 | 156 |
| 421 | 3300049569 | Ga0501032_0031710 | Ga0501032_0031710_3066_3560 | 156 |
| 422 | 3300049572 | Ga0501036_0982269 | Ga0501036_0982269_107_601 | 156 |
| 423 | 3300049574 | Ga0501038_0022535 | Ga0501038_0022535_1798_2298 | 156 |
| 424 | 3300049579 | Ga0501043_0028272 | Ga0501043_0028272_3318_3812 | 156 |
| 425 | 3300049581 | Ga0501047_0004437 | Ga0501047_0004437_3300_3794 | 156 |
| 426 | 3300049582 | Ga0501048_0561443 | Ga0501048_0561443_141_635 | 156 |
| 427 | 3300049664 | Ga0501224_031630 | Ga0501224_031630_57_569 | 156 |
| 428 | 3300049823 | Ga0501044_0081514 | Ga0501044_0081514_372_866 | 156 |
| 429 | 3300053116 | Ga0500592_035320 | Ga0500592_035320_118_591 | 156 |
| 430 | 3300053117 | Ga0500593_137528 | Ga0500593_137528_400_873 | 156 |
| 431 | 3300053122 | Ga0500608_000334 | Ga0500608_000334_5647_6126 | 156 |
| 432 | 3300053125 | Ga0500618_046270 | Ga0500618_046270_356_859 | 156 |
| 433 | 3300053136 | Ga0500559_0095695 | Ga0500559_0095695_273_752 | 156 |
| 434 | 3300053138 | Ga0500564_060211 | Ga0500564_060211_835_1314 | 156 |
| 435 | 3300053139 | Ga0500568_0105685 | Ga0500568_0105685_391_864 | 156 |
| 436 | 3300053148 | Ga0500590_000767 | Ga0500590_000767_1080_1583 | 156 |
| 437 | 3300053177 | Ga0500636_0071420 | Ga0500636_0071420_1516_1995 | 156 |
| 438 | 3300053723 | Ga0500567_000030 | Ga0500567_000030_16573_17052 | 156 |
| 439 | 3300053729 | Ga0500625_000027 | Ga0500625_000027_52450_52929 | 156 |
| 440 | iso_pu_bacteria | 2643221541 | 2643730806 | 156 |
| 441 | iso_pu_bacteria | 2643221606 | 2644044541 | 156 |
| 442 | iso_pu_bacteria | 2643221671 | 2644391534 | 156 |
| 443 | 3300005353 | Ga0070669_100470863 | Ga0070669_1004708632 | 157 |
| 444 | 3300005355 | Ga0070671_100291002 | Ga0070671_1002910022 | 157 |
| 445 | 3300005367 | Ga0070667_100004694 | Ga0070667_1000046944 | 157 |
| 446 | 3300005466 | Ga0070685_10086499 | Ga0070685_100864992 | 157 |
| 447 | 3300005548 | Ga0070665_100005502 | Ga0070665_1000055029 | 157 |
| 448 | 3300005548 | Ga0070665_100966929 | Ga0070665_1009669292 | 157 |
| 449 | 3300005563 | Ga0068855_100137624 | Ga0068855_1001376244 | 157 |
| 450 | 3300005616 | Ga0068852_100464695 | Ga0068852_1004646952 | 157 |
| 451 | 3300005618 | Ga0068864_100163743 | Ga0068864_1001637431 | 157 |
| 452 | 3300005841 | Ga0068863_100000466 | Ga0068863_10000046615 | 157 |
| 453 | 3300005842 | Ga0068858_100009946 | Ga0068858_1000099466 | 157 |
| 454 | 3300005843 | Ga0068860_100000473 | Ga0068860_10000047329 | 157 |
| 455 | 3300005844 | Ga0068862_100005381 | Ga0068862_1000053816 | 157 |
| 456 | 3300005844 | Ga0068862_100013808 | Ga0068862_1000138084 | 157 |
| 457 | 3300006038 | Ga0075365_10001463 | Ga0075365_1000146314 | 157 |
| 458 | 3300006042 | Ga0075368_10000287 | Ga0075368_1000028716 | 157 |
| 459 | 3300006048 | Ga0075363_100000904 | Ga0075363_1000009042 | 157 |
| 460 | 3300006051 | Ga0075364_10055359 | Ga0075364_100553594 | 157 |
| 461 | 3300006051 | Ga0075364_10334942 | Ga0075364_103349422 | 157 |
| 462 | 3300006177 | Ga0075362_10001875 | Ga0075362_100018754 | 157 |
| 463 | 3300006177 | Ga0075362_10157457 | Ga0075362_101574572 | 157 |
| 464 | 3300006178 | Ga0075367_10000871 | Ga0075367_1000087115 | 157 |
| 465 | 3300006178 | Ga0075367_10863251 | Ga0075367_108632511 | 157 |
| 466 | 3300006195 | Ga0075366_10079432 | Ga0075366_100794322 | 157 |
| 467 | 3300006353 | Ga0075370_10017854 | Ga0075370_100178544 | 157 |
| 468 | 3300006353 | Ga0075370_10122011 | Ga0075370_101220112 | 157 |
| 469 | 3300006946 | Ga0079104_1046047 | Ga0079104_10460472 | 157 |
| 470 | 3300009011 | Ga0105251_10272905 | Ga0105251_102729052 | 157 |
| 471 | 3300009092 | Ga0105250_10151833 | Ga0105250_101518332 | 157 |
| 472 | 3300009092 | Ga0105250_10171932 | Ga0105250_101719322 | 157 |
| 473 | 3300009177 | Ga0105248_10230722 | Ga0105248_102307223 | 157 |
| 474 | 3300025903 | Ga0207680_10502387 | Ga0207680_105023872 | 157 |
| 475 | 3300025923 | Ga0207681_10409780 | Ga0207681_104097802 | 157 |
| 476 | 3300025941 | Ga0207711_10124221 | Ga0207711_101242213 | 157 |
| 477 | 3300025949 | Ga0207667_11406901 | Ga0207667_114069011 | 157 |
| 478 | 3300025972 | Ga0207668_10906167 | Ga0207668_109061672 | 157 |
| 479 | 3300025986 | Ga0207658_10003756 | Ga0207658_1000375610 | 157 |
| 480 | 3300026035 | Ga0207703_10003308 | Ga0207703_100033089 | 157 |
| 481 | 3300026088 | Ga0207641_10000098 | Ga0207641_1000009839 | 157 |
| 482 | 3300026095 | Ga0207676_10141458 | Ga0207676_101414584 | 157 |
| 483 | 3300027866 | Ga0209813_10000027 | Ga0209813_1000002753 | 157 |
| 484 | 3300028379 | Ga0268266_10008044 | Ga0268266_100080446 | 157 |
| 485 | 3300028379 | Ga0268266_10583339 | Ga0268266_105833391 | 157 |
| 486 | 3300028380 | Ga0268265_10003510 | Ga0268265_1000351013 | 157 |
| 487 | 3300028380 | Ga0268265_10005291 | Ga0268265_100052918 | 157 |
| 488 | 3300028381 | Ga0268264_10000224 | Ga0268264_1000022480 | 157 |
| 489 | 3300031731 | Ga0307405_10745876 | Ga0307405_107458761 | 157 |
| 490 | 3300031824 | Ga0307413_11785523 | Ga0307413_117855231 | 157 |
| 491 | 3300031911 | Ga0307412_10083969 | Ga0307412_100839692 | 157 |
| 492 | 3300041997 | Ga0439431_0086077 | Ga0439431_0086077_280_759 | 157 |
| 493 | 3300042436 | Ga0439435_0031583 | Ga0439435_0031583_792_1271 | 157 |
| 494 | 3300048906 | Ga0496103_0459819 | Ga0496103_0459819_213_692 | 157 |
| 495 | 3300048908 | Ga0496105_0009539 | Ga0496105_0009539_3705_4181 | 157 |
| 496 | 3300048908 | Ga0496105_0426175 | Ga0496105_0426175_481_957 | 157 |
| 497 | 3300048920 | Ga0496117_0089427 | Ga0496117_0089427_1228_1704 | 157 |
| 498 | 3300048923 | Ga0496120_0062436 | Ga0496120_0062436_1118_1594 | 157 |
| 499 | 3300048924 | Ga0496121_0002667 | Ga0496121_0002667_22152_22628 | 157 |
| 500 | 3300049571 | Ga0501034_0808514 | Ga0501034_0808514_248_733 | 157 |
| 501 | 3300049573 | Ga0501037_0260032 | Ga0501037_0260032_556_1032 | 157 |
| 502 | 3300049575 | Ga0501039_0331637 | Ga0501039_0331637_700_1176 | 157 |
| 503 | 3300049581 | Ga0501047_0478095 | Ga0501047_0478095_338_826 | 157 |
| 504 | 3300049589 | Ga0501073_0246433 | Ga0501073_0246433_256_741 | 157 |
| 505 | 3300049822 | Ga0501035_0384132 | Ga0501035_0384132_115_597 | 157 |
| 506 | 3300049823 | Ga0501044_0024420 | Ga0501044_0024420_2159_2635 | 157 |
| 507 | 3300049823 | Ga0501044_0390785 | Ga0501044_0390785_121_600 | 157 |
| 508 | 3300050489 | nmdc:mga03683_138761_c1 | nmdc:mga03683_138761_c1_406_912 | 157 |
| 509 | 3300050489 | nmdc:mga03683_164_c1 | nmdc:mga03683_164_c1_12268_12747 | 157 |
| 510 | 3300050491 | nmdc:mga00v17_671904_c1 | nmdc:mga00v17_671904_c1_80_559 | 157 |
| 511 | 3300050491 | nmdc:mga00v17_79048_c1 | nmdc:mga00v17_79048_c1_742_1221 | 157 |
| 512 | 3300050492 | nmdc:mga0yw44_107595_c1 | nmdc:mga0yw44_107595_c1_564_1043 | 157 |
| 513 | 3300050493 | nmdc:mga0k408_45592_c1 | nmdc:mga0k408_45592_c1_742_1221 | 157 |
| 514 | 3300050493 | nmdc:mga0k408_9510_c1 | nmdc:mga0k408_9510_c1_580_1056 | 157 |
| 515 | 3300050494 | nmdc:mga06z11_140_c1 | nmdc:mga06z11_140_c1_10501_10980 | 157 |
| 516 | 3300050495 | nmdc:mga04h51_48_c1 | nmdc:mga04h51_48_c1_13207_13686 | 157 |
| 517 | 3300050496 | nmdc:mga07m45_118275_c1 | nmdc:mga07m45_118275_c1_625_1104 | 157 |
| 518 | 3300050496 | nmdc:mga07m45_9_c1 | nmdc:mga07m45_9_c1_163570_164049 | 157 |
| 519 | 3300050516 | nmdc:mga0sz30_8482_c1 | nmdc:mga0sz30_8482_c1_2663_3142 | 157 |
| 520 | 3300053087 | Ga0500643_000005 | Ga0500643_000005_298961_299434 | 157 |
| 521 | 3300053121 | Ga0500607_002009 | Ga0500607_002009_14033_14515 | 157 |
| 522 | 3300053146 | Ga0500588_0077957 | Ga0500588_0077957_155_646 | 157 |
| 523 | 3300053151 | Ga0500604_0041115 | Ga0500604_0041115_712_1185 | 157 |
| 524 | 3300053153 | Ga0500616_0001003 | Ga0500616_0001003_4249_4722 | 157 |
| 525 | 3300053156 | Ga0500622_0122029 | Ga0500622_0122029_263_754 | 157 |
| 526 | 3300001915 | JGI24741J21665_1030381 | JGI24741J21665_10303811 | 158 |
| 527 | 3300001979 | JGI24740J21852_10104351 | JGI24740J21852_101043512 | 158 |
| 528 | 3300002239 | JGI24034J26672_10049767 | JGI24034J26672_100497671 | 158 |
| 529 | 3300005327 | Ga0070658_10005850 | Ga0070658_100058507 | 158 |
| 530 | 3300005327 | Ga0070658_10061342 | Ga0070658_100613423 | 158 |
| 531 | 3300005328 | Ga0070676_10163105 | Ga0070676_101631052 | 158 |
| 532 | 3300005329 | Ga0070683_100065348 | Ga0070683_1000653484 | 158 |
| 533 | 3300005335 | Ga0070666_10033802 | Ga0070666_100338024 | 158 |
| 534 | 3300005336 | Ga0070680_100050345 | Ga0070680_1000503452 | 158 |
| 535 | 3300005336 | Ga0070680_100186823 | Ga0070680_1001868233 | 158 |
| 536 | 3300005337 | Ga0070682_100632998 | Ga0070682_1006329982 | 158 |
| 537 | 3300005339 | Ga0070660_100042448 | Ga0070660_1000424482 | 158 |
| 538 | 3300005339 | Ga0070660_100051571 | Ga0070660_1000515714 | 158 |
| 539 | 3300005344 | Ga0070661_100001389 | Ga0070661_10000138917 | 158 |
| 540 | 3300005345 | Ga0070692_10175896 | Ga0070692_101758962 | 158 |
| 541 | 3300005353 | Ga0070669_100000280 | Ga0070669_10000028014 | 158 |
| 542 | 3300005355 | Ga0070671_100000005 | Ga0070671_100000005106 | 158 |
| 543 | 3300005366 | Ga0070659_100039475 | Ga0070659_1000394752 | 158 |
| 544 | 3300005367 | Ga0070667_100093007 | Ga0070667_1000930072 | 158 |
| 545 | 3300005455 | Ga0070663_101619535 | Ga0070663_1016195351 | 158 |
| 546 | 3300005456 | Ga0070678_100126175 | Ga0070678_1001261752 | 158 |
| 547 | 3300005457 | Ga0070662_100007379 | Ga0070662_1000073796 | 158 |
| 548 | 3300005457 | Ga0070662_100011103 | Ga0070662_1000111034 | 158 |
| 549 | 3300005457 | Ga0070662_100107279 | Ga0070662_1001072795 | 158 |
| 550 | 3300005458 | Ga0070681_10003398 | Ga0070681_100033982 | 158 |
| 551 | 3300005530 | Ga0070679_100007479 | Ga0070679_1000074799 | 158 |
| 552 | 3300005535 | Ga0070684_100203640 | Ga0070684_1002036402 | 158 |
| 553 | 3300005539 | Ga0068853_100040907 | Ga0068853_1000409072 | 158 |
| 554 | 3300005539 | Ga0068853_100462054 | Ga0068853_1004620541 | 158 |
| 555 | 3300005539 | Ga0068853_100560360 | Ga0068853_1005603602 | 158 |
| 556 | 3300005544 | Ga0070686_100014214 | Ga0070686_1000142146 | 158 |
| 557 | 3300005548 | Ga0070665_100635539 | Ga0070665_1006355392 | 158 |
| 558 | 3300005563 | Ga0068855_100005378 | Ga0068855_1000053782 | 158 |
| 559 | 3300005563 | Ga0068855_100007675 | Ga0068855_1000076757 | 158 |
| 560 | 3300005563 | Ga0068855_100273237 | Ga0068855_1002732372 | 158 |
| 561 | 3300005564 | Ga0070664_100016187 | Ga0070664_1000161877 | 158 |
| 562 | 3300005564 | Ga0070664_100063041 | Ga0070664_1000630415 | 158 |
| 563 | 3300005577 | Ga0068857_101374411 | Ga0068857_1013744112 | 158 |
| 564 | 3300005578 | Ga0068854_100053631 | Ga0068854_1000536313 | 158 |
| 565 | 3300005614 | Ga0068856_100011950 | Ga0068856_1000119502 | 158 |
| 566 | 3300005618 | Ga0068864_100018960 | Ga0068864_1000189602 | 158 |
| 567 | 3300005842 | Ga0068858_100060889 | Ga0068858_1000608893 | 158 |
| 568 | 3300005843 | Ga0068860_100776938 | Ga0068860_1007769381 | 158 |
| 569 | 3300005844 | Ga0068862_102018123 | Ga0068862_1020181231 | 158 |
| 570 | 3300006051 | Ga0075364_10002645 | Ga0075364_100026457 | 158 |
| 571 | 3300006353 | Ga0075370_10542908 | Ga0075370_105429082 | 158 |
| 572 | 3300009101 | Ga0105247_10487528 | Ga0105247_104875282 | 158 |
| 573 | 3300009177 | Ga0105248_10070601 | Ga0105248_100706012 | 158 |
| 574 | 3300010375 | Ga0105239_10204978 | Ga0105239_102049782 | 158 |
| 575 | 3300011119 | Ga0105246_10001552 | Ga0105246_1000155210 | 158 |
| 576 | 3300013100 | Ga0157373_10006736 | Ga0157373_100067363 | 158 |
| 577 | 3300013100 | Ga0157373_10036270 | Ga0157373_100362703 | 158 |
| 578 | 3300013100 | Ga0157373_10340324 | Ga0157373_103403242 | 158 |
| 579 | 3300013102 | Ga0157371_10000785 | Ga0157371_1000078518 | 158 |
| 580 | 3300013104 | Ga0157370_10001694 | Ga0157370_1000169411 | 158 |
| 581 | 3300013105 | Ga0157369_10012283 | Ga0157369_1001228311 | 158 |
| 582 | 3300013306 | Ga0163162_11761576 | Ga0163162_117615762 | 158 |
| 583 | 3300013307 | Ga0157372_10029102 | Ga0157372_100291027 | 158 |
| 584 | 3300013307 | Ga0157372_10705751 | Ga0157372_107057512 | 158 |
| 585 | 3300013308 | Ga0157375_10144108 | Ga0157375_101441082 | 158 |
| 586 | 3300013308 | Ga0157375_10179481 | Ga0157375_101794812 | 158 |
| 587 | 3300014745 | Ga0157377_10024862 | Ga0157377_100248622 | 158 |
| 588 | 3300025315 | Ga0207697_10115308 | Ga0207697_101153082 | 158 |
| 589 | 3300025900 | Ga0207710_10294186 | Ga0207710_102941861 | 158 |
| 590 | 3300025903 | Ga0207680_10038091 | Ga0207680_100380913 | 158 |
| 591 | 3300025909 | Ga0207705_10004092 | Ga0207705_100040926 | 158 |
| 592 | 3300025909 | Ga0207705_10010322 | Ga0207705_100103225 | 158 |
| 593 | 3300025909 | Ga0207705_10013576 | Ga0207705_100135765 | 158 |
| 594 | 3300025912 | Ga0207707_10042051 | Ga0207707_100420513 | 158 |
| 595 | 3300025917 | Ga0207660_10097427 | Ga0207660_100974272 | 158 |
| 596 | 3300025919 | Ga0207657_10000156 | Ga0207657_1000015651 | 158 |
| 597 | 3300025920 | Ga0207649_10049011 | Ga0207649_100490114 | 158 |
| 598 | 3300025921 | Ga0207652_10029192 | Ga0207652_100291925 | 158 |
| 599 | 3300025921 | Ga0207652_10232045 | Ga0207652_102320452 | 158 |
| 600 | 3300025921 | Ga0207652_11156991 | Ga0207652_111569912 | 158 |
| 601 | 3300025923 | Ga0207681_10000096 | Ga0207681_1000009618 | 158 |
| 602 | 3300025931 | Ga0207644_10000008 | Ga0207644_10000008219 | 158 |
| 603 | 3300025932 | Ga0207690_10010558 | Ga0207690_100105585 | 158 |
| 604 | 3300025932 | Ga0207690_10041541 | Ga0207690_100415416 | 158 |
| 605 | 3300025932 | Ga0207690_10712426 | Ga0207690_107124262 | 158 |
| 606 | 3300025932 | Ga0207690_10782312 | Ga0207690_107823122 | 158 |
| 607 | 3300025933 | Ga0207706_10001803 | Ga0207706_1000180317 | 158 |
| 608 | 3300025933 | Ga0207706_10012286 | Ga0207706_100122867 | 158 |
| 609 | 3300025933 | Ga0207706_10072887 | Ga0207706_100728875 | 158 |
| 610 | 3300025941 | Ga0207711_11398261 | Ga0207711_113982612 | 158 |
| 611 | 3300025944 | Ga0207661_10025722 | Ga0207661_100257227 | 158 |
| 612 | 3300025944 | Ga0207661_10432261 | Ga0207661_104322612 | 158 |
| 613 | 3300025945 | Ga0207679_10050397 | Ga0207679_100503972 | 158 |
| 614 | 3300025945 | Ga0207679_10681731 | Ga0207679_106817312 | 158 |
| 615 | 3300025949 | Ga0207667_10002631 | Ga0207667_100026315 | 158 |
| 616 | 3300025949 | Ga0207667_10008785 | Ga0207667_100087857 | 158 |
| 617 | 3300025949 | Ga0207667_10246079 | Ga0207667_102460792 | 158 |
| 618 | 3300025981 | Ga0207640_10035619 | Ga0207640_100356193 | 158 |
| 619 | 3300025986 | Ga0207658_10275454 | Ga0207658_102754541 | 158 |
| 620 | 3300026041 | Ga0207639_10001184 | Ga0207639_100011845 | 158 |
| 621 | 3300026041 | Ga0207639_10474822 | Ga0207639_104748222 | 158 |
| 622 | 3300026067 | Ga0207678_10007056 | Ga0207678_100070562 | 158 |
| 623 | 3300026067 | Ga0207678_10143527 | Ga0207678_101435273 | 158 |
| 624 | 3300026078 | Ga0207702_10235282 | Ga0207702_102352822 | 158 |
| 625 | 3300026078 | Ga0207702_10894557 | Ga0207702_108945572 | 158 |
| 626 | 3300026095 | Ga0207676_10026680 | Ga0207676_100266802 | 158 |
| 627 | 3300026116 | Ga0207674_10009464 | Ga0207674_100094645 | 158 |
| 628 | 3300026116 | Ga0207674_10049173 | Ga0207674_100491732 | 158 |
| 629 | 3300026121 | Ga0207683_10248083 | Ga0207683_102480831 | 158 |
| 630 | 3300026142 | Ga0207698_10397518 | Ga0207698_103975181 | 158 |
| 631 | 3300028379 | Ga0268266_10269197 | Ga0268266_102691972 | 158 |
| 632 | 3300028381 | Ga0268264_10036868 | Ga0268264_100368685 | 158 |
| 633 | 3300031548 | Ga0307408_101257004 | Ga0307408_1012570041 | 158 |
| 634 | 3300031691 | Ga0316579_10032772 | Ga0316579_100327723 | 158 |
| 635 | 3300031731 | Ga0307405_10272817 | Ga0307405_102728172 | 158 |
| 636 | 3300031901 | Ga0307406_11477273 | Ga0307406_114772731 | 158 |
| 637 | 3300031911 | Ga0307412_10224887 | Ga0307412_102248871 | 158 |
| 638 | 3300031911 | Ga0307412_10877422 | Ga0307412_108774222 | 158 |
| 639 | 3300032002 | Ga0307416_101144883 | Ga0307416_1011448831 | 158 |
| 640 | 3300032004 | Ga0307414_10020591 | Ga0307414_100205916 | 158 |
| 641 | 3300032004 | Ga0307414_10028547 | Ga0307414_100285472 | 158 |
| 642 | 3300032004 | Ga0307414_10357598 | Ga0307414_103575982 | 158 |
| 643 | 3300032004 | Ga0307414_11104324 | Ga0307414_111043241 | 158 |
| 644 | 3300032005 | Ga0307411_10217148 | Ga0307411_102171483 | 158 |
| 645 | 3300036647 | Ga0316582_0000131 | Ga0316582_0000131_3397_3918 | 158 |
| 646 | 3300041498 | Ga0451841_0878360 | Ga0451841_0878360_375_851 | 158 |
| 647 | 3300046512 | Ga0495610_0305485 | Ga0495610_0305485_95_592 | 158 |
| 648 | 3300048903 | Ga0496100_0018122 | Ga0496100_0018122_430_927 | 158 |
| 649 | 3300048904 | Ga0496101_0107562 | Ga0496101_0107562_689_1186 | 158 |
| 650 | 3300048905 | Ga0496102_0055768 | Ga0496102_0055768_946_1443 | 158 |
| 651 | 3300048906 | Ga0496103_0016230 | Ga0496103_0016230_2537_3034 | 158 |
| 652 | 3300048907 | Ga0496104_0142986 | Ga0496104_0142986_426_923 | 158 |
| 653 | 3300048908 | Ga0496105_0040280 | Ga0496105_0040280_876_1373 | 158 |
| 654 | 3300048908 | Ga0496105_0302663 | Ga0496105_0302663_761_1243 | 158 |
| 655 | 3300048909 | Ga0496106_0004392 | Ga0496106_0004392_1686_2183 | 158 |
| 656 | 3300048910 | Ga0496107_0005831 | Ga0496107_0005831_4314_4811 | 158 |
| 657 | 3300048911 | Ga0496108_0268966 | Ga0496108_0268966_206_703 | 158 |
| 658 | 3300048912 | Ga0496109_0518126 | Ga0496109_0518126_559_1056 | 158 |
| 659 | 3300048913 | Ga0496110_0108760 | Ga0496110_0108760_1921_2418 | 158 |
| 660 | 3300048915 | Ga0496112_0507864 | Ga0496112_0507864_203_700 | 158 |
| 661 | 3300048916 | Ga0496113_0001214 | Ga0496113_0001214_10255_10752 | 158 |
| 662 | 3300048917 | Ga0496114_0073823 | Ga0496114_0073823_855_1337 | 158 |
| 663 | 3300048924 | Ga0496121_0000024 | Ga0496121_0000024_143212_143706 | 158 |
| 664 | 3300049571 | Ga0501034_0451467 | Ga0501034_0451467_82_579 | 158 |
| 665 | 3300050489 | nmdc:mga03683_10563_c1 | nmdc:mga03683_10563_c1_1976_2464 | 158 |
| 666 | 3300050491 | nmdc:mga00v17_357_c1 | nmdc:mga00v17_357_c1_537_1025 | 158 |
| 667 | 3300050491 | nmdc:mga00v17_611975_c1 | nmdc:mga00v17_611975_c1_15_509 | 158 |
| 668 | 3300050496 | nmdc:mga07m45_560937_c1 | nmdc:mga07m45_560937_c1_150_635 | 158 |
| 669 | 3300050516 | nmdc:mga0sz30_7685_c1 | nmdc:mga0sz30_7685_c1_344_832 | 158 |
| 670 | iso_pu_bacteria | 2882806704 | 2882809244 | 158 |
| 671 | 3300005289 | Ga0065704_10084844 | Ga0065704_100848442 | 159 |
| 672 | 3300005327 | Ga0070658_10001686 | Ga0070658_1000168612 | 159 |
| 673 | 3300005539 | Ga0068853_100843839 | Ga0068853_1008438392 | 159 |
| 674 | 3300005563 | Ga0068855_101280560 | Ga0068855_1012805601 | 159 |
| 675 | 3300005577 | Ga0068857_100273739 | Ga0068857_1002737392 | 159 |
| 676 | 3300005578 | Ga0068854_100014709 | Ga0068854_1000147094 | 159 |
| 677 | 3300005578 | Ga0068854_100909848 | Ga0068854_1009098482 | 159 |
| 678 | 3300005614 | Ga0068856_100027069 | Ga0068856_1000270693 | 159 |
| 679 | 3300005616 | Ga0068852_100000174 | Ga0068852_10000017429 | 159 |
| 680 | 3300005834 | Ga0068851_10183448 | Ga0068851_101834482 | 159 |
| 681 | 3300006048 | Ga0075363_100000629 | Ga0075363_1000006298 | 159 |
| 682 | 3300006051 | Ga0075364_10151124 | Ga0075364_101511242 | 159 |
| 683 | 3300006177 | Ga0075362_10000043 | Ga0075362_1000004324 | 159 |
| 684 | 3300006178 | Ga0075367_10255167 | Ga0075367_102551672 | 159 |
| 685 | 3300006195 | Ga0075366_10000830 | Ga0075366_1000083014 | 159 |
| 686 | 3300006353 | Ga0075370_10000002 | Ga0075370_10000002140 | 159 |
| 687 | 3300006353 | Ga0075370_10055104 | Ga0075370_100551043 | 159 |
| 688 | 3300006946 | Ga0079104_1031823 | Ga0079104_10318232 | 159 |
| 689 | 3300009093 | Ga0105240_10002147 | Ga0105240_1000214721 | 159 |
| 690 | 3300009094 | Ga0111539_11919351 | Ga0111539_119193512 | 159 |
| 691 | 3300009174 | Ga0105241_10545035 | Ga0105241_105450352 | 159 |
| 692 | 3300009177 | Ga0105248_10340473 | Ga0105248_103404732 | 159 |
| 693 | 3300009545 | Ga0105237_10884958 | Ga0105237_108849582 | 159 |
| 694 | 3300017792 | Ga0163161_10075125 | Ga0163161_100751253 | 159 |
| 695 | 3300025315 | Ga0207697_10307810 | Ga0207697_103078102 | 159 |
| 696 | 3300025321 | Ga0207656_10408355 | Ga0207656_104083551 | 159 |
| 697 | 3300025904 | Ga0207647_10016274 | Ga0207647_100162745 | 159 |
| 698 | 3300025909 | Ga0207705_10000007 | Ga0207705_10000007530 | 159 |
| 699 | 3300025913 | Ga0207695_10001471 | Ga0207695_1000147110 | 159 |
| 700 | 3300025914 | Ga0207671_10260172 | Ga0207671_102601722 | 159 |
| 701 | 3300025949 | Ga0207667_10352524 | Ga0207667_103525241 | 159 |
| 702 | 3300025949 | Ga0207667_10533107 | Ga0207667_105331072 | 159 |
| 703 | 3300025972 | Ga0207668_10054318 | Ga0207668_100543182 | 159 |
| 704 | 3300025981 | Ga0207640_10002520 | Ga0207640_100025209 | 159 |
| 705 | 3300025986 | Ga0207658_11224592 | Ga0207658_112245922 | 159 |
| 706 | 3300026041 | Ga0207639_10200615 | Ga0207639_102006152 | 159 |
| 707 | 3300026078 | Ga0207702_10011176 | Ga0207702_100111763 | 159 |
| 708 | 3300026116 | Ga0207674_10135300 | Ga0207674_101353003 | 159 |
| 709 | 3300026142 | Ga0207698_10000098 | Ga0207698_1000009824 | 159 |
| 710 | 3300028379 | Ga0268266_10569806 | Ga0268266_105698063 | 159 |
| 711 | 3300035112 | Ga0373932_0096501 | Ga0373932_0096501_38_562 | 159 |
| 712 | 3300035121 | Ga0373960_0078111 | Ga0373960_0078111_352_876 | 159 |
| 713 | 3300048907 | Ga0496104_0229837 | Ga0496104_0229837_640_1131 | 159 |
| 714 | 3300048908 | Ga0496105_0319403 | Ga0496105_0319403_667_1158 | 159 |
| 715 | 3300048927 | Ga0496124_0779675 | Ga0496124_0779675_38_526 | 159 |
| 716 | 3300050489 | nmdc:mga03683_3_c1 | nmdc:mga03683_3_c1_186475_187002 | 159 |
| 717 | 3300050490 | nmdc:mga03n38_243_c1 | nmdc:mga03n38_243_c1_4027_4554 | 159 |
| 718 | 3300050491 | nmdc:mga00v17_145892_c1 | nmdc:mga00v17_145892_c1_379_906 | 159 |
| 719 | 3300050493 | nmdc:mga0k408_2_c1 | nmdc:mga0k408_2_c1_363717_364244 | 159 |
| 720 | 3300050496 | nmdc:mga07m45_1_c1 | nmdc:mga07m45_1_c1_258645_259169 | 159 |
| 721 | 3300050496 | nmdc:mga07m45_256_c1 | nmdc:mga07m45_256_c1_907_1392 | 159 |
| 722 | 3300050511 | nmdc:mga08y16_1471492_c1 | nmdc:mga08y16_1471492_c1_38_565 | 159 |
| 723 | 3300053125 | Ga0500618_002917 | Ga0500618_002917_3089_3586 | 159 |
| 724 | 2162886007 | SwRhRL2b_contig_2375226 | SwRhRL2b_0484.00006300 | 160 |
| 725 | 3300005289 | Ga0065704_10070157 | Ga0065704_1007015729 | 160 |
| 726 | 3300005327 | Ga0070658_10249434 | Ga0070658_102494342 | 160 |
| 727 | 3300005563 | Ga0068855_100069885 | Ga0068855_1000698853 | 160 |
| 728 | 3300005618 | Ga0068864_100222879 | Ga0068864_1002228792 | 160 |
| 729 | 3300005841 | Ga0068863_101380064 | Ga0068863_1013800642 | 160 |
| 730 | 3300005844 | Ga0068862_100247202 | Ga0068862_1002472023 | 160 |
| 731 | 3300006058 | Ga0075432_10000636 | Ga0075432_1000063610 | 160 |
| 732 | 3300006195 | Ga0075366_10087476 | Ga0075366_100874762 | 160 |
| 733 | 3300006195 | Ga0075366_10628441 | Ga0075366_106284411 | 160 |
| 734 | 3300006353 | Ga0075370_10009387 | Ga0075370_100093873 | 160 |
| 735 | 3300006353 | Ga0075370_10056327 | Ga0075370_100563273 | 160 |
| 736 | 3300009177 | Ga0105248_10047334 | Ga0105248_100473343 | 160 |
| 737 | 3300013102 | Ga0157371_10067925 | Ga0157371_100679253 | 160 |
| 738 | 3300025903 | Ga0207680_10420056 | Ga0207680_104200562 | 160 |
| 739 | 3300025931 | Ga0207644_10002058 | Ga0207644_100020584 | 160 |
| 740 | 3300025941 | Ga0207711_10155432 | Ga0207711_101554323 | 160 |
| 741 | 3300025949 | Ga0207667_10056598 | Ga0207667_100565984 | 160 |
| 742 | 3300025949 | Ga0207667_10102292 | Ga0207667_101022921 | 160 |
| 743 | 3300026095 | Ga0207676_10483568 | Ga0207676_104835682 | 160 |
| 744 | 3300026142 | Ga0207698_10054747 | Ga0207698_100547473 | 160 |
| 745 | 3300026142 | Ga0207698_11417413 | Ga0207698_114174131 | 160 |
| 746 | 3300027907 | Ga0207428_10021045 | Ga0207428_100210455 | 160 |
| 747 | 3300028380 | Ga0268265_10262033 | Ga0268265_102620332 | 160 |
| 748 | 3300031731 | Ga0307405_11006616 | Ga0307405_110066162 | 160 |
| 749 | 3300046460 | Ga0495638_0082949 | Ga0495638_0082949_476_964 | 160 |
| 750 | 3300046507 | Ga0495606_0196315 | Ga0495606_0196315_306_809 | 160 |
| 751 | 3300046512 | Ga0495610_0012788 | Ga0495610_0012788_1043_1546 | 160 |
| 752 | 3300046519 | Ga0495632_0285947 | Ga0495632_0285947_39_527 | 160 |
| 753 | 3300046522 | Ga0495643_0097153 | Ga0495643_0097153_838_1341 | 160 |
| 754 | 3300048091 | Ga0495626_0001180 | Ga0495626_0001180_4494_4997 | 160 |
| 755 | 3300048905 | Ga0496102_0315077 | Ga0496102_0315077_85_591 | 160 |
| 756 | 3300048906 | Ga0496103_0045736 | Ga0496103_0045736_136_642 | 160 |
| 757 | 3300048919 | Ga0496116_0020693 | Ga0496116_0020693_919_1425 | 160 |
| 758 | 3300048921 | Ga0496118_0023491 | Ga0496118_0023491_1681_2187 | 160 |
| 759 | 3300049570 | Ga0501033_0793166 | Ga0501033_0793166_54_557 | 160 |
| 760 | 3300050493 | nmdc:mga0k408_653273_c1 | nmdc:mga0k408_653273_c1_58_549 | 160 |
| 761 | 3300050496 | nmdc:mga07m45_18528_c1 | nmdc:mga07m45_18528_c1_1207_1701 | 160 |
| 762 | 3300050496 | nmdc:mga07m45_5276_c1 | nmdc:mga07m45_5276_c1_4003_4494 | 160 |
| 763 | 3300050514 | nmdc:mga08x19_303034_c1 | nmdc:mga08x19_303034_c1_470_964 | 160 |
| 764 | 3300053087 | Ga0500643_102818 | Ga0500643_102818_106_594 | 160 |
| 765 | 3300053103 | Ga0500555_139243 | Ga0500555_139243_34_525 | 160 |
| 766 | 3300053108 | Ga0500562_028676 | Ga0500562_028676_69_560 | 160 |
| 767 | 3300053121 | Ga0500607_000473 | Ga0500607_000473_34532_35023 | 160 |
| 768 | 3300053136 | Ga0500559_0002117 | Ga0500559_0002117_3849_4340 | 160 |
| 769 | 3300053136 | Ga0500559_0002682 | Ga0500559_0002682_2294_2785 | 160 |
| 770 | 3300053148 | Ga0500590_009605 | Ga0500590_009605_3007_3498 | 160 |
| 771 | 3300053178 | Ga0500637_0001962 | Ga0500637_0001962_6215_6706 | 160 |
| 772 | 3300053730 | Ga0500645_002625 | Ga0500645_002625_3827_4318 | 160 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2cu6-assembly1.cif.gz_A | crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 | 0.7714 | 63 | 153 |
| 2cu6-assembly1.cif.gz_A | crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 | 0.7568 | 63 | 153 |
| 1wcj-assembly1.cif.gz_A | conserved hypothetical protein tm0487 from thermotoga maritima | 0.7471 | 65 | 158 |
| 3lno-assembly1.cif.gz_A | crystal structure of domain of unknown function duf59 from bacillus anthracis | 0.7417 | 62 | 160 |
| 4qq0-assembly1.cif.gz_A | cdsd - the structural protein of the type iii secretion system of chlamydia trachomatis: c-terminal domain | 0.7344 | 63 | 142 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q0JJS8_71_163_3.30.300.130 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.8827 | 64 | 149 | 3.30.300.130 |
| af_Q0JJS8_71_163_3.30.300.130 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.8136 | 64 | 149 | 3.30.300.130 |
| af_Q8II78_18_117_3.30.300.130 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.8075 | 64 | 151 | 3.30.300.130 |
| af_P0AFH8_57_122_3.30.1340.30 | Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;; | 0.7958 | 61 | 141 | 3.30.1340.30 |
| af_P0AFH8_57_122_3.30.1340.30 | Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;; | 0.7853 | 61 | 141 | 3.30.1340.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G0VN27-F1-model_v4 | FeS assembly SUF system protein | 0.9573 | 63 | 142 |
|
| AF-A0A497GU73-F1-model_v4 | Aromatic ring hydroxylase | 0.9489 | 65 | 140 |
|
| AF-A0A3A1MLC0-F1-model_v4 | DUF59 domain-containing protein | 0.9445 | 62 | 139 |
|
| AF-A0A523XVX3-F1-model_v4 | DUF59 domain-containing protein | 0.9403 | 63 | 139 |
|
| AF-A0A496LTY7-F1-model_v4 | Metal-sulfur cluster assembly factor | 0.933 | 65 | 139 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar