F480124
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 772 | 381 | 726 | 295 |
Family's Representative Sequence
| Representative Sequence | 3300035410|Ga0373924_0145528|Ga0373924_0145528_28_1002 |
| Length | 324 |
| Sequence | MASRRAARLTFGASSHKTLRCAQRDNAAMHTPLPDTLCYLNGEYLPLNEAKVSVLDRGFIFGDGIYEVVPVYGKKLFCFDEHLARLGRSLAKLRIANPHSRDQWLERCRKLIAALAERGGATDQLVYIQVTRGVALRDHVMPVGVEPTVFMMANAMKPASGEQRHHGVACVSARDFRWERGDIKSTSLLGNVLARQMSADHDAVETIMFRGGYLTEASASNVWIVHEGAVLGAPKSEHVLEGIRYELIKELCEECGIAYNLRPIAEADVTAADEILLSSATKEVLPVTTLDGEGVGHGALRGKPGPVYARLYEAYQRAKLTQTI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 2 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 3 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 4 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 5 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 6 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 7 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 8 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 9 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 10 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 11 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 12 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 13 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 14 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 15 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 16 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 17 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 18 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 19 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 20 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 21 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 22 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 23 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 24 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 25 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 26 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 27 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 28 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 29 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 30 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 31 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 32 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 33 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 34 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 35 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 36 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 37 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 38 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 39 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 40 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 41 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 42 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 43 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 44 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 45 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 46 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 47 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 48 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 49 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 50 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 51 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 52 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 53 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 54 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 55 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 56 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 57 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 60 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 63 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 66 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 82 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 87 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 92 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 94 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 97 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 98 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 99 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 100 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 101 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 102 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 103 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 104 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 105 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 106 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 107 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 108 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 109 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 110 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 111 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 112 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 113 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 114 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 115 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 117 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 118 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 119 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 120 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 141 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 145 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 148 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 229 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 230 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 231 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 232 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 233 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 234 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 235 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 236 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 237 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 238 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 239 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 240 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 241 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 242 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 243 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 244 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 245 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 246 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 247 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 248 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 249 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 250 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 251 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 253 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 254 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 257 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 258 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 259 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 260 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 262 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 263 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 265 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 266 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 267 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 268 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 271 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 275 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 276 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 277 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 278 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 279 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 280 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 281 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 282 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 313 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 314 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 315 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 316 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 317 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 318 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 321 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 322 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 323 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 324 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 325 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 326 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 327 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 328 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 329 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 330 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 331 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 336 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 337 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 338 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 340 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 341 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 342 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 343 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 344 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 345 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 346 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 347 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 350 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 354 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 355 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 356 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 357 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 358 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 359 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 360 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 361 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 362 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 363 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 364 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 365 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 366 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 367 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 368 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 369 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 370 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 371 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 372 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 373 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 374 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 375 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 376 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 377 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 378 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 379 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 380 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 381 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.78 |
| Metatranscriptomes | 0.26 |
| Isolates | 5.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.95 |
| Nodule | 0.13 |
| Rhizoplane | 3.63 |
| Rhizosphere | 68.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10011450 | 3300001979 | Bacteria | 3375 |
| 2 | JGI24739J22299_10020291 | 3300001989 | Bacteria | 2374 |
| 3 | JGI25152J39213_1001430 | 3300002773 | Bacteria | 10303 |
| 4 | JGI25153J46596_10006137 | 3300003215 | Bacteria | 6160 |
| 5 | JGI25153J46596_10029984 | 3300003215 | Bacteria | 1859 |
| 6 | rootH1_10059918 | 3300003316 | Bacteria | 2257 |
| 7 | rootH2_10090249 | 3300003320 | Bacteria | 2666 |
| 8 | rootL2_10074920 | 3300003322 | Bacteria | 2223 |
| 9 | rootL2_10190253 | 3300003322 | Bacteria | 1773 |
| 10 | rootH1_10182120 | 3300003323 | Bacteria | 3236 |
| 11 | Ga0055532_1002575 | 3300003758 | Bacteria | 3646 |
| 12 | Ga0055532_1003704 | 3300003758 | Bacteria | 2512 |
| 13 | Ga0055532_1005497 | 3300003758 | Bacteria | 1777 |
| 14 | Ga0055525_1000056 | 3300003759 | Bacteria | 212321 |
| 15 | Ga0055527_1001292 | 3300003760 | Bacteria | 5439 |
| 16 | Ga0055527_1001533 | 3300003760 | Bacteria | 4730 |
| 17 | Ga0055535_1002809 | 3300003761 | Bacteria | 5536 |
| 18 | Ga0055535_1002850 | 3300003761 | Bacteria | 5439 |
| 19 | Ga0055542_1002605 | 3300003762 | Bacteria | 5698 |
| 20 | Ga0055542_1004152 | 3300003762 | Bacteria | 3637 |
| 21 | Ga0055529_1000823 | 3300003763 | Bacteria | 18476 |
| 22 | Ga0055534_1000722 | 3300003784 | Bacteria | 15998 |
| 23 | Ga0055528_1001010 | 3300003790 | Bacteria | 18684 |
| 24 | Ga0055528_1031440 | 3300003790 | Bacteria | 1381 |
| 25 | Ga0055540_1012226 | 3300003792 | Bacteria | 2710 |
| 26 | Ga0058692_1001284 | 3300003856 | Bacteria | 9534 |
| 27 | Ga0065165_1000910 | 3300005262 | Bacteria | 38170 |
| 28 | Ga0065707_10099760 | 3300005295 | Bacteria | 2981 |
| 29 | Ga0070676_10002478 | 3300005328 | Bacteria | 9462 |
| 30 | Ga0070676_10029595 | 3300005328 | Bacteria | 3116 |
| 31 | Ga0070676_10115885 | 3300005328 | Bacteria | 1675 |
| 32 | Ga0070683_100009017 | 3300005329 | Bacteria | 8510 |
| 33 | Ga0070683_100234578 | 3300005329 | Bacteria | 1744 |
| 34 | Ga0070683_100312746 | 3300005329 | Bacteria | 1495 |
| 35 | Ga0070690_100185470 | 3300005330 | Bacteria | 1439 |
| 36 | Ga0070690_100325991 | 3300005330 | Bacteria | 1108 |
| 37 | Ga0070670_100000775 | 3300005331 | Bacteria | 24812 |
| 38 | Ga0070670_100004150 | 3300005331 | Bacteria | 12113 |
| 39 | Ga0070670_100019018 | 3300005331 | Bacteria | 5891 |
| 40 | Ga0070670_100068564 | 3300005331 | Bacteria | 3044 |
| 41 | Ga0070670_100132670 | 3300005331 | Bacteria | 2151 |
| 42 | Ga0070670_100171586 | 3300005331 | Bacteria | 1881 |
| 43 | Ga0070670_100228926 | 3300005331 | Bacteria | 1617 |
| 44 | Ga0070677_10043499 | 3300005333 | Bacteria | 1784 |
| 45 | Ga0070677_10059229 | 3300005333 | Bacteria | 1575 |
| 46 | Ga0068869_100001648 | 3300005334 | Bacteria | 13321 |
| 47 | Ga0068869_100002505 | 3300005334 | Bacteria | 11079 |
| 48 | Ga0068869_100186912 | 3300005334 | Bacteria | 1627 |
| 49 | Ga0070666_10002795 | 3300005335 | Bacteria | 10542 |
| 50 | Ga0070666_10019439 | 3300005335 | Bacteria | 4385 |
| 51 | Ga0070666_10069547 | 3300005335 | Bacteria | 2394 |
| 52 | Ga0070680_100163072 | 3300005336 | Bacteria | 1873 |
| 53 | Ga0068868_100041022 | 3300005338 | Bacteria | 3605 |
| 54 | Ga0068868_100084774 | 3300005338 | Bacteria | 2545 |
| 55 | Ga0068868_100299470 | 3300005338 | Bacteria | 1366 |
| 56 | Ga0068868_100420606 | 3300005338 | Bacteria | 1157 |
| 57 | Ga0070660_100000001 | 3300005339 | Bacteria | 190487 |
| 58 | Ga0070660_100056956 | 3300005339 | Bacteria | 3026 |
| 59 | Ga0070668_100135605 | 3300005347 | Bacteria | 1979 |
| 60 | Ga0070668_100207372 | 3300005347 | Bacteria | 1611 |
| 61 | Ga0070668_100337928 | 3300005347 | Bacteria | 1272 |
| 62 | Ga0070669_100005859 | 3300005353 | Bacteria | 8865 |
| 63 | Ga0070669_100012845 | 3300005353 | Bacteria | 5947 |
| 64 | Ga0070669_100171684 | 3300005353 | Bacteria | 1691 |
| 65 | Ga0070669_100305094 | 3300005353 | Bacteria | 1281 |
| 66 | Ga0070669_100402027 | 3300005353 | Bacteria | 1121 |
| 67 | Ga0070675_100001482 | 3300005354 | Bacteria | 17319 |
| 68 | Ga0070675_100020379 | 3300005354 | Bacteria | 5292 |
| 69 | Ga0070675_100034226 | 3300005354 | Bacteria | 4122 |
| 70 | Ga0070675_100035035 | 3300005354 | Bacteria | 4076 |
| 71 | Ga0070675_100092730 | 3300005354 | Bacteria | 2532 |
| 72 | Ga0070675_100095980 | 3300005354 | Bacteria | 2490 |
| 73 | Ga0070671_100039517 | 3300005355 | Bacteria | 3916 |
| 74 | Ga0070671_100042415 | 3300005355 | Bacteria | 3781 |
| 75 | Ga0070671_100042863 | 3300005355 | Bacteria | 3763 |
| 76 | Ga0070671_100055566 | 3300005355 | Bacteria | 3293 |
| 77 | Ga0070671_100082453 | 3300005355 | Bacteria | 2689 |
| 78 | Ga0070671_100187226 | 3300005355 | Bacteria | 1754 |
| 79 | Ga0070671_100272828 | 3300005355 | Bacteria | 1438 |
| 80 | Ga0070674_100040038 | 3300005356 | Bacteria | 3168 |
| 81 | Ga0070674_100120808 | 3300005356 | Bacteria | 1939 |
| 82 | Ga0070674_100423751 | 3300005356 | Bacteria | 1092 |
| 83 | Ga0070673_100003372 | 3300005364 | Bacteria | 9941 |
| 84 | Ga0070673_100044736 | 3300005364 | Bacteria | 3429 |
| 85 | Ga0070673_100215499 | 3300005364 | Bacteria | 1660 |
| 86 | Ga0070673_100236798 | 3300005364 | Bacteria | 1585 |
| 87 | Ga0070673_100252437 | 3300005364 | Bacteria | 1538 |
| 88 | Ga0070659_100000189 | 3300005366 | Bacteria | 47370 |
| 89 | Ga0070667_100001504 | 3300005367 | Bacteria | 20851 |
| 90 | Ga0070667_100006001 | 3300005367 | Bacteria | 10096 |
| 91 | Ga0070667_100006649 | 3300005367 | Bacteria | 9611 |
| 92 | Ga0070667_100082325 | 3300005367 | Bacteria | 2755 |
| 93 | Ga0070667_100101241 | 3300005367 | Bacteria | 2488 |
| 94 | Ga0070667_100131122 | 3300005367 | Bacteria | 2188 |
| 95 | Ga0070701_10173876 | 3300005438 | Bacteria | 1256 |
| 96 | Ga0070700_100210142 | 3300005441 | Bacteria | 1373 |
| 97 | Ga0070708_100258413 | 3300005445 | Bacteria | 1637 |
| 98 | Ga0070663_100012207 | 3300005455 | Bacteria | 5424 |
| 99 | Ga0070663_100020206 | 3300005455 | Bacteria | 4405 |
| 100 | Ga0070678_100015954 | 3300005456 | Bacteria | 4788 |
| 101 | Ga0070678_100017348 | 3300005456 | Bacteria | 4632 |
| 102 | Ga0070678_100060580 | 3300005456 | Bacteria | 2787 |
| 103 | Ga0070678_100061375 | 3300005456 | Bacteria | 2770 |
| 104 | Ga0070678_100150380 | 3300005456 | Bacteria | 1875 |
| 105 | Ga0070662_100007654 | 3300005457 | Bacteria | 7008 |
| 106 | Ga0070662_100013829 | 3300005457 | Bacteria | 5376 |
| 107 | Ga0070662_100045971 | 3300005457 | Bacteria | 3135 |
| 108 | Ga0070662_100148501 | 3300005457 | Bacteria | 1823 |
| 109 | Ga0070662_100189138 | 3300005457 | Bacteria | 1627 |
| 110 | Ga0070662_100333430 | 3300005457 | Bacteria | 1240 |
| 111 | Ga0068867_100002317 | 3300005459 | Bacteria | 13397 |
| 112 | Ga0068867_100005331 | 3300005459 | Bacteria | 9088 |
| 113 | Ga0068867_100046359 | 3300005459 | Bacteria | 3193 |
| 114 | Ga0068867_100103912 | 3300005459 | Bacteria | 2173 |
| 115 | Ga0068867_100142473 | 3300005459 | Bacteria | 1875 |
| 116 | Ga0068867_100167322 | 3300005459 | Bacteria | 1738 |
| 117 | Ga0068867_100517055 | 3300005459 | Bacteria | 1029 |
| 118 | Ga0070685_10101141 | 3300005466 | Bacteria | 1761 |
| 119 | Ga0070706_100000367 | 3300005467 | Bacteria | 54314 |
| 120 | Ga0070706_100074527 | 3300005467 | Bacteria | 3141 |
| 121 | Ga0070707_100185816 | 3300005468 | Bacteria | 2026 |
| 122 | Ga0070684_100166425 | 3300005535 | Bacteria | 2001 |
| 123 | Ga0068853_100039755 | 3300005539 | Bacteria | 4012 |
| 124 | Ga0068853_100293718 | 3300005539 | Bacteria | 1501 |
| 125 | Ga0070672_100000485 | 3300005543 | Bacteria | 23134 |
| 126 | Ga0070672_100003226 | 3300005543 | Bacteria | 10557 |
| 127 | Ga0070672_100009095 | 3300005543 | Bacteria | 6832 |
| 128 | Ga0070672_100050694 | 3300005543 | Bacteria | 3234 |
| 129 | Ga0070672_100079414 | 3300005543 | Bacteria | 2626 |
| 130 | Ga0070672_100166826 | 3300005543 | Bacteria | 1829 |
| 131 | Ga0070693_100325643 | 3300005547 | Bacteria | 1044 |
| 132 | Ga0070665_100058116 | 3300005548 | Bacteria | 3877 |
| 133 | Ga0070665_100342154 | 3300005548 | Bacteria | 1501 |
| 134 | Ga0070665_100432345 | 3300005548 | Bacteria | 1325 |
| 135 | Ga0070665_100472217 | 3300005548 | Bacteria | 1265 |
| 136 | Ga0070704_100034005 | 3300005549 | Bacteria | 3453 |
| 137 | Ga0068855_100221846 | 3300005563 | Bacteria | 2119 |
| 138 | Ga0070664_100077229 | 3300005564 | Bacteria | 2863 |
| 139 | Ga0070664_100091085 | 3300005564 | Bacteria | 2640 |
| 140 | Ga0068857_100289944 | 3300005577 | Bacteria | 1507 |
| 141 | Ga0068854_100039816 | 3300005578 | Bacteria | 3313 |
| 142 | Ga0068854_100042167 | 3300005578 | Bacteria | 3228 |
| 143 | Ga0068854_100057248 | 3300005578 | Bacteria | 2812 |
| 144 | Ga0068854_100081993 | 3300005578 | Bacteria | 2384 |
| 145 | Ga0068856_100097818 | 3300005614 | Bacteria | 2924 |
| 146 | Ga0068856_100432177 | 3300005614 | Bacteria | 1337 |
| 147 | Ga0068852_100001454 | 3300005616 | Bacteria | 15992 |
| 148 | Ga0068852_100006370 | 3300005616 | Bacteria | 8525 |
| 149 | Ga0068852_100007209 | 3300005616 | Bacteria | 8107 |
| 150 | Ga0068852_100011335 | 3300005616 | Bacteria | 6706 |
| 151 | Ga0068852_100048807 | 3300005616 | Bacteria | 3619 |
| 152 | Ga0068852_100082732 | 3300005616 | Bacteria | 2853 |
| 153 | Ga0068852_100108555 | 3300005616 | Bacteria | 2519 |
| 154 | Ga0068859_100274935 | 3300005617 | Bacteria | 1777 |
| 155 | Ga0068864_100008292 | 3300005618 | Bacteria | 8570 |
| 156 | Ga0068864_100011131 | 3300005618 | Bacteria | 7434 |
| 157 | Ga0068864_100012300 | 3300005618 | Bacteria | 7074 |
| 158 | Ga0068864_100018209 | 3300005618 | Bacteria | 5863 |
| 159 | Ga0068864_100035355 | 3300005618 | Bacteria | 4253 |
| 160 | Ga0068864_100158532 | 3300005618 | Bacteria | 2056 |
| 161 | Ga0068866_10005941 | 3300005718 | Bacteria | 5074 |
| 162 | Ga0068861_100002678 | 3300005719 | Bacteria | 11666 |
| 163 | Ga0068861_100011019 | 3300005719 | Bacteria | 6284 |
| 164 | Ga0068861_100478323 | 3300005719 | Bacteria | 1122 |
| 165 | Ga0068851_10028063 | 3300005834 | Bacteria | 2778 |
| 166 | Ga0068851_10083848 | 3300005834 | Bacteria | 1668 |
| 167 | Ga0068851_10090779 | 3300005834 | Bacteria | 1608 |
| 168 | Ga0068863_100010999 | 3300005841 | Bacteria | 8776 |
| 169 | Ga0068863_100425543 | 3300005841 | Bacteria | 1301 |
| 170 | Ga0068863_100582935 | 3300005841 | Bacteria | 1106 |
| 171 | Ga0068858_100004441 | 3300005842 | Bacteria | 13757 |
| 172 | Ga0068858_100093635 | 3300005842 | Bacteria | 2797 |
| 173 | Ga0068860_100001559 | 3300005843 | Bacteria | 24688 |
| 174 | Ga0068860_100006168 | 3300005843 | Bacteria | 12055 |
| 175 | Ga0068860_100013982 | 3300005843 | Bacteria | 7871 |
| 176 | Ga0068860_100033277 | 3300005843 | Bacteria | 4947 |
| 177 | Ga0068862_100056270 | 3300005844 | Bacteria | 3370 |
| 178 | Ga0068862_100081824 | 3300005844 | Bacteria | 2802 |
| 179 | Ga0068862_100162356 | 3300005844 | Bacteria | 1995 |
| 180 | Ga0081455_10060841 | 3300005937 | Bacteria | 3181 |
| 181 | Ga0075365_10057943 | 3300006038 | Bacteria | 2578 |
| 182 | Ga0075365_10082684 | 3300006038 | Bacteria | 2177 |
| 183 | Ga0075368_10003231 | 3300006042 | Bacteria | 5425 |
| 184 | Ga0075368_10005709 | 3300006042 | Bacteria | 4300 |
| 185 | Ga0075368_10029201 | 3300006042 | Bacteria | 2132 |
| 186 | Ga0075363_100000145 | 3300006048 | Bacteria | 17501 |
| 187 | Ga0075363_100015708 | 3300006048 | Bacteria | 3727 |
| 188 | Ga0075363_100050668 | 3300006048 | Bacteria | 2213 |
| 189 | Ga0075363_100074539 | 3300006048 | Bacteria | 1847 |
| 190 | Ga0075363_100122212 | 3300006048 | Bacteria | 1455 |
| 191 | Ga0075364_10058438 | 3300006051 | Bacteria | 2527 |
| 192 | Ga0075362_10000580 | 3300006177 | Bacteria | 10685 |
| 193 | Ga0075362_10003899 | 3300006177 | Bacteria | 5296 |
| 194 | Ga0075362_10047649 | 3300006177 | Bacteria | 1909 |
| 195 | Ga0075362_10090893 | 3300006177 | Bacteria | 1417 |
| 196 | Ga0075367_10002249 | 3300006178 | Bacteria | 8731 |
| 197 | Ga0075367_10004330 | 3300006178 | Bacteria | 6910 |
| 198 | Ga0075367_10012127 | 3300006178 | Bacteria | 4585 |
| 199 | Ga0075367_10024628 | 3300006178 | Bacteria | 3395 |
| 200 | Ga0075367_10034912 | 3300006178 | Bacteria | 2908 |
| 201 | Ga0075367_10160829 | 3300006178 | Bacteria | 1396 |
| 202 | Ga0075367_10275422 | 3300006178 | Bacteria | 1057 |
| 203 | Ga0075369_10003203 | 3300006186 | Bacteria | 5939 |
| 204 | Ga0075369_10018407 | 3300006186 | Bacteria | 2843 |
| 205 | Ga0075369_10064800 | 3300006186 | Bacteria | 1601 |
| 206 | Ga0075366_10000582 | 3300006195 | Bacteria | 17130 |
| 207 | Ga0075366_10001974 | 3300006195 | Bacteria | 10379 |
| 208 | Ga0075366_10007235 | 3300006195 | Bacteria | 6116 |
| 209 | Ga0075366_10009087 | 3300006195 | Bacteria | 5542 |
| 210 | Ga0075366_10016069 | 3300006195 | Bacteria | 4297 |
| 211 | Ga0075366_10017325 | 3300006195 | Bacteria | 4146 |
| 212 | Ga0075366_10022472 | 3300006195 | Bacteria | 3669 |
| 213 | Ga0075366_10052321 | 3300006195 | Bacteria | 2427 |
| 214 | Ga0075366_10138256 | 3300006195 | Bacteria | 1472 |
| 215 | Ga0075366_10148112 | 3300006195 | Bacteria | 1421 |
| 216 | Ga0075366_10165633 | 3300006195 | Bacteria | 1340 |
| 217 | Ga0075366_10186592 | 3300006195 | Bacteria | 1260 |
| 218 | Ga0097621_100025465 | 3300006237 | Bacteria | 4630 |
| 219 | Ga0097621_100025620 | 3300006237 | Bacteria | 4616 |
| 220 | Ga0097621_100055415 | 3300006237 | Bacteria | 3237 |
| 221 | Ga0075370_10000854 | 3300006353 | Bacteria | 12360 |
| 222 | Ga0075370_10001171 | 3300006353 | Bacteria | 11031 |
| 223 | Ga0075370_10002800 | 3300006353 | Bacteria | 8175 |
| 224 | Ga0075370_10010740 | 3300006353 | Bacteria | 4800 |
| 225 | Ga0075370_10012014 | 3300006353 | Bacteria | 4565 |
| 226 | Ga0075370_10045564 | 3300006353 | Bacteria | 2480 |
| 227 | Ga0075370_10057297 | 3300006353 | Bacteria | 2215 |
| 228 | Ga0068871_100007855 | 3300006358 | Bacteria | 7643 |
| 229 | Ga0068871_100040253 | 3300006358 | Bacteria | 3743 |
| 230 | Ga0068871_100050810 | 3300006358 | Bacteria | 3355 |
| 231 | Ga0075429_100038607 | 3300006880 | Bacteria | 4157 |
| 232 | Ga0068865_100122943 | 3300006881 | Bacteria | 1933 |
| 233 | Ga0068865_100297440 | 3300006881 | Bacteria | 1291 |
| 234 | Ga0097620_100274948 | 3300006931 | Bacteria | 1777 |
| 235 | Ga0105250_10003919 | 3300009092 | Bacteria | 6950 |
| 236 | Ga0105240_10016993 | 3300009093 | Bacteria | 9829 |
| 237 | Ga0105240_10018949 | 3300009093 | Bacteria | 9215 |
| 238 | Ga0105240_10068369 | 3300009093 | Bacteria | 4399 |
| 239 | Ga0105240_10081673 | 3300009093 | Bacteria | 3971 |
| 240 | Ga0105240_10290860 | 3300009093 | Bacteria | 1873 |
| 241 | Ga0105240_10476165 | 3300009093 | Bacteria | 1393 |
| 242 | Ga0105245_10039692 | 3300009098 | Bacteria | 4190 |
| 243 | Ga0105243_10000649 | 3300009148 | Bacteria | 34418 |
| 244 | Ga0105243_10035667 | 3300009148 | Bacteria | 3856 |
| 245 | Ga0105248_10033310 | 3300009177 | Bacteria | 5755 |
| 246 | Ga0105248_10112249 | 3300009177 | Bacteria | 3074 |
| 247 | Ga0105248_10144405 | 3300009177 | Bacteria | 2685 |
| 248 | Ga0105248_10157950 | 3300009177 | Bacteria | 2559 |
| 249 | Ga0105237_10001988 | 3300009545 | Bacteria | 26016 |
| 250 | Ga0105237_10044846 | 3300009545 | Bacteria | 4451 |
| 251 | Ga0105237_10074686 | 3300009545 | Bacteria | 3382 |
| 252 | Ga0105238_10006005 | 3300009551 | Bacteria | 12036 |
| 253 | Ga0105238_10014640 | 3300009551 | Bacteria | 7932 |
| 254 | Ga0105238_10286934 | 3300009551 | Bacteria | 1628 |
| 255 | Ga0105238_10299583 | 3300009551 | Bacteria | 1591 |
| 256 | Ga0105249_10009613 | 3300009553 | Bacteria | 8474 |
| 257 | Ga0105249_10018682 | 3300009553 | Bacteria | 6174 |
| 258 | Ga0105249_10094890 | 3300009553 | Bacteria | 2796 |
| 259 | Ga0105249_10403396 | 3300009553 | Bacteria | 1398 |
| 260 | Ga0105239_10004146 | 3300010375 | Bacteria | 17401 |
| 261 | Ga0105239_10005722 | 3300010375 | Bacteria | 14521 |
| 262 | Ga0105239_10142381 | 3300010375 | Bacteria | 2673 |
| 263 | Ga0105246_10058179 | 3300011119 | Bacteria | 2677 |
| 264 | Ga0157373_10056772 | 3300013100 | Bacteria | 2778 |
| 265 | Ga0157371_10122165 | 3300013102 | Bacteria | 1852 |
| 266 | Ga0157374_10143755 | 3300013296 | Bacteria | 2316 |
| 267 | Ga0157378_10001811 | 3300013297 | Bacteria | 19191 |
| 268 | Ga0157378_10289253 | 3300013297 | Bacteria | 1582 |
| 269 | Ga0157378_10459111 | 3300013297 | Bacteria | 1265 |
| 270 | Ga0163162_10011522 | 3300013306 | Bacteria | 8623 |
| 271 | Ga0163162_10011677 | 3300013306 | Bacteria | 8564 |
| 272 | Ga0163162_10061442 | 3300013306 | Bacteria | 3795 |
| 273 | Ga0163162_10311123 | 3300013306 | Bacteria | 1708 |
| 274 | Ga0157372_10011373 | 3300013307 | Bacteria | 9468 |
| 275 | Ga0157372_10017578 | 3300013307 | Bacteria | 7673 |
| 276 | Ga0157372_10520383 | 3300013307 | Bacteria | 1387 |
| 277 | Ga0157372_10948110 | 3300013307 | Bacteria | 997 |
| 278 | Ga0157375_10005345 | 3300013308 | Bacteria | 11160 |
| 279 | Ga0157375_10069609 | 3300013308 | Bacteria | 3526 |
| 280 | Ga0157375_10090733 | 3300013308 | Bacteria | 3115 |
| 281 | Ga0157375_10120376 | 3300013308 | Bacteria | 2734 |
| 282 | Ga0157375_10168125 | 3300013308 | Bacteria | 2339 |
| 283 | Ga0163163_10011394 | 3300014325 | Bacteria | 8062 |
| 284 | Ga0163163_10254879 | 3300014325 | Bacteria | 1805 |
| 285 | Ga0163163_10296297 | 3300014325 | Bacteria | 1670 |
| 286 | Ga0157380_10006323 | 3300014326 | Bacteria | 8324 |
| 287 | Ga0157380_10369806 | 3300014326 | Bacteria | 1349 |
| 288 | Ga0182008_10000148 | 3300014497 | Bacteria | 54597 |
| 289 | Ga0157377_10000006 | 3300014745 | Bacteria | 419853 |
| 290 | Ga0157377_10218869 | 3300014745 | Bacteria | 1218 |
| 291 | Ga0157379_10003479 | 3300014968 | Bacteria | 13332 |
| 292 | Ga0157379_10015125 | 3300014968 | Bacteria | 6768 |
| 293 | Ga0157379_10016325 | 3300014968 | Bacteria | 6531 |
| 294 | Ga0157379_10125292 | 3300014968 | Bacteria | 2312 |
| 295 | Ga0157376_10023415 | 3300014969 | Bacteria | 4833 |
| 296 | Ga0157376_10052668 | 3300014969 | Bacteria | 3385 |
| 297 | Ga0182007_10086821 | 3300015262 | Bacteria | 1029 |
| 298 | Ga0163161_10009633 | 3300017792 | Bacteria | 6682 |
| 299 | Ga0163161_10025036 | 3300017792 | Bacteria | 4220 |
| 300 | Ga0163161_10103176 | 3300017792 | Bacteria | 2125 |
| 301 | Ga0206353_11878195 | 3300020082 | Bacteria | 1195 |
| 302 | Ga0213872_10000120 | 3300021361 | Bacteria | 73389 |
| 303 | Ga0213872_10000141 | 3300021361 | Bacteria | 64990 |
| 304 | Ga0213872_10000155 | 3300021361 | Bacteria | 62940 |
| 305 | Ga0213872_10000277 | 3300021361 | Bacteria | 43679 |
| 306 | Ga0213872_10014511 | 3300021361 | Bacteria | 3676 |
| 307 | Ga0213872_10022453 | 3300021361 | Bacteria | 2906 |
| 308 | Ga0213872_10041095 | 3300021361 | Bacteria | 2110 |
| 309 | Ga0209566_100878 | 3300025225 | Bacteria | 14676 |
| 310 | Ga0209674_104904 | 3300025226 | Bacteria | 2081 |
| 311 | Ga0209672_100041 | 3300025228 | Bacteria | 278535 |
| 312 | Ga0209672_100153 | 3300025228 | Bacteria | 61197 |
| 313 | Ga0209147_100043 | 3300025229 | Bacteria | 300460 |
| 314 | Ga0209147_102422 | 3300025229 | Bacteria | 4653 |
| 315 | Ga0209563_100014 | 3300025230 | Bacteria | 940582 |
| 316 | Ga0209258_100023 | 3300025242 | Bacteria | 547286 |
| 317 | Ga0209258_100822 | 3300025242 | Bacteria | 17427 |
| 318 | Ga0207425_1000703 | 3300025245 | Bacteria | 18068 |
| 319 | Ga0209148_1000029 | 3300025254 | Bacteria | 579199 |
| 320 | Ga0209148_1001387 | 3300025254 | Bacteria | 12523 |
| 321 | Ga0209129_1000933 | 3300025258 | Bacteria | 17722 |
| 322 | Ga0209565_1013438 | 3300025263 | Bacteria | 1917 |
| 323 | Ga0207666_1005498 | 3300025271 | Bacteria | 1620 |
| 324 | Ga0209455_1000064 | 3300025272 | Bacteria | 332404 |
| 325 | Ga0209455_1000722 | 3300025272 | Bacteria | 19152 |
| 326 | Ga0209673_1000084 | 3300025273 | Bacteria | 215878 |
| 327 | Ga0209673_1008819 | 3300025273 | Bacteria | 4443 |
| 328 | Ga0209673_1014498 | 3300025273 | Bacteria | 3046 |
| 329 | Ga0209675_1002104 | 3300025291 | Bacteria | 10553 |
| 330 | Ga0209676_1030785 | 3300025292 | Bacteria | 1635 |
| 331 | Ga0209564_1000627 | 3300025295 | Bacteria | 53872 |
| 332 | Ga0209564_1003064 | 3300025295 | Bacteria | 11871 |
| 333 | Ga0209758_1000593 | 3300025297 | Bacteria | 56468 |
| 334 | Ga0209758_1000769 | 3300025297 | Bacteria | 46067 |
| 335 | Ga0209050_1000799 | 3300025298 | Bacteria | 44543 |
| 336 | Ga0209256_1012880 | 3300025299 | Bacteria | 3151 |
| 337 | Ga0209051_1023211 | 3300025303 | Bacteria | 2586 |
| 338 | Ga0209257_1011852 | 3300025304 | Bacteria | 4125 |
| 339 | Ga0209257_1047282 | 3300025304 | Bacteria | 1238 |
| 340 | Ga0207697_10017039 | 3300025315 | Bacteria | 2988 |
| 341 | Ga0207697_10021253 | 3300025315 | Bacteria | 2657 |
| 342 | Ga0207656_10003851 | 3300025321 | Bacteria | 5200 |
| 343 | Ga0207656_10057781 | 3300025321 | Bacteria | 1693 |
| 344 | Ga0207682_10004387 | 3300025893 | Bacteria | 5908 |
| 345 | Ga0207682_10010609 | 3300025893 | Bacteria | 3607 |
| 346 | Ga0207682_10013701 | 3300025893 | Bacteria | 3157 |
| 347 | Ga0207682_10019286 | 3300025893 | Bacteria | 2670 |
| 348 | Ga0207642_10009093 | 3300025899 | Bacteria | 3441 |
| 349 | Ga0207642_10073719 | 3300025899 | Bacteria | 1634 |
| 350 | Ga0207688_10026931 | 3300025901 | Bacteria | 3162 |
| 351 | Ga0207680_10109929 | 3300025903 | Bacteria | 1786 |
| 352 | Ga0207647_10012826 | 3300025904 | Bacteria | 5823 |
| 353 | Ga0207645_10038735 | 3300025907 | Bacteria | 3055 |
| 354 | Ga0207645_10144160 | 3300025907 | Bacteria | 1552 |
| 355 | Ga0207684_10008798 | 3300025910 | Bacteria | 8962 |
| 356 | Ga0207684_10139365 | 3300025910 | Bacteria | 2084 |
| 357 | Ga0207695_10001714 | 3300025913 | Bacteria | 35105 |
| 358 | Ga0207695_10030498 | 3300025913 | Bacteria | 5935 |
| 359 | Ga0207695_10164414 | 3300025913 | Bacteria | 2148 |
| 360 | Ga0207671_10002519 | 3300025914 | Bacteria | 19541 |
| 361 | Ga0207671_10031240 | 3300025914 | Bacteria | 3968 |
| 362 | Ga0207660_10025648 | 3300025917 | Bacteria | 4004 |
| 363 | Ga0207662_10020118 | 3300025918 | Bacteria | 3807 |
| 364 | Ga0207657_10000022 | 3300025919 | Bacteria | 154101 |
| 365 | Ga0207649_10159182 | 3300025920 | Bacteria | 1563 |
| 366 | Ga0207652_10008831 | 3300025921 | Bacteria | 8117 |
| 367 | Ga0207646_10143806 | 3300025922 | Bacteria | 2149 |
| 368 | Ga0207681_10001432 | 3300025923 | Bacteria | 15375 |
| 369 | Ga0207681_10027585 | 3300025923 | Bacteria | 3673 |
| 370 | Ga0207681_10166070 | 3300025923 | Bacteria | 1669 |
| 371 | Ga0207694_10002756 | 3300025924 | Bacteria | 14193 |
| 372 | Ga0207694_10356368 | 3300025924 | Bacteria | 1212 |
| 373 | Ga0207650_10000275 | 3300025925 | Bacteria | 53824 |
| 374 | Ga0207650_10003009 | 3300025925 | Bacteria | 11613 |
| 375 | Ga0207650_10013330 | 3300025925 | Bacteria | 5691 |
| 376 | Ga0207650_10076434 | 3300025925 | Bacteria | 2530 |
| 377 | Ga0207659_10003305 | 3300025926 | Bacteria | 9661 |
| 378 | Ga0207659_10019588 | 3300025926 | Bacteria | 4457 |
| 379 | Ga0207659_10039814 | 3300025926 | Bacteria | 3282 |
| 380 | Ga0207644_10005477 | 3300025931 | Bacteria | 8268 |
| 381 | Ga0207644_10048247 | 3300025931 | Bacteria | 3043 |
| 382 | Ga0207644_10061537 | 3300025931 | Bacteria | 2719 |
| 383 | Ga0207644_10126323 | 3300025931 | Bacteria | 1952 |
| 384 | Ga0207690_10000010 | 3300025932 | Bacteria | 330298 |
| 385 | Ga0207690_10267286 | 3300025932 | Bacteria | 1327 |
| 386 | Ga0207706_10002925 | 3300025933 | Bacteria | 16502 |
| 387 | Ga0207706_10100784 | 3300025933 | Bacteria | 2541 |
| 388 | Ga0207706_10227080 | 3300025933 | Bacteria | 1634 |
| 389 | Ga0207706_10241037 | 3300025933 | Bacteria | 1581 |
| 390 | Ga0207709_10001139 | 3300025935 | Bacteria | 19377 |
| 391 | Ga0207709_10170600 | 3300025935 | Bacteria | 1526 |
| 392 | Ga0207670_10053469 | 3300025936 | Bacteria | 2721 |
| 393 | Ga0207669_10001031 | 3300025937 | Bacteria | 11905 |
| 394 | Ga0207669_10001953 | 3300025937 | Bacteria | 8743 |
| 395 | Ga0207704_10157907 | 3300025938 | Bacteria | 1610 |
| 396 | Ga0207691_10001335 | 3300025940 | Bacteria | 24610 |
| 397 | Ga0207691_10003672 | 3300025940 | Bacteria | 14890 |
| 398 | Ga0207691_10007054 | 3300025940 | Bacteria | 10841 |
| 399 | Ga0207691_10048981 | 3300025940 | Bacteria | 3872 |
| 400 | Ga0207691_10095462 | 3300025940 | Bacteria | 2660 |
| 401 | Ga0207691_10170069 | 3300025940 | Bacteria | 1909 |
| 402 | Ga0207691_10182758 | 3300025940 | Bacteria | 1832 |
| 403 | Ga0207691_10416470 | 3300025940 | Bacteria | 1145 |
| 404 | Ga0207711_10009412 | 3300025941 | Bacteria | 8157 |
| 405 | Ga0207711_10033637 | 3300025941 | Bacteria | 4339 |
| 406 | Ga0207711_10079455 | 3300025941 | Bacteria | 2863 |
| 407 | Ga0207711_10132439 | 3300025941 | Bacteria | 2236 |
| 408 | Ga0207689_10001138 | 3300025942 | Bacteria | 25663 |
| 409 | Ga0207689_10013440 | 3300025942 | Bacteria | 6990 |
| 410 | Ga0207689_10049644 | 3300025942 | Bacteria | 3461 |
| 411 | Ga0207689_10051233 | 3300025942 | Bacteria | 3403 |
| 412 | Ga0207661_10102125 | 3300025944 | Bacteria | 2410 |
| 413 | Ga0207661_10133640 | 3300025944 | Bacteria | 2128 |
| 414 | Ga0207679_10016675 | 3300025945 | Bacteria | 4879 |
| 415 | Ga0207679_10078325 | 3300025945 | Bacteria | 2517 |
| 416 | Ga0207679_10143970 | 3300025945 | Bacteria | 1930 |
| 417 | Ga0207679_10365964 | 3300025945 | Bacteria | 1260 |
| 418 | Ga0207667_10018841 | 3300025949 | Bacteria | 7728 |
| 419 | Ga0207667_10328645 | 3300025949 | Bacteria | 1561 |
| 420 | Ga0207651_10015270 | 3300025960 | Bacteria | 4458 |
| 421 | Ga0207651_10034820 | 3300025960 | Bacteria | 3266 |
| 422 | Ga0207651_10064540 | 3300025960 | Bacteria | 2563 |
| 423 | Ga0207651_10451241 | 3300025960 | Bacteria | 1103 |
| 424 | Ga0207712_10020151 | 3300025961 | Bacteria | 4365 |
| 425 | Ga0207712_10187570 | 3300025961 | Bacteria | 1630 |
| 426 | Ga0207668_10081035 | 3300025972 | Bacteria | 2353 |
| 427 | Ga0207668_10092283 | 3300025972 | Bacteria | 2228 |
| 428 | Ga0207668_10152178 | 3300025972 | Bacteria | 1792 |
| 429 | Ga0207640_10155938 | 3300025981 | Bacteria | 1683 |
| 430 | Ga0207640_10379215 | 3300025981 | Bacteria | 1145 |
| 431 | Ga0207658_10006476 | 3300025986 | Bacteria | 7992 |
| 432 | Ga0207658_10007334 | 3300025986 | Bacteria | 7517 |
| 433 | Ga0207658_10037844 | 3300025986 | Bacteria | 3471 |
| 434 | Ga0207658_10106977 | 3300025986 | Bacteria | 2203 |
| 435 | Ga0207677_10061139 | 3300026023 | Bacteria | 2607 |
| 436 | Ga0207677_10084498 | 3300026023 | Bacteria | 2288 |
| 437 | Ga0207677_10131825 | 3300026023 | Bacteria | 1899 |
| 438 | Ga0207677_10274858 | 3300026023 | Bacteria | 1380 |
| 439 | Ga0207703_10009043 | 3300026035 | Bacteria | 7845 |
| 440 | Ga0207703_10026809 | 3300026035 | Bacteria | 4539 |
| 441 | Ga0207703_10072967 | 3300026035 | Bacteria | 2838 |
| 442 | Ga0207703_10236104 | 3300026035 | Bacteria | 1641 |
| 443 | Ga0207639_10015322 | 3300026041 | Bacteria | 5406 |
| 444 | Ga0207639_10022020 | 3300026041 | Bacteria | 4586 |
| 445 | Ga0207639_10033735 | 3300026041 | Bacteria | 3779 |
| 446 | Ga0207639_10549776 | 3300026041 | Bacteria | 1060 |
| 447 | Ga0207678_10000013 | 3300026067 | Bacteria | 141619 |
| 448 | Ga0207678_10021701 | 3300026067 | Bacteria | 5631 |
| 449 | Ga0207708_10117053 | 3300026075 | Bacteria | 2074 |
| 450 | Ga0207641_10003042 | 3300026088 | Bacteria | 15111 |
| 451 | Ga0207641_10016486 | 3300026088 | Bacteria | 6051 |
| 452 | Ga0207641_10073800 | 3300026088 | Bacteria | 2941 |
| 453 | Ga0207641_10100741 | 3300026088 | Bacteria | 2544 |
| 454 | Ga0207641_10568486 | 3300026088 | Bacteria | 1107 |
| 455 | Ga0207648_10000254 | 3300026089 | Bacteria | 57696 |
| 456 | Ga0207648_10000419 | 3300026089 | Bacteria | 46680 |
| 457 | Ga0207648_10012495 | 3300026089 | Bacteria | 7950 |
| 458 | Ga0207648_10024822 | 3300026089 | Bacteria | 5347 |
| 459 | Ga0207648_10026116 | 3300026089 | Bacteria | 5193 |
| 460 | Ga0207648_10066548 | 3300026089 | Bacteria | 3142 |
| 461 | Ga0207648_10425365 | 3300026089 | Bacteria | 1206 |
| 462 | Ga0207676_10019987 | 3300026095 | Bacteria | 4893 |
| 463 | Ga0207676_10037501 | 3300026095 | Bacteria | 3694 |
| 464 | Ga0207676_10063117 | 3300026095 | Bacteria | 2941 |
| 465 | Ga0207676_10176961 | 3300026095 | Bacteria | 1864 |
| 466 | Ga0207676_10465127 | 3300026095 | Bacteria | 1195 |
| 467 | Ga0207674_10065213 | 3300026116 | Bacteria | 3672 |
| 468 | Ga0207675_100002557 | 3300026118 | Bacteria | 18015 |
| 469 | Ga0207675_100004240 | 3300026118 | Bacteria | 13863 |
| 470 | Ga0207675_100012087 | 3300026118 | Bacteria | 8066 |
| 471 | Ga0207683_10055802 | 3300026121 | Bacteria | 3465 |
| 472 | Ga0207683_10061301 | 3300026121 | Bacteria | 3310 |
| 473 | Ga0207683_10077576 | 3300026121 | Bacteria | 2943 |
| 474 | Ga0207683_10101938 | 3300026121 | Bacteria | 2563 |
| 475 | Ga0207683_10307523 | 3300026121 | Bacteria | 1451 |
| 476 | Ga0207683_10312163 | 3300026121 | Bacteria | 1439 |
| 477 | Ga0207683_10367252 | 3300026121 | Bacteria | 1322 |
| 478 | Ga0207698_10004407 | 3300026142 | Bacteria | 8577 |
| 479 | Ga0207698_10004420 | 3300026142 | Bacteria | 8566 |
| 480 | Ga0207698_10008959 | 3300026142 | Bacteria | 6349 |
| 481 | Ga0207698_10092623 | 3300026142 | Bacteria | 2478 |
| 482 | Ga0207698_10317308 | 3300026142 | Bacteria | 1458 |
| 483 | Ga0207698_10647761 | 3300026142 | Bacteria | 1046 |
| 484 | Ga0209371_1000526 | 3300027312 | Bacteria | 36476 |
| 485 | Ga0209968_1000617 | 3300027526 | Bacteria | 5511 |
| 486 | Ga0209966_1000517 | 3300027695 | Bacteria | 9984 |
| 487 | Ga0209813_10008813 | 3300027866 | Bacteria | 2559 |
| 488 | Ga0209974_10001326 | 3300027876 | Bacteria | 8891 |
| 489 | Ga0268266_10021143 | 3300028379 | Bacteria | 5544 |
| 490 | Ga0268266_10191859 | 3300028379 | Bacteria | 1866 |
| 491 | Ga0268265_10009051 | 3300028380 | Bacteria | 6733 |
| 492 | Ga0268265_10037721 | 3300028380 | Bacteria | 3549 |
| 493 | Ga0268265_10293563 | 3300028380 | Bacteria | 1460 |
| 494 | Ga0268264_10002884 | 3300028381 | Bacteria | 14955 |
| 495 | Ga0268264_10099566 | 3300028381 | Bacteria | 2523 |
| 496 | Ga0268264_10132357 | 3300028381 | Bacteria | 2213 |
| 497 | Ga0307517_10004486 | 3300028786 | Bacteria | 21426 |
| 498 | Ga0307517_10128757 | 3300028786 | Bacteria | 1833 |
| 499 | Ga0307515_10001761 | 3300028794 | Bacteria | 48250 |
| 500 | Ga0307515_10011753 | 3300028794 | Bacteria | 16566 |
| 501 | Ga0307515_10209215 | 3300028794 | Bacteria | 1800 |
| 502 | Ga0307515_10221009 | 3300028794 | Bacteria | 1712 |
| 503 | Ga0307515_10227993 | 3300028794 | Bacteria | 1663 |
| 504 | Ga0268256_1000860 | 3300030500 | Bacteria | 21270 |
| 505 | Ga0265328_10081360 | 3300031239 | Bacteria | 1193 |
| 506 | Ga0265331_10001051 | 3300031250 | Bacteria | 21516 |
| 507 | Ga0265327_10000149 | 3300031251 | Bacteria | 150385 |
| 508 | Ga0307513_10116245 | 3300031456 | Bacteria | 2655 |
| 509 | Ga0307513_10121506 | 3300031456 | Bacteria | 2578 |
| 510 | Ga0307513_10323162 | 3300031456 | Bacteria | 1300 |
| 511 | Ga0307509_10000405 | 3300031507 | Bacteria | 72472 |
| 512 | Ga0307509_10015076 | 3300031507 | Bacteria | 9049 |
| 513 | Ga0307509_10065554 | 3300031507 | Bacteria | 3813 |
| 514 | Ga0307509_10127153 | 3300031507 | Bacteria | 2512 |
| 515 | Ga0307408_100204666 | 3300031548 | Bacteria | 1600 |
| 516 | Ga0307408_100220807 | 3300031548 | Bacteria | 1546 |
| 517 | Ga0307508_10000440 | 3300031616 | Bacteria | 49668 |
| 518 | Ga0307508_10004752 | 3300031616 | Bacteria | 13130 |
| 519 | Ga0307508_10015474 | 3300031616 | Bacteria | 6948 |
| 520 | Ga0307508_10172040 | 3300031616 | Bacteria | 1769 |
| 521 | Ga0307514_10012264 | 3300031649 | Bacteria | 7133 |
| 522 | Ga0307516_10001028 | 3300031730 | Bacteria | 38713 |
| 523 | Ga0307516_10001466 | 3300031730 | Bacteria | 32597 |
| 524 | Ga0307516_10087052 | 3300031730 | Bacteria | 2959 |
| 525 | Ga0307405_10020862 | 3300031731 | Bacteria | 3670 |
| 526 | Ga0307405_10364613 | 3300031731 | Bacteria | 1119 |
| 527 | Ga0307413_10108421 | 3300031824 | Bacteria | 1853 |
| 528 | Ga0307413_10267254 | 3300031824 | Bacteria | 1278 |
| 529 | Ga0307518_10178984 | 3300031838 | Bacteria | 1436 |
| 530 | Ga0307410_10378109 | 3300031852 | Bacteria | 1139 |
| 531 | Ga0307406_10035628 | 3300031901 | Bacteria | 3062 |
| 532 | Ga0307407_10026775 | 3300031903 | Bacteria | 3059 |
| 533 | Ga0307412_10016042 | 3300031911 | Bacteria | 4452 |
| 534 | Ga0307409_100253842 | 3300031995 | Bacteria | 1609 |
| 535 | Ga0307409_100413856 | 3300031995 | Bacteria | 1291 |
| 536 | Ga0307416_100093487 | 3300032002 | Bacteria | 2590 |
| 537 | Ga0307416_100111725 | 3300032002 | Bacteria | 2410 |
| 538 | Ga0307416_100356078 | 3300032002 | Bacteria | 1483 |
| 539 | Ga0307411_10043269 | 3300032005 | Bacteria | 2880 |
| 540 | Ga0307411_10095287 | 3300032005 | Bacteria | 2089 |
| 541 | Ga0307415_100029395 | 3300032126 | Bacteria | 3512 |
| 542 | Ga0307415_100032311 | 3300032126 | Bacteria | 3383 |
| 543 | Ga0316593_10008342 | 3300032168 | Bacteria | 2884 |
| 544 | Ga0307507_10092918 | 3300033179 | Bacteria | 2572 |
| 545 | Ga0307507_10105932 | 3300033179 | Bacteria | 2325 |
| 546 | Ga0307510_10003419 | 3300033180 | Bacteria | 18519 |
| 547 | Ga0307510_10016969 | 3300033180 | Bacteria | 8587 |
| 548 | Ga0307510_10063734 | 3300033180 | Bacteria | 3750 |
| 549 | Ga0373932_0013862 | 3300035112 | Bacteria | 2015 |
| 550 | Ga0373946_0140151 | 3300035171 | Bacteria | 1120 |
| 551 | Ga0316574_0089740 | 3300035398 | Bacteria | 1958 |
| 552 | Ga0373924_0145528 | 3300035410 | Bacteria | 1035 |
| 553 | Ga0373931_0004344 | 3300035691 | Bacteria | 6472 |
| 554 | Ga0373931_0029921 | 3300035691 | Bacteria | 2800 |
| 555 | Ga0373933_0145398 | 3300035724 | Bacteria | 1499 |
| 556 | Ga0373937_0108263 | 3300036401 | Bacteria | 2584 |
| 557 | Ga0373937_0269388 | 3300036401 | Bacteria | 1607 |
| 558 | Ga0373937_0555889 | 3300036401 | Bacteria | 1090 |
| 559 | Ga0316582_0022105 | 3300036647 | Bacteria | 3771 |
| 560 | Ga0316582_0072290 | 3300036647 | Bacteria | 2236 |
| 561 | Ga0316584_0119348 | 3300036712 | Bacteria | 1971 |
| 562 | Ga0373925_0024575 | 3300037068 | Bacteria | 4399 |
| 563 | Ga0373925_0048827 | 3300037068 | Bacteria | 3154 |
| 564 | Ga0373925_0107796 | 3300037068 | Bacteria | 2149 |
| 565 | Ga0395905_0382148 | 3300037471 | Bacteria | 1302 |
| 566 | Ga0400487_56809 | 3300039110 | Bacteria | 2903 |
| 567 | Ga0436365_0972532 | 3300039437 | Bacteria | 2343 |
| 568 | Ga0436365_1295259 | 3300039437 | Bacteria | 8569 |
| 569 | Ga0436361_0004041 | 3300039447 | Bacteria | 50055 |
| 570 | Ga0436361_0006095 | 3300039447 | Bacteria | 919 |
| 571 | Ga0436361_0097160 | 3300039447 | Bacteria | 66004 |
| 572 | Ga0436361_0508822 | 3300039447 | Bacteria | 44352 |
| 573 | Ga0436361_0616064 | 3300039447 | Bacteria | 4507 |
| 574 | Ga0436361_0813098 | 3300039447 | Bacteria | 136133 |
| 575 | Ga0436361_0890342 | 3300039447 | Bacteria | 2318 |
| 576 | Ga0436361_0997353 | 3300039447 | Bacteria | 3564 |
| 577 | Ga0436361_1067841 | 3300039447 | Bacteria | 1761 |
| 578 | Ga0451789_0850686 | 3300041443 | Bacteria | 2795 |
| 579 | Ga0451791_1448603 | 3300041451 | Bacteria | 1669 |
| 580 | Ga0451793_0036517 | 3300041452 | Bacteria | 2122 |
| 581 | Ga0451795_0755555 | 3300041456 | Bacteria | 1996 |
| 582 | Ga0451798_0683313 | 3300041458 | Bacteria | 1091 |
| 583 | Ga0451802_0060270 | 3300041460 | Bacteria | 1961 |
| 584 | Ga0451839_0934005 | 3300041496 | Bacteria | 1212 |
| 585 | Ga0451853_0888552 | 3300041512 | Bacteria | 1157 |
| 586 | Ga0439455_0050885 | 3300042012 | Bacteria | 1082 |
| 587 | Ga0450911_000958 | 3300042115 | Bacteria | 7525 |
| 588 | Ga0439464_0002359 | 3300042439 | Bacteria | 4640 |
| 589 | Ga0451577_0246756 | 3300042876 | Bacteria | 1616 |
| 590 | Ga0453684_0029228 | 3300044712 | Bacteria | 7838 |
| 591 | Ga0453684_0216774 | 3300044712 | Bacteria | 2220 |
| 592 | Ga0451576_0126117 | 3300045051 | Bacteria | 2667 |
| 593 | Ga0451576_0170695 | 3300045051 | Bacteria | 2270 |
| 594 | Ga0495592_0000528 | 3300046454 | Bacteria | 27565 |
| 595 | Ga0495590_0038871 | 3300046457 | Bacteria | 1660 |
| 596 | Ga0495629_0374654 | 3300046459 | Bacteria | 969 |
| 597 | Ga0495638_0083555 | 3300046460 | Bacteria | 1934 |
| 598 | Ga0495580_0077961 | 3300046472 | Bacteria | 2311 |
| 599 | Ga0495605_0128925 | 3300046474 | Bacteria | 1142 |
| 600 | Ga0495639_0116624 | 3300046475 | Bacteria | 1271 |
| 601 | Ga0495664_0094528 | 3300046477 | Bacteria | 1799 |
| 602 | Ga0495585_0010716 | 3300046492 | Bacteria | 5444 |
| 603 | Ga0495606_0046495 | 3300046507 | Bacteria | 2868 |
| 604 | Ga0495610_0044046 | 3300046512 | Bacteria | 2219 |
| 605 | Ga0495620_0057588 | 3300046515 | Bacteria | 1630 |
| 606 | Ga0495628_0224975 | 3300046516 | Bacteria | 1408 |
| 607 | Ga0495632_0001689 | 3300046519 | Bacteria | 18062 |
| 608 | Ga0495632_0015621 | 3300046519 | Bacteria | 4246 |
| 609 | Ga0495632_0027029 | 3300046519 | Bacteria | 3011 |
| 610 | Ga0495632_0036013 | 3300046519 | Bacteria | 2520 |
| 611 | Ga0495648_0125861 | 3300046524 | Bacteria | 1370 |
| 612 | Ga0495654_0005635 | 3300046530 | Bacteria | 7244 |
| 613 | Ga0495598_0009291 | 3300046537 | Bacteria | 2320 |
| 614 | Ga0495598_0026501 | 3300046537 | Bacteria | 1590 |
| 615 | Ga0495621_0044763 | 3300046539 | Bacteria | 1565 |
| 616 | Ga0495597_0010750 | 3300046542 | Bacteria | 4460 |
| 617 | Ga0495625_0008661 | 3300046660 | Bacteria | 8648 |
| 618 | Ga0495625_0023081 | 3300046660 | Bacteria | 4757 |
| 619 | Ga0495625_0222375 | 3300046660 | Bacteria | 1236 |
| 620 | Ga0495647_0009287 | 3300046681 | Bacteria | 3327 |
| 621 | Ga0495658_0033364 | 3300046683 | Bacteria | 2818 |
| 622 | Ga0495649_0003993 | 3300046694 | Bacteria | 9723 |
| 623 | Ga0495660_0035588 | 3300046810 | Bacteria | 2781 |
| 624 | Ga0495676_0019792 | 3300047321 | Bacteria | 5917 |
| 625 | Ga0495687_001797 | 3300047443 | Bacteria | 18906 |
| 626 | Ga0495687_007155 | 3300047443 | Bacteria | 6646 |
| 627 | Ga0495686_0044943 | 3300047472 | Bacteria | 2796 |
| 628 | Ga0495593_0045863 | 3300047673 | Bacteria | 2331 |
| 629 | Ga0495626_0045695 | 3300048091 | Bacteria | 2043 |
| 630 | Ga0496101_0051814 | 3300048904 | Bacteria | 2958 |
| 631 | Ga0496102_0018789 | 3300048905 | Bacteria | 6080 |
| 632 | Ga0496103_0098087 | 3300048906 | Bacteria | 1853 |
| 633 | Ga0496104_0018943 | 3300048907 | Bacteria | 6288 |
| 634 | Ga0496104_0095478 | 3300048907 | Bacteria | 2844 |
| 635 | Ga0496105_0176831 | 3300048908 | Bacteria | 1748 |
| 636 | Ga0496106_0306686 | 3300048909 | Bacteria | 1273 |
| 637 | Ga0496107_0211422 | 3300048910 | Bacteria | 1442 |
| 638 | Ga0496108_0009600 | 3300048911 | Bacteria | 7843 |
| 639 | Ga0496108_0150854 | 3300048911 | Bacteria | 2005 |
| 640 | Ga0496109_0043536 | 3300048912 | Bacteria | 4069 |
| 641 | Ga0496110_0200555 | 3300048913 | Bacteria | 1813 |
| 642 | Ga0496111_0013244 | 3300048914 | Bacteria | 5606 |
| 643 | Ga0496112_0109655 | 3300048915 | Bacteria | 2730 |
| 644 | Ga0496112_0220849 | 3300048915 | Bacteria | 1851 |
| 645 | Ga0496113_0126219 | 3300048916 | Bacteria | 2004 |
| 646 | Ga0496114_0405558 | 3300048917 | Bacteria | 1207 |
| 647 | Ga0496115_0148915 | 3300048918 | Bacteria | 1932 |
| 648 | Ga0496121_0007296 | 3300048924 | Bacteria | 13370 |
| 649 | Ga0496122_0122437 | 3300048925 | Bacteria | 1674 |
| 650 | Ga0496123_0129409 | 3300048926 | Bacteria | 1402 |
| 651 | Ga0496124_0072578 | 3300048927 | Bacteria | 2850 |
| 652 | Ga0496125_0040624 | 3300048928 | Bacteria | 3987 |
| 653 | Ga0496125_0059109 | 3300048928 | Bacteria | 3091 |
| 654 | Ga0501043_0000277 | 3300049579 | Bacteria | 46284 |
| 655 | Ga0501046_0000345 | 3300049580 | Bacteria | 46730 |
| 656 | Ga0501047_0000395 | 3300049581 | Bacteria | 48969 |
| 657 | Ga0501048_0000111 | 3300049582 | Bacteria | 46009 |
| 658 | Ga0501198_000023 | 3300049649 | Bacteria | 69100 |
| 659 | Ga0501222_000031 | 3300049662 | Bacteria | 56867 |
| 660 | Ga0501276_003863 | 3300049773 | Bacteria | 1104 |
| 661 | Ga0501045_0071736 | 3300049824 | Bacteria | 2549 |
| 662 | nmdc:mga03683_37286_c1 | 3300050489 | Bacteria | 1540 |
| 663 | nmdc:mga03683_90202_c1 | 3300050489 | Bacteria | 1335 |
| 664 | nmdc:mga03n38_103612_c1 | 3300050490 | Bacteria | 1376 |
| 665 | nmdc:mga03n38_4126_c1 | 3300050490 | Bacteria | 4771 |
| 666 | nmdc:mga00v17_27516_c1 | 3300050491 | Bacteria | 3320 |
| 667 | nmdc:mga00v17_8528_c1 | 3300050491 | Bacteria | 5517 |
| 668 | nmdc:mga0yw44_300239_c1 | 3300050492 | Bacteria | 1076 |
| 669 | nmdc:mga0k408_11259_c1 | 3300050493 | Bacteria | 4864 |
| 670 | nmdc:mga0k408_13795_c1 | 3300050493 | Bacteria | 4438 |
| 671 | nmdc:mga0k408_1405_c1 | 3300050493 | Bacteria | 13025 |
| 672 | nmdc:mga0k408_1412_c1 | 3300050493 | Bacteria | 12975 |
| 673 | nmdc:mga0k408_2728_c1 | 3300050493 | Bacteria | 4496 |
| 674 | nmdc:mga0k408_316661_c1 | 3300050493 | Bacteria | 931 |
| 675 | nmdc:mga0k408_40965_c1 | 3300050493 | Bacteria | 2666 |
| 676 | nmdc:mga0k408_4980_c1 | 3300050493 | Bacteria | 7039 |
| 677 | nmdc:mga0k408_5321_c1 | 3300050493 | Bacteria | 6838 |
| 678 | nmdc:mga0k408_5383_c1 | 3300050493 | Bacteria | 6807 |
| 679 | nmdc:mga0k408_92577_c1 | 3300050493 | Bacteria | 1777 |
| 680 | nmdc:mga06z11_10035_c1 | 3300050494 | Bacteria | 4016 |
| 681 | nmdc:mga06z11_105112_c1 | 3300050494 | Bacteria | 1555 |
| 682 | nmdc:mga06z11_13948_c1 | 3300050494 | Bacteria | 3544 |
| 683 | nmdc:mga06z11_15236_c1 | 3300050494 | Bacteria | 3427 |
| 684 | nmdc:mga06z11_3034_c1 | 3300050494 | Bacteria | 6460 |
| 685 | nmdc:mga06z11_58993_c1 | 3300050494 | Bacteria | 1993 |
| 686 | nmdc:mga04h51_5190_c1 | 3300050495 | Bacteria | 3305 |
| 687 | nmdc:mga07m45_1136_c1 | 3300050496 | Bacteria | 11938 |
| 688 | nmdc:mga07m45_162486_c1 | 3300050496 | Bacteria | 1297 |
| 689 | nmdc:mga07m45_172704_c1 | 3300050496 | Bacteria | 1256 |
| 690 | nmdc:mga07m45_1876_c1 | 3300050496 | Bacteria | 9712 |
| 691 | nmdc:mga07m45_65850_c1 | 3300050496 | Bacteria | 2058 |
| 692 | nmdc:mga07m45_8856_c1 | 3300050496 | Bacteria | 5193 |
| 693 | nmdc:mga09592_9369_c1 | 3300050508 | Bacteria | 7965 |
| 694 | nmdc:mga0qj67_41652_c1 | 3300050509 | Bacteria | 3613 |
| 695 | nmdc:mga0sz30_114364_c1 | 3300050516 | Bacteria | 1184 |
| 696 | Ga0495601_0235306 | 3300053077 | Bacteria | 1196 |
| 697 | Ga0495595_0083762 | 3300053084 | Bacteria | 1523 |
| 698 | Ga0495619_0276097 | 3300053085 | Bacteria | 1164 |
| 699 | Ga0500578_0000406 | 3300053086 | Bacteria | 52894 |
| 700 | Ga0500578_0050971 | 3300053086 | Bacteria | 2653 |
| 701 | Ga0500578_0205033 | 3300053086 | Bacteria | 1205 |
| 702 | Ga0500644_0028023 | 3300053088 | Bacteria | 1758 |
| 703 | Ga0500646_0005193 | 3300053090 | Bacteria | 3296 |
| 704 | Ga0500651_0000877 | 3300053093 | Bacteria | 14753 |
| 705 | Ga0500651_0188997 | 3300053093 | Bacteria | 1220 |
| 706 | Ga0500641_0153343 | 3300053096 | Bacteria | 994 |
| 707 | Ga0500650_0146576 | 3300053098 | Bacteria | 1093 |
| 708 | Ga0500569_018620 | 3300053109 | Bacteria | 1796 |
| 709 | Ga0500593_000740 | 3300053117 | Bacteria | 12307 |
| 710 | Ga0500593_132659 | 3300053117 | Bacteria | 992 |
| 711 | Ga0500628_003477 | 3300053129 | Bacteria | 2600 |
| 712 | Ga0500642_0026417 | 3300053130 | Bacteria | 2370 |
| 713 | Ga0500642_0058307 | 3300053130 | Bacteria | 1725 |
| 714 | Ga0500652_000420 | 3300053131 | Bacteria | 15148 |
| 715 | Ga0500652_006725 | 3300053131 | Bacteria | 3721 |
| 716 | Ga0500658_0006265 | 3300053134 | Bacteria | 4423 |
| 717 | Ga0500559_0000265 | 3300053136 | Bacteria | 40939 |
| 718 | Ga0500561_0019744 | 3300053137 | Bacteria | 1565 |
| 719 | Ga0500568_0011911 | 3300053139 | Bacteria | 4014 |
| 720 | Ga0500568_0073755 | 3300053139 | Bacteria | 1303 |
| 721 | Ga0500622_0001047 | 3300053156 | Bacteria | 23044 |
| 722 | Ga0500622_0002039 | 3300053156 | Bacteria | 15066 |
| 723 | Ga0500622_0063954 | 3300053156 | Bacteria | 1872 |
| 724 | Ga0500636_0109930 | 3300053177 | Bacteria | 1559 |
| 725 | Ga0500645_003124 | 3300053730 | Bacteria | 6902 |
| 726 | Ga0500587_001927 | 3300053739 | Bacteria | 2956 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031456 | Ga0307513_10116245 | Ga0307513_101162452 | 249 |
| 2 | 3300013308 | Ga0157375_10168125 | Ga0157375_101681252 | 258 |
| 3 | 3300050493 | nmdc:mga0k408_2728_c1 | nmdc:mga0k408_2728_c1_10_822 | 265 |
| 4 | 3300050516 | nmdc:mga0sz30_114364_c1 | nmdc:mga0sz30_114364_c1_355_1170 | 266 |
| 5 | 3300006048 | Ga0075363_100015708 | Ga0075363_1000157083 | 268 |
| 6 | 3300006195 | Ga0075366_10017325 | Ga0075366_100173253 | 268 |
| 7 | 3300006353 | Ga0075370_10012014 | Ga0075370_100120143 | 268 |
| 8 | 3300013306 | Ga0163162_10061442 | Ga0163162_100614423 | 268 |
| 9 | 3300050490 | nmdc:mga03n38_103612_c1 | nmdc:mga03n38_103612_c1_311_1192 | 268 |
| 10 | 3300050493 | nmdc:mga0k408_11259_c1 | nmdc:mga0k408_11259_c1_3180_4061 | 268 |
| 11 | 3300050494 | nmdc:mga06z11_58993_c1 | nmdc:mga06z11_58993_c1_917_1798 | 268 |
| 12 | 3300035398 | Ga0316574_0089740 | Ga0316574_0089740_15_878 | 269 |
| 13 | 3300021361 | Ga0213872_10000141 | Ga0213872_1000014121 | 270 |
| 14 | 3300032168 | Ga0316593_10008342 | Ga0316593_100083422 | 270 |
| 15 | 3300039447 | Ga0436361_0508822 | Ga0436361_0508822_21564_22457 | 270 |
| 16 | 3300021361 | Ga0213872_10041095 | Ga0213872_100410953 | 271 |
| 17 | 3300039447 | Ga0436361_0890342 | Ga0436361_0890342_835_1716 | 271 |
| 18 | 3300005549 | Ga0070704_100034005 | Ga0070704_1000340053 | 272 |
| 19 | iso_pu_bacteria | 2574179768 | 2574429964 | 272 |
| 20 | 3300039447 | Ga0436361_0006095 | Ga0436361_0006095_16_864 | 275 |
| 21 | 3300039110 | Ga0400487_56809 | Ga0400487_56809_1614_2474 | 276 |
| 22 | 3300026041 | Ga0207639_10549776 | Ga0207639_105497761 | 279 |
| 23 | 3300036647 | Ga0316582_0022105 | Ga0316582_0022105_1724_2587 | 279 |
| 24 | 3300036647 | Ga0316582_0072290 | Ga0316582_0072290_1349_2212 | 279 |
| 25 | 3300036712 | Ga0316584_0119348 | Ga0316584_0119348_447_1310 | 279 |
| 26 | 3300014497 | Ga0182008_10000148 | Ga0182008_1000014823 | 280 |
| 27 | 3300003320 | rootH2_10090249 | rootH2_100902492 | 281 |
| 28 | 3300003323 | rootH1_10182120 | rootH1_101821203 | 281 |
| 29 | 3300003758 | Ga0055532_1003704 | Ga0055532_10037042 | 281 |
| 30 | 3300003759 | Ga0055525_1000056 | Ga0055525_1000056173 | 281 |
| 31 | 3300003760 | Ga0055527_1001533 | Ga0055527_10015335 | 281 |
| 32 | 3300003761 | Ga0055535_1002809 | Ga0055535_10028095 | 281 |
| 33 | 3300003762 | Ga0055542_1002605 | Ga0055542_10026055 | 281 |
| 34 | 3300003763 | Ga0055529_1000823 | Ga0055529_10008235 | 281 |
| 35 | 3300003790 | Ga0055528_1001010 | Ga0055528_10010106 | 281 |
| 36 | 3300003856 | Ga0058692_1001284 | Ga0058692_10012849 | 281 |
| 37 | 3300021361 | Ga0213872_10000120 | Ga0213872_1000012039 | 281 |
| 38 | 3300025228 | Ga0209672_100153 | Ga0209672_10015351 | 281 |
| 39 | 3300025229 | Ga0209147_100043 | Ga0209147_100043271 | 281 |
| 40 | 3300025230 | Ga0209563_100014 | Ga0209563_10001421 | 281 |
| 41 | 3300025242 | Ga0209258_100023 | Ga0209258_100023470 | 281 |
| 42 | 3300025254 | Ga0209148_1000029 | Ga0209148_1000029537 | 281 |
| 43 | 3300025263 | Ga0209565_1013438 | Ga0209565_10134381 | 281 |
| 44 | 3300025272 | Ga0209455_1000064 | Ga0209455_1000064266 | 281 |
| 45 | 3300025272 | Ga0209455_1000722 | Ga0209455_10007226 | 281 |
| 46 | 3300025273 | Ga0209673_1000084 | Ga0209673_100008482 | 281 |
| 47 | 3300025295 | Ga0209564_1003064 | Ga0209564_10030643 | 281 |
| 48 | 3300027312 | Ga0209371_1000526 | Ga0209371_100052619 | 281 |
| 49 | 3300030500 | Ga0268256_1000860 | Ga0268256_100086017 | 281 |
| 50 | 3300039447 | Ga0436361_0097160 | Ga0436361_0097160_39116_39988 | 281 |
| 51 | iso_pu_bacteria | 2585428057 | 2587730577 | 281 |
| 52 | iso_pu_bacteria | 2585428058 | 2587736805 | 281 |
| 53 | iso_pu_bacteria | 2585428062 | 2587758931 | 281 |
| 54 | iso_pu_bacteria | 2588253510 | 2588294948 | 281 |
| 55 | iso_pu_bacteria | 2643221592 | 2643967807 | 281 |
| 56 | iso_pu_bacteria | 2643221625 | 2644140629 | 281 |
| 57 | iso_pu_bacteria | 2643221648 | 2644273596 | 281 |
| 58 | iso_pu_bacteria | 2738543013 | 2739249845 | 281 |
| 59 | 3300003322 | rootL2_10190253 | rootL2_101902531 | 282 |
| 60 | 3300003784 | Ga0055534_1000722 | Ga0055534_100072215 | 282 |
| 61 | 3300003792 | Ga0055540_1012226 | Ga0055540_10122262 | 282 |
| 62 | 3300005295 | Ga0065707_10099760 | Ga0065707_100997603 | 282 |
| 63 | 3300005328 | Ga0070676_10029595 | Ga0070676_100295954 | 282 |
| 64 | 3300005330 | Ga0070690_100325991 | Ga0070690_1003259911 | 282 |
| 65 | 3300005347 | Ga0070668_100207372 | Ga0070668_1002073723 | 282 |
| 66 | 3300005456 | Ga0070678_100015954 | Ga0070678_1000159545 | 282 |
| 67 | 3300005459 | Ga0068867_100005331 | Ga0068867_1000053314 | 282 |
| 68 | 3300005467 | Ga0070706_100074527 | Ga0070706_1000745272 | 282 |
| 69 | 3300005543 | Ga0070672_100009095 | Ga0070672_1000090953 | 282 |
| 70 | 3300005616 | Ga0068852_100006370 | Ga0068852_1000063702 | 282 |
| 71 | 3300005719 | Ga0068861_100011019 | Ga0068861_1000110194 | 282 |
| 72 | 3300005841 | Ga0068863_100425543 | Ga0068863_1004255432 | 282 |
| 73 | 3300005843 | Ga0068860_100001559 | Ga0068860_10000155911 | 282 |
| 74 | 3300005843 | Ga0068860_100033277 | Ga0068860_1000332772 | 282 |
| 75 | 3300005844 | Ga0068862_100056270 | Ga0068862_1000562704 | 282 |
| 76 | 3300005937 | Ga0081455_10060841 | Ga0081455_100608413 | 282 |
| 77 | 3300006048 | Ga0075363_100074539 | Ga0075363_1000745392 | 282 |
| 78 | 3300006177 | Ga0075362_10047649 | Ga0075362_100476491 | 282 |
| 79 | 3300006178 | Ga0075367_10160829 | Ga0075367_101608292 | 282 |
| 80 | 3300006195 | Ga0075366_10009087 | Ga0075366_100090875 | 282 |
| 81 | 3300006195 | Ga0075366_10148112 | Ga0075366_101481122 | 282 |
| 82 | 3300006880 | Ga0075429_100038607 | Ga0075429_1000386074 | 282 |
| 83 | 3300009093 | Ga0105240_10018949 | Ga0105240_100189494 | 282 |
| 84 | 3300009093 | Ga0105240_10290860 | Ga0105240_102908602 | 282 |
| 85 | 3300009148 | Ga0105243_10000649 | Ga0105243_100006494 | 282 |
| 86 | 3300009545 | Ga0105237_10001988 | Ga0105237_1000198819 | 282 |
| 87 | 3300009551 | Ga0105238_10014640 | Ga0105238_100146404 | 282 |
| 88 | 3300009553 | Ga0105249_10018682 | Ga0105249_100186822 | 282 |
| 89 | 3300010375 | Ga0105239_10004146 | Ga0105239_1000414612 | 282 |
| 90 | 3300013297 | Ga0157378_10001811 | Ga0157378_1000181111 | 282 |
| 91 | 3300013308 | Ga0157375_10120376 | Ga0157375_101203763 | 282 |
| 92 | 3300014745 | Ga0157377_10000006 | Ga0157377_10000006406 | 282 |
| 93 | 3300014968 | Ga0157379_10125292 | Ga0157379_101252922 | 282 |
| 94 | 3300021361 | Ga0213872_10014511 | Ga0213872_100145113 | 282 |
| 95 | 3300025291 | Ga0209675_1002104 | Ga0209675_100210410 | 282 |
| 96 | 3300025292 | Ga0209676_1030785 | Ga0209676_10307852 | 282 |
| 97 | 3300025303 | Ga0209051_1023211 | Ga0209051_10232112 | 282 |
| 98 | 3300025304 | Ga0209257_1011852 | Ga0209257_10118522 | 282 |
| 99 | 3300025899 | Ga0207642_10073719 | Ga0207642_100737192 | 282 |
| 100 | 3300025907 | Ga0207645_10038735 | Ga0207645_100387354 | 282 |
| 101 | 3300025910 | Ga0207684_10139365 | Ga0207684_101393652 | 282 |
| 102 | 3300025913 | Ga0207695_10164414 | Ga0207695_101644143 | 282 |
| 103 | 3300025914 | Ga0207671_10002519 | Ga0207671_100025196 | 282 |
| 104 | 3300025935 | Ga0207709_10001139 | Ga0207709_100011394 | 282 |
| 105 | 3300025940 | Ga0207691_10048981 | Ga0207691_100489814 | 282 |
| 106 | 3300025940 | Ga0207691_10416470 | Ga0207691_104164701 | 282 |
| 107 | 3300025972 | Ga0207668_10092283 | Ga0207668_100922834 | 282 |
| 108 | 3300026035 | Ga0207703_10236104 | Ga0207703_102361042 | 282 |
| 109 | 3300026041 | Ga0207639_10022020 | Ga0207639_100220204 | 282 |
| 110 | 3300026089 | Ga0207648_10000254 | Ga0207648_1000025454 | 282 |
| 111 | 3300026089 | Ga0207648_10000419 | Ga0207648_1000041912 | 282 |
| 112 | 3300026118 | Ga0207675_100004240 | Ga0207675_1000042406 | 282 |
| 113 | 3300026121 | Ga0207683_10077576 | Ga0207683_100775763 | 282 |
| 114 | 3300026121 | Ga0207683_10367252 | Ga0207683_103672522 | 282 |
| 115 | 3300026142 | Ga0207698_10317308 | Ga0207698_103173082 | 282 |
| 116 | 3300027876 | Ga0209974_10001326 | Ga0209974_100013262 | 282 |
| 117 | 3300028380 | Ga0268265_10037721 | Ga0268265_100377214 | 282 |
| 118 | 3300028380 | Ga0268265_10293563 | Ga0268265_102935632 | 282 |
| 119 | 3300028381 | Ga0268264_10002884 | Ga0268264_1000288411 | 282 |
| 120 | 3300028381 | Ga0268264_10099566 | Ga0268264_100995663 | 282 |
| 121 | 3300028794 | Ga0307515_10001761 | Ga0307515_1000176118 | 282 |
| 122 | 3300031239 | Ga0265328_10081360 | Ga0265328_100813602 | 282 |
| 123 | 3300031250 | Ga0265331_10001051 | Ga0265331_100010516 | 282 |
| 124 | 3300031251 | Ga0265327_10000149 | Ga0265327_100001497 | 282 |
| 125 | 3300031456 | Ga0307513_10121506 | Ga0307513_101215063 | 282 |
| 126 | 3300031548 | Ga0307408_100204666 | Ga0307408_1002046662 | 282 |
| 127 | 3300031616 | Ga0307508_10000440 | Ga0307508_1000044032 | 282 |
| 128 | 3300031649 | Ga0307514_10012264 | Ga0307514_100122643 | 282 |
| 129 | 3300031730 | Ga0307516_10001466 | Ga0307516_1000146618 | 282 |
| 130 | 3300031730 | Ga0307516_10087052 | Ga0307516_100870522 | 282 |
| 131 | 3300031731 | Ga0307405_10364613 | Ga0307405_103646132 | 282 |
| 132 | 3300032002 | Ga0307416_100111725 | Ga0307416_1001117251 | 282 |
| 133 | 3300033179 | Ga0307507_10105932 | Ga0307507_101059322 | 282 |
| 134 | 3300035171 | Ga0373946_0140151 | Ga0373946_0140151_195_1097 | 282 |
| 135 | 3300037068 | Ga0373925_0048827 | Ga0373925_0048827_1447_2349 | 282 |
| 136 | 3300037471 | Ga0395905_0382148 | Ga0395905_0382148_11_901 | 282 |
| 137 | 3300039447 | Ga0436361_0616064 | Ga0436361_0616064_2300_3187 | 282 |
| 138 | 3300041496 | Ga0451839_0934005 | Ga0451839_0934005_70_957 | 282 |
| 139 | 3300042115 | Ga0450911_000958 | Ga0450911_000958_3517_4386 | 282 |
| 140 | 3300046475 | Ga0495639_0116624 | Ga0495639_0116624_244_1146 | 282 |
| 141 | 3300046477 | Ga0495664_0094528 | Ga0495664_0094528_36_953 | 282 |
| 142 | 3300046492 | Ga0495585_0010716 | Ga0495585_0010716_2495_3385 | 282 |
| 143 | 3300046519 | Ga0495632_0015621 | Ga0495632_0015621_1564_2451 | 282 |
| 144 | 3300046660 | Ga0495625_0008661 | Ga0495625_0008661_5100_5987 | 282 |
| 145 | 3300047472 | Ga0495686_0044943 | Ga0495686_0044943_1175_2062 | 282 |
| 146 | 3300048905 | Ga0496102_0018789 | Ga0496102_0018789_367_1242 | 282 |
| 147 | 3300048924 | Ga0496121_0007296 | Ga0496121_0007296_8939_9808 | 282 |
| 148 | 3300048927 | Ga0496124_0072578 | Ga0496124_0072578_890_1759 | 282 |
| 149 | 3300048928 | Ga0496125_0040624 | Ga0496125_0040624_680_1549 | 282 |
| 150 | 3300048928 | Ga0496125_0059109 | Ga0496125_0059109_1538_2407 | 282 |
| 151 | 3300049579 | Ga0501043_0000277 | Ga0501043_0000277_33941_34834 | 282 |
| 152 | 3300049580 | Ga0501046_0000345 | Ga0501046_0000345_11897_12790 | 282 |
| 153 | 3300049581 | Ga0501047_0000395 | Ga0501047_0000395_33941_34834 | 282 |
| 154 | 3300049582 | Ga0501048_0000111 | Ga0501048_0000111_33891_34784 | 282 |
| 155 | 3300049649 | Ga0501198_000023 | Ga0501198_000023_61972_62847 | 282 |
| 156 | 3300049662 | Ga0501222_000031 | Ga0501222_000031_6270_7145 | 282 |
| 157 | 3300049773 | Ga0501276_003863 | Ga0501276_003863_131_1006 | 282 |
| 158 | 3300049824 | Ga0501045_0071736 | Ga0501045_0071736_439_1332 | 282 |
| 159 | 3300050493 | nmdc:mga0k408_1412_c1 | nmdc:mga0k408_1412_c1_9676_10551 | 282 |
| 160 | 3300050493 | nmdc:mga0k408_316661_c1 | nmdc:mga0k408_316661_c1_27_902 | 282 |
| 161 | 3300050508 | nmdc:mga09592_9369_c1 | nmdc:mga09592_9369_c1_5922_6797 | 282 |
| 162 | 3300050509 | nmdc:mga0qj67_41652_c1 | nmdc:mga0qj67_41652_c1_2467_3342 | 282 |
| 163 | 3300053117 | Ga0500593_000740 | Ga0500593_000740_2894_3784 | 282 |
| 164 | 3300053739 | Ga0500587_001927 | Ga0500587_001927_1145_2032 | 282 |
| 165 | iso_pu_bacteria | 2928115317 | 2928120505 | 282 |
| 166 | 3300002773 | JGI25152J39213_1001430 | JGI25152J39213_10014305 | 283 |
| 167 | 3300003215 | JGI25153J46596_10006137 | JGI25153J46596_100061374 | 283 |
| 168 | 3300003215 | JGI25153J46596_10029984 | JGI25153J46596_100299842 | 283 |
| 169 | 3300003790 | Ga0055528_1031440 | Ga0055528_10314401 | 283 |
| 170 | 3300005262 | Ga0065165_1000910 | Ga0065165_10009105 | 283 |
| 171 | 3300006038 | Ga0075365_10057943 | Ga0075365_100579433 | 283 |
| 172 | 3300006178 | Ga0075367_10024628 | Ga0075367_100246282 | 283 |
| 173 | 3300006195 | Ga0075366_10007235 | Ga0075366_100072354 | 283 |
| 174 | 3300006353 | Ga0075370_10001171 | Ga0075370_1000117112 | 283 |
| 175 | 3300021361 | Ga0213872_10000155 | Ga0213872_1000015554 | 283 |
| 176 | 3300021361 | Ga0213872_10022453 | Ga0213872_100224532 | 283 |
| 177 | 3300025245 | Ga0207425_1000703 | Ga0207425_100070314 | 283 |
| 178 | 3300025258 | Ga0209129_1000933 | Ga0209129_10009339 | 283 |
| 179 | 3300025273 | Ga0209673_1008819 | Ga0209673_10088194 | 283 |
| 180 | 3300025273 | Ga0209673_1014498 | Ga0209673_10144981 | 283 |
| 181 | 3300025295 | Ga0209564_1000627 | Ga0209564_100062747 | 283 |
| 182 | 3300025297 | Ga0209758_1000593 | Ga0209758_100059349 | 283 |
| 183 | 3300025297 | Ga0209758_1000769 | Ga0209758_100076938 | 283 |
| 184 | 3300025298 | Ga0209050_1000799 | Ga0209050_100079935 | 283 |
| 185 | 3300025299 | Ga0209256_1012880 | Ga0209256_10128802 | 283 |
| 186 | 3300025304 | Ga0209257_1047282 | Ga0209257_10472822 | 283 |
| 187 | 3300039447 | Ga0436361_0813098 | Ga0436361_0813098_10358_11236 | 283 |
| 188 | 3300039447 | Ga0436361_0997353 | Ga0436361_0997353_1451_2329 | 283 |
| 189 | 3300041443 | Ga0451789_0850686 | Ga0451789_0850686_750_1625 | 283 |
| 190 | 3300041451 | Ga0451791_1448603 | Ga0451791_1448603_596_1471 | 283 |
| 191 | 3300041452 | Ga0451793_0036517 | Ga0451793_0036517_759_1634 | 283 |
| 192 | 3300041456 | Ga0451795_0755555 | Ga0451795_0755555_1058_1933 | 283 |
| 193 | 3300041458 | Ga0451798_0683313 | Ga0451798_0683313_183_1058 | 283 |
| 194 | 3300041460 | Ga0451802_0060270 | Ga0451802_0060270_244_1119 | 283 |
| 195 | 3300046512 | Ga0495610_0044046 | Ga0495610_0044046_908_1783 | 283 |
| 196 | 3300046519 | Ga0495632_0001689 | Ga0495632_0001689_1024_1899 | 283 |
| 197 | 3300050494 | nmdc:mga06z11_15236_c1 | nmdc:mga06z11_15236_c1_2084_2959 | 283 |
| 198 | 3300050496 | nmdc:mga07m45_8856_c1 | nmdc:mga07m45_8856_c1_3808_4683 | 283 |
| 199 | 3300053086 | Ga0500578_0000406 | Ga0500578_0000406_41579_42454 | 283 |
| 200 | 3300053088 | Ga0500644_0028023 | Ga0500644_0028023_359_1234 | 283 |
| 201 | 3300053090 | Ga0500646_0005193 | Ga0500646_0005193_150_1025 | 283 |
| 202 | 3300053093 | Ga0500651_0000877 | Ga0500651_0000877_10240_11115 | 283 |
| 203 | 3300053096 | Ga0500641_0153343 | Ga0500641_0153343_53_928 | 283 |
| 204 | 3300053098 | Ga0500650_0146576 | Ga0500650_0146576_133_1008 | 283 |
| 205 | 3300053109 | Ga0500569_018620 | Ga0500569_018620_640_1515 | 283 |
| 206 | 3300053117 | Ga0500593_132659 | Ga0500593_132659_30_905 | 283 |
| 207 | 3300053129 | Ga0500628_003477 | Ga0500628_003477_1044_1919 | 283 |
| 208 | 3300053130 | Ga0500642_0026417 | Ga0500642_0026417_829_1704 | 283 |
| 209 | 3300053130 | Ga0500642_0058307 | Ga0500642_0058307_254_1129 | 283 |
| 210 | 3300053131 | Ga0500652_000420 | Ga0500652_000420_2781_3656 | 283 |
| 211 | 3300053137 | Ga0500561_0019744 | Ga0500561_0019744_333_1208 | 283 |
| 212 | 3300053139 | Ga0500568_0073755 | Ga0500568_0073755_317_1192 | 283 |
| 213 | 3300053156 | Ga0500622_0001047 | Ga0500622_0001047_14018_14893 | 283 |
| 214 | 3300053156 | Ga0500622_0063954 | Ga0500622_0063954_349_1224 | 283 |
| 215 | 3300005331 | Ga0070670_100132670 | Ga0070670_1001326701 | 284 |
| 216 | 3300006177 | Ga0075362_10090893 | Ga0075362_100908933 | 284 |
| 217 | 3300021361 | Ga0213872_10000277 | Ga0213872_100002777 | 284 |
| 218 | 3300028794 | Ga0307515_10209215 | Ga0307515_102092152 | 284 |
| 219 | 3300039447 | Ga0436361_0004041 | Ga0436361_0004041_18891_19787 | 284 |
| 220 | 3300039447 | Ga0436361_1067841 | Ga0436361_1067841_858_1739 | 284 |
| 221 | iso_pu_bacteria | 2919704043 | 2919708972 | 284 |
| 222 | 3300005328 | Ga0070676_10115885 | Ga0070676_101158852 | 285 |
| 223 | 3300005331 | Ga0070670_100228926 | Ga0070670_1002289262 | 285 |
| 224 | 3300005333 | Ga0070677_10043499 | Ga0070677_100434991 | 285 |
| 225 | 3300005333 | Ga0070677_10059229 | Ga0070677_100592292 | 285 |
| 226 | 3300005335 | Ga0070666_10019439 | Ga0070666_100194395 | 285 |
| 227 | 3300005338 | Ga0068868_100041022 | Ga0068868_1000410224 | 285 |
| 228 | 3300005353 | Ga0070669_100305094 | Ga0070669_1003050941 | 285 |
| 229 | 3300005354 | Ga0070675_100095980 | Ga0070675_1000959803 | 285 |
| 230 | 3300005355 | Ga0070671_100055566 | Ga0070671_1000555662 | 285 |
| 231 | 3300005355 | Ga0070671_100082453 | Ga0070671_1000824534 | 285 |
| 232 | 3300005355 | Ga0070671_100272828 | Ga0070671_1002728282 | 285 |
| 233 | 3300005356 | Ga0070674_100423751 | Ga0070674_1004237511 | 285 |
| 234 | 3300005364 | Ga0070673_100044736 | Ga0070673_1000447364 | 285 |
| 235 | 3300005367 | Ga0070667_100101241 | Ga0070667_1001012412 | 285 |
| 236 | 3300005456 | Ga0070678_100061375 | Ga0070678_1000613752 | 285 |
| 237 | 3300005457 | Ga0070662_100148501 | Ga0070662_1001485012 | 285 |
| 238 | 3300005457 | Ga0070662_100333430 | Ga0070662_1003334302 | 285 |
| 239 | 3300005459 | Ga0068867_100046359 | Ga0068867_1000463594 | 285 |
| 240 | 3300005459 | Ga0068867_100103912 | Ga0068867_1001039122 | 285 |
| 241 | 3300005466 | Ga0070685_10101141 | Ga0070685_101011412 | 285 |
| 242 | 3300005548 | Ga0070665_100342154 | Ga0070665_1003421542 | 285 |
| 243 | 3300005578 | Ga0068854_100057248 | Ga0068854_1000572484 | 285 |
| 244 | 3300005618 | Ga0068864_100011131 | Ga0068864_1000111312 | 285 |
| 245 | 3300005719 | Ga0068861_100478323 | Ga0068861_1004783232 | 285 |
| 246 | 3300005834 | Ga0068851_10090779 | Ga0068851_100907792 | 285 |
| 247 | 3300005841 | Ga0068863_100010999 | Ga0068863_1000109996 | 285 |
| 248 | 3300005844 | Ga0068862_100162356 | Ga0068862_1001623563 | 285 |
| 249 | 3300009553 | Ga0105249_10094890 | Ga0105249_100948903 | 285 |
| 250 | 3300013296 | Ga0157374_10143755 | Ga0157374_101437554 | 285 |
| 251 | 3300013297 | Ga0157378_10289253 | Ga0157378_102892532 | 285 |
| 252 | 3300013308 | Ga0157375_10090733 | Ga0157375_100907334 | 285 |
| 253 | 3300014325 | Ga0163163_10011394 | Ga0163163_100113944 | 285 |
| 254 | 3300014968 | Ga0157379_10016325 | Ga0157379_100163254 | 285 |
| 255 | 3300014969 | Ga0157376_10052668 | Ga0157376_100526683 | 285 |
| 256 | 3300025271 | Ga0207666_1005498 | Ga0207666_10054981 | 285 |
| 257 | 3300025315 | Ga0207697_10021253 | Ga0207697_100212532 | 285 |
| 258 | 3300025893 | Ga0207682_10010609 | Ga0207682_100106092 | 285 |
| 259 | 3300025893 | Ga0207682_10019286 | Ga0207682_100192863 | 285 |
| 260 | 3300025907 | Ga0207645_10144160 | Ga0207645_101441602 | 285 |
| 261 | 3300025923 | Ga0207681_10027585 | Ga0207681_100275853 | 285 |
| 262 | 3300025931 | Ga0207644_10048247 | Ga0207644_100482472 | 285 |
| 263 | 3300025936 | Ga0207670_10053469 | Ga0207670_100534693 | 285 |
| 264 | 3300025942 | Ga0207689_10049644 | Ga0207689_100496442 | 285 |
| 265 | 3300025945 | Ga0207679_10365964 | Ga0207679_103659641 | 285 |
| 266 | 3300025961 | Ga0207712_10187570 | Ga0207712_101875701 | 285 |
| 267 | 3300025972 | Ga0207668_10081035 | Ga0207668_100810354 | 285 |
| 268 | 3300025981 | Ga0207640_10155938 | Ga0207640_101559382 | 285 |
| 269 | 3300026023 | Ga0207677_10061139 | Ga0207677_100611393 | 285 |
| 270 | 3300026088 | Ga0207641_10100741 | Ga0207641_101007413 | 285 |
| 271 | 3300026089 | Ga0207648_10024822 | Ga0207648_100248224 | 285 |
| 272 | 3300026089 | Ga0207648_10066548 | Ga0207648_100665484 | 285 |
| 273 | 3300026121 | Ga0207683_10101938 | Ga0207683_101019383 | 285 |
| 274 | 3300028379 | Ga0268266_10191859 | Ga0268266_101918592 | 285 |
| 275 | 3300036401 | Ga0373937_0269388 | Ga0373937_0269388_413_1297 | 285 |
| 276 | 3300042439 | Ga0439464_0002359 | Ga0439464_0002359_2406_3290 | 285 |
| 277 | 3300046537 | Ga0495598_0009291 | Ga0495598_0009291_615_1499 | 285 |
| 278 | 3300046537 | Ga0495598_0026501 | Ga0495598_0026501_326_1243 | 285 |
| 279 | 3300046539 | Ga0495621_0044763 | Ga0495621_0044763_560_1477 | 285 |
| 280 | 3300048907 | Ga0496104_0095478 | Ga0496104_0095478_754_1638 | 285 |
| 281 | 3300048908 | Ga0496105_0176831 | Ga0496105_0176831_177_1061 | 285 |
| 282 | 3300048925 | Ga0496122_0122437 | Ga0496122_0122437_644_1525 | 285 |
| 283 | 3300048926 | Ga0496123_0129409 | Ga0496123_0129409_55_936 | 285 |
| 284 | iso_pu_bacteria | 2643221654 | 2644303490 | 285 |
| 285 | 3300003316 | rootH1_10059918 | rootH1_100599182 | 286 |
| 286 | 3300003322 | rootL2_10074920 | rootL2_100749202 | 286 |
| 287 | 3300005331 | Ga0070670_100000775 | Ga0070670_10000077512 | 286 |
| 288 | 3300005331 | Ga0070670_100019018 | Ga0070670_1000190183 | 286 |
| 289 | 3300005338 | Ga0068868_100084774 | Ga0068868_1000847744 | 286 |
| 290 | 3300005338 | Ga0068868_100299470 | Ga0068868_1002994702 | 286 |
| 291 | 3300005338 | Ga0068868_100420606 | Ga0068868_1004206061 | 286 |
| 292 | 3300005347 | Ga0070668_100135605 | Ga0070668_1001356052 | 286 |
| 293 | 3300005353 | Ga0070669_100171684 | Ga0070669_1001716842 | 286 |
| 294 | 3300005353 | Ga0070669_100402027 | Ga0070669_1004020272 | 286 |
| 295 | 3300005354 | Ga0070675_100001482 | Ga0070675_10000148217 | 286 |
| 296 | 3300005354 | Ga0070675_100034226 | Ga0070675_1000342263 | 286 |
| 297 | 3300005355 | Ga0070671_100042415 | Ga0070671_1000424154 | 286 |
| 298 | 3300005355 | Ga0070671_100187226 | Ga0070671_1001872262 | 286 |
| 299 | 3300005356 | Ga0070674_100120808 | Ga0070674_1001208082 | 286 |
| 300 | 3300005364 | Ga0070673_100003372 | Ga0070673_1000033728 | 286 |
| 301 | 3300005364 | Ga0070673_100236798 | Ga0070673_1002367982 | 286 |
| 302 | 3300005367 | Ga0070667_100006649 | Ga0070667_1000066499 | 286 |
| 303 | 3300005367 | Ga0070667_100131122 | Ga0070667_1001311223 | 286 |
| 304 | 3300005445 | Ga0070708_100258413 | Ga0070708_1002584131 | 286 |
| 305 | 3300005456 | Ga0070678_100017348 | Ga0070678_1000173481 | 286 |
| 306 | 3300005457 | Ga0070662_100189138 | Ga0070662_1001891383 | 286 |
| 307 | 3300005459 | Ga0068867_100002317 | Ga0068867_1000023177 | 286 |
| 308 | 3300005459 | Ga0068867_100517055 | Ga0068867_1005170551 | 286 |
| 309 | 3300005467 | Ga0070706_100000367 | Ga0070706_10000036716 | 286 |
| 310 | 3300005468 | Ga0070707_100185816 | Ga0070707_1001858162 | 286 |
| 311 | 3300005543 | Ga0070672_100000485 | Ga0070672_10000048512 | 286 |
| 312 | 3300005543 | Ga0070672_100050694 | Ga0070672_1000506944 | 286 |
| 313 | 3300005547 | Ga0070693_100325643 | Ga0070693_1003256431 | 286 |
| 314 | 3300005548 | Ga0070665_100058116 | Ga0070665_1000581162 | 286 |
| 315 | 3300005548 | Ga0070665_100472217 | Ga0070665_1004722172 | 286 |
| 316 | 3300005564 | Ga0070664_100091085 | Ga0070664_1000910852 | 286 |
| 317 | 3300005578 | Ga0068854_100081993 | Ga0068854_1000819932 | 286 |
| 318 | 3300005616 | Ga0068852_100048807 | Ga0068852_1000488074 | 286 |
| 319 | 3300005616 | Ga0068852_100108555 | Ga0068852_1001085552 | 286 |
| 320 | 3300005618 | Ga0068864_100035355 | Ga0068864_1000353553 | 286 |
| 321 | 3300005618 | Ga0068864_100158532 | Ga0068864_1001585322 | 286 |
| 322 | 3300006038 | Ga0075365_10082684 | Ga0075365_100826842 | 286 |
| 323 | 3300006042 | Ga0075368_10003231 | Ga0075368_100032315 | 286 |
| 324 | 3300006042 | Ga0075368_10005709 | Ga0075368_100057095 | 286 |
| 325 | 3300006042 | Ga0075368_10029201 | Ga0075368_100292012 | 286 |
| 326 | 3300006048 | Ga0075363_100000145 | Ga0075363_10000014511 | 286 |
| 327 | 3300006048 | Ga0075363_100050668 | Ga0075363_1000506683 | 286 |
| 328 | 3300006048 | Ga0075363_100122212 | Ga0075363_1001222122 | 286 |
| 329 | 3300006051 | Ga0075364_10058438 | Ga0075364_100584383 | 286 |
| 330 | 3300006177 | Ga0075362_10000580 | Ga0075362_1000058010 | 286 |
| 331 | 3300006177 | Ga0075362_10003899 | Ga0075362_100038994 | 286 |
| 332 | 3300006178 | Ga0075367_10002249 | Ga0075367_100022495 | 286 |
| 333 | 3300006178 | Ga0075367_10004330 | Ga0075367_100043304 | 286 |
| 334 | 3300006178 | Ga0075367_10012127 | Ga0075367_100121273 | 286 |
| 335 | 3300006178 | Ga0075367_10034912 | Ga0075367_100349122 | 286 |
| 336 | 3300006178 | Ga0075367_10275422 | Ga0075367_102754221 | 286 |
| 337 | 3300006186 | Ga0075369_10003203 | Ga0075369_100032037 | 286 |
| 338 | 3300006186 | Ga0075369_10018407 | Ga0075369_100184074 | 286 |
| 339 | 3300006186 | Ga0075369_10064800 | Ga0075369_100648001 | 286 |
| 340 | 3300006195 | Ga0075366_10000582 | Ga0075366_1000058215 | 286 |
| 341 | 3300006195 | Ga0075366_10001974 | Ga0075366_100019749 | 286 |
| 342 | 3300006195 | Ga0075366_10016069 | Ga0075366_100160694 | 286 |
| 343 | 3300006195 | Ga0075366_10022472 | Ga0075366_100224724 | 286 |
| 344 | 3300006195 | Ga0075366_10052321 | Ga0075366_100523212 | 286 |
| 345 | 3300006195 | Ga0075366_10138256 | Ga0075366_101382563 | 286 |
| 346 | 3300006195 | Ga0075366_10165633 | Ga0075366_101656332 | 286 |
| 347 | 3300006195 | Ga0075366_10186592 | Ga0075366_101865921 | 286 |
| 348 | 3300006353 | Ga0075370_10000854 | Ga0075370_100008549 | 286 |
| 349 | 3300006353 | Ga0075370_10002800 | Ga0075370_100028007 | 286 |
| 350 | 3300006353 | Ga0075370_10010740 | Ga0075370_100107404 | 286 |
| 351 | 3300006353 | Ga0075370_10045564 | Ga0075370_100455643 | 286 |
| 352 | 3300006353 | Ga0075370_10057297 | Ga0075370_100572974 | 286 |
| 353 | 3300006358 | Ga0068871_100040253 | Ga0068871_1000402535 | 286 |
| 354 | 3300009093 | Ga0105240_10081673 | Ga0105240_100816731 | 286 |
| 355 | 3300009148 | Ga0105243_10035667 | Ga0105243_100356675 | 286 |
| 356 | 3300009545 | Ga0105237_10044846 | Ga0105237_100448464 | 286 |
| 357 | 3300010375 | Ga0105239_10142381 | Ga0105239_101423812 | 286 |
| 358 | 3300011119 | Ga0105246_10058179 | Ga0105246_100581792 | 286 |
| 359 | 3300013297 | Ga0157378_10459111 | Ga0157378_104591112 | 286 |
| 360 | 3300013306 | Ga0163162_10311123 | Ga0163162_103111232 | 286 |
| 361 | 3300013307 | Ga0157372_10520383 | Ga0157372_105203832 | 286 |
| 362 | 3300014325 | Ga0163163_10254879 | Ga0163163_102548793 | 286 |
| 363 | 3300014326 | Ga0157380_10369806 | Ga0157380_103698062 | 286 |
| 364 | 3300014745 | Ga0157377_10218869 | Ga0157377_102188692 | 286 |
| 365 | 3300014968 | Ga0157379_10015125 | Ga0157379_100151254 | 286 |
| 366 | 3300017792 | Ga0163161_10103176 | Ga0163161_101031762 | 286 |
| 367 | 3300025315 | Ga0207697_10017039 | Ga0207697_100170393 | 286 |
| 368 | 3300025321 | Ga0207656_10057781 | Ga0207656_100577812 | 286 |
| 369 | 3300025893 | Ga0207682_10004387 | Ga0207682_100043872 | 286 |
| 370 | 3300025901 | Ga0207688_10026931 | Ga0207688_100269313 | 286 |
| 371 | 3300025910 | Ga0207684_10008798 | Ga0207684_100087983 | 286 |
| 372 | 3300025914 | Ga0207671_10031240 | Ga0207671_100312405 | 286 |
| 373 | 3300025922 | Ga0207646_10143806 | Ga0207646_101438062 | 286 |
| 374 | 3300025923 | Ga0207681_10166070 | Ga0207681_101660702 | 286 |
| 375 | 3300025925 | Ga0207650_10000275 | Ga0207650_1000027545 | 286 |
| 376 | 3300025925 | Ga0207650_10076434 | Ga0207650_100764342 | 286 |
| 377 | 3300025926 | Ga0207659_10003305 | Ga0207659_1000330511 | 286 |
| 378 | 3300025931 | Ga0207644_10005477 | Ga0207644_100054772 | 286 |
| 379 | 3300025931 | Ga0207644_10061537 | Ga0207644_100615374 | 286 |
| 380 | 3300025933 | Ga0207706_10241037 | Ga0207706_102410372 | 286 |
| 381 | 3300025937 | Ga0207669_10001031 | Ga0207669_100010312 | 286 |
| 382 | 3300025940 | Ga0207691_10001335 | Ga0207691_1000133520 | 286 |
| 383 | 3300025942 | Ga0207689_10051233 | Ga0207689_100512335 | 286 |
| 384 | 3300025945 | Ga0207679_10078325 | Ga0207679_100783252 | 286 |
| 385 | 3300025960 | Ga0207651_10015270 | Ga0207651_100152702 | 286 |
| 386 | 3300025960 | Ga0207651_10064540 | Ga0207651_100645401 | 286 |
| 387 | 3300025986 | Ga0207658_10006476 | Ga0207658_100064767 | 286 |
| 388 | 3300025986 | Ga0207658_10037844 | Ga0207658_100378443 | 286 |
| 389 | 3300026023 | Ga0207677_10274858 | Ga0207677_102748582 | 286 |
| 390 | 3300026088 | Ga0207641_10073800 | Ga0207641_100738003 | 286 |
| 391 | 3300026089 | Ga0207648_10012495 | Ga0207648_100124952 | 286 |
| 392 | 3300026089 | Ga0207648_10425365 | Ga0207648_104253652 | 286 |
| 393 | 3300026095 | Ga0207676_10176961 | Ga0207676_101769612 | 286 |
| 394 | 3300026121 | Ga0207683_10061301 | Ga0207683_100613014 | 286 |
| 395 | 3300027526 | Ga0209968_1000617 | Ga0209968_10006173 | 286 |
| 396 | 3300027695 | Ga0209966_1000517 | Ga0209966_10005176 | 286 |
| 397 | 3300027866 | Ga0209813_10008813 | Ga0209813_100088132 | 286 |
| 398 | 3300028379 | Ga0268266_10021143 | Ga0268266_100211436 | 286 |
| 399 | 3300028381 | Ga0268264_10132357 | Ga0268264_101323572 | 286 |
| 400 | 3300028786 | Ga0307517_10004486 | Ga0307517_1000448621 | 286 |
| 401 | 3300028786 | Ga0307517_10128757 | Ga0307517_101287573 | 286 |
| 402 | 3300028794 | Ga0307515_10011753 | Ga0307515_1001175310 | 286 |
| 403 | 3300028794 | Ga0307515_10221009 | Ga0307515_102210093 | 286 |
| 404 | 3300028794 | Ga0307515_10227993 | Ga0307515_102279933 | 286 |
| 405 | 3300031456 | Ga0307513_10323162 | Ga0307513_103231622 | 286 |
| 406 | 3300031507 | Ga0307509_10000405 | Ga0307509_1000040565 | 286 |
| 407 | 3300031507 | Ga0307509_10015076 | Ga0307509_100150768 | 286 |
| 408 | 3300031507 | Ga0307509_10065554 | Ga0307509_100655544 | 286 |
| 409 | 3300031507 | Ga0307509_10127153 | Ga0307509_101271532 | 286 |
| 410 | 3300031616 | Ga0307508_10004752 | Ga0307508_1000475212 | 286 |
| 411 | 3300031616 | Ga0307508_10015474 | Ga0307508_100154748 | 286 |
| 412 | 3300031616 | Ga0307508_10172040 | Ga0307508_101720402 | 286 |
| 413 | 3300031730 | Ga0307516_10001028 | Ga0307516_1000102815 | 286 |
| 414 | 3300031731 | Ga0307405_10020862 | Ga0307405_100208622 | 286 |
| 415 | 3300031824 | Ga0307413_10108421 | Ga0307413_101084212 | 286 |
| 416 | 3300031824 | Ga0307413_10267254 | Ga0307413_102672542 | 286 |
| 417 | 3300031838 | Ga0307518_10178984 | Ga0307518_101789842 | 286 |
| 418 | 3300031901 | Ga0307406_10035628 | Ga0307406_100356284 | 286 |
| 419 | 3300031903 | Ga0307407_10026775 | Ga0307407_100267752 | 286 |
| 420 | 3300031911 | Ga0307412_10016042 | Ga0307412_100160424 | 286 |
| 421 | 3300031995 | Ga0307409_100253842 | Ga0307409_1002538422 | 286 |
| 422 | 3300031995 | Ga0307409_100413856 | Ga0307409_1004138561 | 286 |
| 423 | 3300032002 | Ga0307416_100093487 | Ga0307416_1000934873 | 286 |
| 424 | 3300032005 | Ga0307411_10043269 | Ga0307411_100432692 | 286 |
| 425 | 3300032005 | Ga0307411_10095287 | Ga0307411_100952873 | 286 |
| 426 | 3300032126 | Ga0307415_100029395 | Ga0307415_1000293954 | 286 |
| 427 | 3300033179 | Ga0307507_10092918 | Ga0307507_100929184 | 286 |
| 428 | 3300033180 | Ga0307510_10003419 | Ga0307510_100034198 | 286 |
| 429 | 3300033180 | Ga0307510_10016969 | Ga0307510_100169691 | 286 |
| 430 | 3300033180 | Ga0307510_10063734 | Ga0307510_100637345 | 286 |
| 431 | 3300035112 | Ga0373932_0013862 | Ga0373932_0013862_316_1203 | 286 |
| 432 | 3300035691 | Ga0373931_0029921 | Ga0373931_0029921_357_1244 | 286 |
| 433 | 3300036401 | Ga0373937_0555889 | Ga0373937_0555889_20_907 | 286 |
| 434 | 3300042012 | Ga0439455_0050885 | Ga0439455_0050885_173_1060 | 286 |
| 435 | 3300042876 | Ga0451577_0246756 | Ga0451577_0246756_605_1492 | 286 |
| 436 | 3300044712 | Ga0453684_0029228 | Ga0453684_0029228_2681_3568 | 286 |
| 437 | 3300044712 | Ga0453684_0216774 | Ga0453684_0216774_681_1568 | 286 |
| 438 | 3300046454 | Ga0495592_0000528 | Ga0495592_0000528_12175_13062 | 286 |
| 439 | 3300046457 | Ga0495590_0038871 | Ga0495590_0038871_142_1029 | 286 |
| 440 | 3300046459 | Ga0495629_0374654 | Ga0495629_0374654_13_900 | 286 |
| 441 | 3300046460 | Ga0495638_0083555 | Ga0495638_0083555_493_1380 | 286 |
| 442 | 3300046474 | Ga0495605_0128925 | Ga0495605_0128925_55_942 | 286 |
| 443 | 3300046507 | Ga0495606_0046495 | Ga0495606_0046495_1584_2477 | 286 |
| 444 | 3300046515 | Ga0495620_0057588 | Ga0495620_0057588_87_974 | 286 |
| 445 | 3300046519 | Ga0495632_0027029 | Ga0495632_0027029_377_1264 | 286 |
| 446 | 3300046519 | Ga0495632_0036013 | Ga0495632_0036013_968_1855 | 286 |
| 447 | 3300046524 | Ga0495648_0125861 | Ga0495648_0125861_275_1162 | 286 |
| 448 | 3300046542 | Ga0495597_0010750 | Ga0495597_0010750_818_1705 | 286 |
| 449 | 3300046660 | Ga0495625_0023081 | Ga0495625_0023081_520_1407 | 286 |
| 450 | 3300046660 | Ga0495625_0222375 | Ga0495625_0222375_158_1045 | 286 |
| 451 | 3300046694 | Ga0495649_0003993 | Ga0495649_0003993_7450_8337 | 286 |
| 452 | 3300046810 | Ga0495660_0035588 | Ga0495660_0035588_322_1209 | 286 |
| 453 | 3300047321 | Ga0495676_0019792 | Ga0495676_0019792_1526_2413 | 286 |
| 454 | 3300047443 | Ga0495687_001797 | Ga0495687_001797_6394_7281 | 286 |
| 455 | 3300047443 | Ga0495687_007155 | Ga0495687_007155_4787_5674 | 286 |
| 456 | 3300047673 | Ga0495593_0045863 | Ga0495593_0045863_878_1765 | 286 |
| 457 | 3300048091 | Ga0495626_0045695 | Ga0495626_0045695_1128_2015 | 286 |
| 458 | 3300048917 | Ga0496114_0405558 | Ga0496114_0405558_100_987 | 286 |
| 459 | 3300050489 | nmdc:mga03683_37286_c1 | nmdc:mga03683_37286_c1_34_921 | 286 |
| 460 | 3300050489 | nmdc:mga03683_90202_c1 | nmdc:mga03683_90202_c1_107_994 | 286 |
| 461 | 3300050490 | nmdc:mga03n38_4126_c1 | nmdc:mga03n38_4126_c1_1772_2659 | 286 |
| 462 | 3300050491 | nmdc:mga00v17_27516_c1 | nmdc:mga00v17_27516_c1_1231_2118 | 286 |
| 463 | 3300050491 | nmdc:mga00v17_8528_c1 | nmdc:mga00v17_8528_c1_3899_4786 | 286 |
| 464 | 3300050492 | nmdc:mga0yw44_300239_c1 | nmdc:mga0yw44_300239_c1_41_928 | 286 |
| 465 | 3300050493 | nmdc:mga0k408_13795_c1 | nmdc:mga0k408_13795_c1_1519_2406 | 286 |
| 466 | 3300050493 | nmdc:mga0k408_1405_c1 | nmdc:mga0k408_1405_c1_11456_12343 | 286 |
| 467 | 3300050493 | nmdc:mga0k408_40965_c1 | nmdc:mga0k408_40965_c1_1056_1943 | 286 |
| 468 | 3300050493 | nmdc:mga0k408_4980_c1 | nmdc:mga0k408_4980_c1_3518_4405 | 286 |
| 469 | 3300050493 | nmdc:mga0k408_5321_c1 | nmdc:mga0k408_5321_c1_1443_2330 | 286 |
| 470 | 3300050493 | nmdc:mga0k408_5383_c1 | nmdc:mga0k408_5383_c1_2486_3373 | 286 |
| 471 | 3300050493 | nmdc:mga0k408_92577_c1 | nmdc:mga0k408_92577_c1_683_1570 | 286 |
| 472 | 3300050494 | nmdc:mga06z11_10035_c1 | nmdc:mga06z11_10035_c1_335_1222 | 286 |
| 473 | 3300050494 | nmdc:mga06z11_105112_c1 | nmdc:mga06z11_105112_c1_455_1342 | 286 |
| 474 | 3300050494 | nmdc:mga06z11_13948_c1 | nmdc:mga06z11_13948_c1_113_1000 | 286 |
| 475 | 3300050494 | nmdc:mga06z11_3034_c1 | nmdc:mga06z11_3034_c1_4490_5377 | 286 |
| 476 | 3300050495 | nmdc:mga04h51_5190_c1 | nmdc:mga04h51_5190_c1_1179_2066 | 286 |
| 477 | 3300050496 | nmdc:mga07m45_1136_c1 | nmdc:mga07m45_1136_c1_9019_9906 | 286 |
| 478 | 3300050496 | nmdc:mga07m45_162486_c1 | nmdc:mga07m45_162486_c1_201_1088 | 286 |
| 479 | 3300050496 | nmdc:mga07m45_172704_c1 | nmdc:mga07m45_172704_c1_46_933 | 286 |
| 480 | 3300050496 | nmdc:mga07m45_1876_c1 | nmdc:mga07m45_1876_c1_4418_5305 | 286 |
| 481 | 3300050496 | nmdc:mga07m45_65850_c1 | nmdc:mga07m45_65850_c1_1050_1937 | 286 |
| 482 | 3300053086 | Ga0500578_0050971 | Ga0500578_0050971_1084_1977 | 286 |
| 483 | 3300053086 | Ga0500578_0205033 | Ga0500578_0205033_29_916 | 286 |
| 484 | 3300053093 | Ga0500651_0188997 | Ga0500651_0188997_171_1058 | 286 |
| 485 | 3300053131 | Ga0500652_006725 | Ga0500652_006725_2253_3140 | 286 |
| 486 | 3300053134 | Ga0500658_0006265 | Ga0500658_0006265_3191_4078 | 286 |
| 487 | 3300053136 | Ga0500559_0000265 | Ga0500559_0000265_27056_27943 | 286 |
| 488 | 3300053139 | Ga0500568_0011911 | Ga0500568_0011911_705_1592 | 286 |
| 489 | 3300053156 | Ga0500622_0002039 | Ga0500622_0002039_3114_4001 | 286 |
| 490 | 3300053177 | Ga0500636_0109930 | Ga0500636_0109930_209_1096 | 286 |
| 491 | 3300053730 | Ga0500645_003124 | Ga0500645_003124_1286_2179 | 286 |
| 492 | iso_pu_bacteria | 2643221660 | 2644339834 | 286 |
| 493 | 3300005328 | Ga0070676_10002478 | Ga0070676_100024786 | 287 |
| 494 | 3300005329 | Ga0070683_100009017 | Ga0070683_1000090179 | 287 |
| 495 | 3300005329 | Ga0070683_100234578 | Ga0070683_1002345782 | 287 |
| 496 | 3300005329 | Ga0070683_100312746 | Ga0070683_1003127462 | 287 |
| 497 | 3300005330 | Ga0070690_100185470 | Ga0070690_1001854702 | 287 |
| 498 | 3300005331 | Ga0070670_100004150 | Ga0070670_1000041509 | 287 |
| 499 | 3300005331 | Ga0070670_100068564 | Ga0070670_1000685643 | 287 |
| 500 | 3300005331 | Ga0070670_100171586 | Ga0070670_1001715862 | 287 |
| 501 | 3300005334 | Ga0068869_100001648 | Ga0068869_10000164812 | 287 |
| 502 | 3300005334 | Ga0068869_100002505 | Ga0068869_10000250512 | 287 |
| 503 | 3300005335 | Ga0070666_10002795 | Ga0070666_100027958 | 287 |
| 504 | 3300005335 | Ga0070666_10069547 | Ga0070666_100695474 | 287 |
| 505 | 3300005336 | Ga0070680_100163072 | Ga0070680_1001630722 | 287 |
| 506 | 3300005339 | Ga0070660_100056956 | Ga0070660_1000569564 | 287 |
| 507 | 3300005347 | Ga0070668_100337928 | Ga0070668_1003379282 | 287 |
| 508 | 3300005353 | Ga0070669_100005859 | Ga0070669_1000058596 | 287 |
| 509 | 3300005353 | Ga0070669_100012845 | Ga0070669_1000128458 | 287 |
| 510 | 3300005354 | Ga0070675_100020379 | Ga0070675_1000203796 | 287 |
| 511 | 3300005354 | Ga0070675_100035035 | Ga0070675_1000350354 | 287 |
| 512 | 3300005354 | Ga0070675_100092730 | Ga0070675_1000927304 | 287 |
| 513 | 3300005355 | Ga0070671_100039517 | Ga0070671_1000395173 | 287 |
| 514 | 3300005355 | Ga0070671_100042863 | Ga0070671_1000428632 | 287 |
| 515 | 3300005356 | Ga0070674_100040038 | Ga0070674_1000400384 | 287 |
| 516 | 3300005364 | Ga0070673_100215499 | Ga0070673_1002154992 | 287 |
| 517 | 3300005364 | Ga0070673_100252437 | Ga0070673_1002524372 | 287 |
| 518 | 3300005367 | Ga0070667_100001504 | Ga0070667_10000150415 | 287 |
| 519 | 3300005367 | Ga0070667_100006001 | Ga0070667_10000600112 | 287 |
| 520 | 3300005367 | Ga0070667_100082325 | Ga0070667_1000823251 | 287 |
| 521 | 3300005438 | Ga0070701_10173876 | Ga0070701_101738762 | 287 |
| 522 | 3300005441 | Ga0070700_100210142 | Ga0070700_1002101421 | 287 |
| 523 | 3300005455 | Ga0070663_100020206 | Ga0070663_1000202064 | 287 |
| 524 | 3300005456 | Ga0070678_100060580 | Ga0070678_1000605802 | 287 |
| 525 | 3300005457 | Ga0070662_100007654 | Ga0070662_1000076548 | 287 |
| 526 | 3300005457 | Ga0070662_100013829 | Ga0070662_1000138296 | 287 |
| 527 | 3300005457 | Ga0070662_100045971 | Ga0070662_1000459714 | 287 |
| 528 | 3300005459 | Ga0068867_100167322 | Ga0068867_1001673222 | 287 |
| 529 | 3300005535 | Ga0070684_100166425 | Ga0070684_1001664253 | 287 |
| 530 | 3300005539 | Ga0068853_100039755 | Ga0068853_1000397555 | 287 |
| 531 | 3300005539 | Ga0068853_100293718 | Ga0068853_1002937183 | 287 |
| 532 | 3300005543 | Ga0070672_100003226 | Ga0070672_1000032266 | 287 |
| 533 | 3300005543 | Ga0070672_100079414 | Ga0070672_1000794142 | 287 |
| 534 | 3300005543 | Ga0070672_100166826 | Ga0070672_1001668262 | 287 |
| 535 | 3300005577 | Ga0068857_100289944 | Ga0068857_1002899442 | 287 |
| 536 | 3300005578 | Ga0068854_100039816 | Ga0068854_1000398164 | 287 |
| 537 | 3300005578 | Ga0068854_100042167 | Ga0068854_1000421675 | 287 |
| 538 | 3300005614 | Ga0068856_100097818 | Ga0068856_1000978183 | 287 |
| 539 | 3300005614 | Ga0068856_100432177 | Ga0068856_1004321772 | 287 |
| 540 | 3300005616 | Ga0068852_100001454 | Ga0068852_1000014548 | 287 |
| 541 | 3300005616 | Ga0068852_100007209 | Ga0068852_1000072096 | 287 |
| 542 | 3300005616 | Ga0068852_100082732 | Ga0068852_1000827324 | 287 |
| 543 | 3300005617 | Ga0068859_100274935 | Ga0068859_1002749352 | 287 |
| 544 | 3300005618 | Ga0068864_100008292 | Ga0068864_1000082924 | 287 |
| 545 | 3300005618 | Ga0068864_100012300 | Ga0068864_1000123006 | 287 |
| 546 | 3300005718 | Ga0068866_10005941 | Ga0068866_100059414 | 287 |
| 547 | 3300005719 | Ga0068861_100002678 | Ga0068861_1000026782 | 287 |
| 548 | 3300005834 | Ga0068851_10028063 | Ga0068851_100280632 | 287 |
| 549 | 3300005834 | Ga0068851_10083848 | Ga0068851_100838482 | 287 |
| 550 | 3300005842 | Ga0068858_100004441 | Ga0068858_1000044414 | 287 |
| 551 | 3300005843 | Ga0068860_100006168 | Ga0068860_1000061689 | 287 |
| 552 | 3300005843 | Ga0068860_100013982 | Ga0068860_1000139823 | 287 |
| 553 | 3300005844 | Ga0068862_100081824 | Ga0068862_1000818242 | 287 |
| 554 | 3300006237 | Ga0097621_100025465 | Ga0097621_1000254651 | 287 |
| 555 | 3300006237 | Ga0097621_100025620 | Ga0097621_1000256206 | 287 |
| 556 | 3300006237 | Ga0097621_100055415 | Ga0097621_1000554154 | 287 |
| 557 | 3300006358 | Ga0068871_100007855 | Ga0068871_1000078554 | 287 |
| 558 | 3300006358 | Ga0068871_100050810 | Ga0068871_1000508103 | 287 |
| 559 | 3300006881 | Ga0068865_100122943 | Ga0068865_1001229432 | 287 |
| 560 | 3300006881 | Ga0068865_100297440 | Ga0068865_1002974402 | 287 |
| 561 | 3300006931 | Ga0097620_100274948 | Ga0097620_1002749482 | 287 |
| 562 | 3300009093 | Ga0105240_10476165 | Ga0105240_104761651 | 287 |
| 563 | 3300009098 | Ga0105245_10039692 | Ga0105245_100396924 | 287 |
| 564 | 3300009177 | Ga0105248_10033310 | Ga0105248_100333104 | 287 |
| 565 | 3300009177 | Ga0105248_10144405 | Ga0105248_101444052 | 287 |
| 566 | 3300009177 | Ga0105248_10157950 | Ga0105248_101579503 | 287 |
| 567 | 3300009551 | Ga0105238_10286934 | Ga0105238_102869341 | 287 |
| 568 | 3300009551 | Ga0105238_10299583 | Ga0105238_102995832 | 287 |
| 569 | 3300009553 | Ga0105249_10009613 | Ga0105249_100096134 | 287 |
| 570 | 3300009553 | Ga0105249_10403396 | Ga0105249_104033962 | 287 |
| 571 | 3300013100 | Ga0157373_10056772 | Ga0157373_100567722 | 287 |
| 572 | 3300013102 | Ga0157371_10122165 | Ga0157371_101221653 | 287 |
| 573 | 3300013306 | Ga0163162_10011522 | Ga0163162_100115228 | 287 |
| 574 | 3300013306 | Ga0163162_10011677 | Ga0163162_1001167710 | 287 |
| 575 | 3300013307 | Ga0157372_10011373 | Ga0157372_1001137310 | 287 |
| 576 | 3300013307 | Ga0157372_10017578 | Ga0157372_100175787 | 287 |
| 577 | 3300013308 | Ga0157375_10005345 | Ga0157375_100053453 | 287 |
| 578 | 3300013308 | Ga0157375_10069609 | Ga0157375_100696092 | 287 |
| 579 | 3300014325 | Ga0163163_10296297 | Ga0163163_102962973 | 287 |
| 580 | 3300014326 | Ga0157380_10006323 | Ga0157380_100063235 | 287 |
| 581 | 3300014968 | Ga0157379_10003479 | Ga0157379_1000347914 | 287 |
| 582 | 3300014969 | Ga0157376_10023415 | Ga0157376_100234156 | 287 |
| 583 | 3300017792 | Ga0163161_10009633 | Ga0163161_100096334 | 287 |
| 584 | 3300017792 | Ga0163161_10025036 | Ga0163161_100250363 | 287 |
| 585 | 3300020082 | Ga0206353_11878195 | Ga0206353_118781951 | 287 |
| 586 | 3300025321 | Ga0207656_10003851 | Ga0207656_100038516 | 287 |
| 587 | 3300025893 | Ga0207682_10013701 | Ga0207682_100137013 | 287 |
| 588 | 3300025899 | Ga0207642_10009093 | Ga0207642_100090932 | 287 |
| 589 | 3300025903 | Ga0207680_10109929 | Ga0207680_101099293 | 287 |
| 590 | 3300025917 | Ga0207660_10025648 | Ga0207660_100256486 | 287 |
| 591 | 3300025918 | Ga0207662_10020118 | Ga0207662_100201185 | 287 |
| 592 | 3300025920 | Ga0207649_10159182 | Ga0207649_101591822 | 287 |
| 593 | 3300025921 | Ga0207652_10008831 | Ga0207652_100088317 | 287 |
| 594 | 3300025923 | Ga0207681_10001432 | Ga0207681_100014328 | 287 |
| 595 | 3300025924 | Ga0207694_10356368 | Ga0207694_103563682 | 287 |
| 596 | 3300025925 | Ga0207650_10003009 | Ga0207650_100030093 | 287 |
| 597 | 3300025925 | Ga0207650_10013330 | Ga0207650_100133306 | 287 |
| 598 | 3300025926 | Ga0207659_10019588 | Ga0207659_100195883 | 287 |
| 599 | 3300025926 | Ga0207659_10039814 | Ga0207659_100398144 | 287 |
| 600 | 3300025931 | Ga0207644_10126323 | Ga0207644_101263232 | 287 |
| 601 | 3300025932 | Ga0207690_10267286 | Ga0207690_102672862 | 287 |
| 602 | 3300025933 | Ga0207706_10002925 | Ga0207706_1000292513 | 287 |
| 603 | 3300025933 | Ga0207706_10100784 | Ga0207706_101007843 | 287 |
| 604 | 3300025933 | Ga0207706_10227080 | Ga0207706_102270802 | 287 |
| 605 | 3300025935 | Ga0207709_10170600 | Ga0207709_101706003 | 287 |
| 606 | 3300025937 | Ga0207669_10001953 | Ga0207669_1000195310 | 287 |
| 607 | 3300025938 | Ga0207704_10157907 | Ga0207704_101579073 | 287 |
| 608 | 3300025940 | Ga0207691_10003672 | Ga0207691_1000367212 | 287 |
| 609 | 3300025940 | Ga0207691_10007054 | Ga0207691_100070548 | 287 |
| 610 | 3300025940 | Ga0207691_10095462 | Ga0207691_100954623 | 287 |
| 611 | 3300025940 | Ga0207691_10170069 | Ga0207691_101700691 | 287 |
| 612 | 3300025940 | Ga0207691_10182758 | Ga0207691_101827583 | 287 |
| 613 | 3300025941 | Ga0207711_10009412 | Ga0207711_100094129 | 287 |
| 614 | 3300025941 | Ga0207711_10033637 | Ga0207711_100336375 | 287 |
| 615 | 3300025941 | Ga0207711_10079455 | Ga0207711_100794552 | 287 |
| 616 | 3300025941 | Ga0207711_10132439 | Ga0207711_101324392 | 287 |
| 617 | 3300025942 | Ga0207689_10001138 | Ga0207689_1000113815 | 287 |
| 618 | 3300025942 | Ga0207689_10013440 | Ga0207689_100134408 | 287 |
| 619 | 3300025944 | Ga0207661_10102125 | Ga0207661_101021252 | 287 |
| 620 | 3300025944 | Ga0207661_10133640 | Ga0207661_101336403 | 287 |
| 621 | 3300025945 | Ga0207679_10016675 | Ga0207679_100166753 | 287 |
| 622 | 3300025949 | Ga0207667_10018841 | Ga0207667_100188418 | 287 |
| 623 | 3300025960 | Ga0207651_10034820 | Ga0207651_100348202 | 287 |
| 624 | 3300025960 | Ga0207651_10451241 | Ga0207651_104512412 | 287 |
| 625 | 3300025961 | Ga0207712_10020151 | Ga0207712_100201513 | 287 |
| 626 | 3300025972 | Ga0207668_10152178 | Ga0207668_101521783 | 287 |
| 627 | 3300025981 | Ga0207640_10379215 | Ga0207640_103792152 | 287 |
| 628 | 3300025986 | Ga0207658_10007334 | Ga0207658_100073345 | 287 |
| 629 | 3300025986 | Ga0207658_10106977 | Ga0207658_101069773 | 287 |
| 630 | 3300026023 | Ga0207677_10084498 | Ga0207677_100844984 | 287 |
| 631 | 3300026023 | Ga0207677_10131825 | Ga0207677_101318253 | 287 |
| 632 | 3300026035 | Ga0207703_10009043 | Ga0207703_1000904310 | 287 |
| 633 | 3300026035 | Ga0207703_10026809 | Ga0207703_100268095 | 287 |
| 634 | 3300026041 | Ga0207639_10015322 | Ga0207639_100153227 | 287 |
| 635 | 3300026067 | Ga0207678_10021701 | Ga0207678_100217014 | 287 |
| 636 | 3300026075 | Ga0207708_10117053 | Ga0207708_101170532 | 287 |
| 637 | 3300026088 | Ga0207641_10003042 | Ga0207641_1000304213 | 287 |
| 638 | 3300026088 | Ga0207641_10016486 | Ga0207641_100164866 | 287 |
| 639 | 3300026089 | Ga0207648_10026116 | Ga0207648_100261162 | 287 |
| 640 | 3300026095 | Ga0207676_10037501 | Ga0207676_100375012 | 287 |
| 641 | 3300026095 | Ga0207676_10063117 | Ga0207676_100631173 | 287 |
| 642 | 3300026095 | Ga0207676_10465127 | Ga0207676_104651271 | 287 |
| 643 | 3300026116 | Ga0207674_10065213 | Ga0207674_100652132 | 287 |
| 644 | 3300026118 | Ga0207675_100002557 | Ga0207675_1000025578 | 287 |
| 645 | 3300026118 | Ga0207675_100012087 | Ga0207675_1000120874 | 287 |
| 646 | 3300026121 | Ga0207683_10055802 | Ga0207683_100558024 | 287 |
| 647 | 3300026121 | Ga0207683_10307523 | Ga0207683_103075232 | 287 |
| 648 | 3300026142 | Ga0207698_10004407 | Ga0207698_100044077 | 287 |
| 649 | 3300026142 | Ga0207698_10008959 | Ga0207698_100089594 | 287 |
| 650 | 3300026142 | Ga0207698_10092623 | Ga0207698_100926232 | 287 |
| 651 | 3300026142 | Ga0207698_10647761 | Ga0207698_106477612 | 287 |
| 652 | 3300028380 | Ga0268265_10009051 | Ga0268265_100090515 | 287 |
| 653 | 3300031852 | Ga0307410_10378109 | Ga0307410_103781091 | 287 |
| 654 | 3300032002 | Ga0307416_100356078 | Ga0307416_1003560781 | 287 |
| 655 | 3300032126 | Ga0307415_100032311 | Ga0307415_1000323112 | 287 |
| 656 | 3300035410 | Ga0373924_0145528 | Ga0373924_0145528_28_1002 | 287 |
| 657 | 3300035691 | Ga0373931_0004344 | Ga0373931_0004344_4418_5308 | 287 |
| 658 | 3300035724 | Ga0373933_0145398 | Ga0373933_0145398_417_1391 | 287 |
| 659 | 3300036401 | Ga0373937_0108263 | Ga0373937_0108263_275_1165 | 287 |
| 660 | 3300037068 | Ga0373925_0024575 | Ga0373925_0024575_79_969 | 287 |
| 661 | 3300037068 | Ga0373925_0107796 | Ga0373925_0107796_386_1360 | 287 |
| 662 | 3300039437 | Ga0436365_1295259 | Ga0436365_1295259_7305_8195 | 287 |
| 663 | 3300041512 | Ga0451853_0888552 | Ga0451853_0888552_149_1039 | 287 |
| 664 | 3300045051 | Ga0451576_0126117 | Ga0451576_0126117_1263_2153 | 287 |
| 665 | 3300046472 | Ga0495580_0077961 | Ga0495580_0077961_1196_2086 | 287 |
| 666 | 3300046516 | Ga0495628_0224975 | Ga0495628_0224975_57_1031 | 287 |
| 667 | 3300046681 | Ga0495647_0009287 | Ga0495647_0009287_2309_3283 | 287 |
| 668 | 3300046683 | Ga0495658_0033364 | Ga0495658_0033364_799_1689 | 287 |
| 669 | 3300048904 | Ga0496101_0051814 | Ga0496101_0051814_1396_2286 | 287 |
| 670 | 3300048906 | Ga0496103_0098087 | Ga0496103_0098087_631_1521 | 287 |
| 671 | 3300048907 | Ga0496104_0018943 | Ga0496104_0018943_4524_5414 | 287 |
| 672 | 3300048909 | Ga0496106_0306686 | Ga0496106_0306686_94_984 | 287 |
| 673 | 3300048910 | Ga0496107_0211422 | Ga0496107_0211422_335_1225 | 287 |
| 674 | 3300048911 | Ga0496108_0009600 | Ga0496108_0009600_5537_6427 | 287 |
| 675 | 3300048912 | Ga0496109_0043536 | Ga0496109_0043536_2826_3716 | 287 |
| 676 | 3300048913 | Ga0496110_0200555 | Ga0496110_0200555_759_1649 | 287 |
| 677 | 3300048914 | Ga0496111_0013244 | Ga0496111_0013244_308_1198 | 287 |
| 678 | 3300048915 | Ga0496112_0220849 | Ga0496112_0220849_293_1183 | 287 |
| 679 | 3300048916 | Ga0496113_0126219 | Ga0496113_0126219_406_1296 | 287 |
| 680 | 3300048918 | Ga0496115_0148915 | Ga0496115_0148915_729_1619 | 287 |
| 681 | 3300053077 | Ga0495601_0235306 | Ga0495601_0235306_288_1178 | 287 |
| 682 | 3300053084 | Ga0495595_0083762 | Ga0495595_0083762_358_1332 | 287 |
| 683 | 3300053085 | Ga0495619_0276097 | Ga0495619_0276097_230_1117 | 287 |
| 684 | 3300005618 | Ga0068864_100018209 | Ga0068864_1000182095 | 288 |
| 685 | 3300005841 | Ga0068863_100582935 | Ga0068863_1005829351 | 288 |
| 686 | 3300009177 | Ga0105248_10112249 | Ga0105248_101122494 | 288 |
| 687 | 3300026088 | Ga0207641_10568486 | Ga0207641_105684861 | 288 |
| 688 | 3300026095 | Ga0207676_10019987 | Ga0207676_100199872 | 288 |
| 689 | 3300031548 | Ga0307408_100220807 | Ga0307408_1002208072 | 288 |
| 690 | 3300045051 | Ga0451576_0170695 | Ga0451576_0170695_1046_1948 | 288 |
| 691 | 3300048911 | Ga0496108_0150854 | Ga0496108_0150854_909_1829 | 288 |
| 692 | 3300048915 | Ga0496112_0109655 | Ga0496112_0109655_1605_2525 | 288 |
| 693 | iso_pu_bacteria | 2904541872 | 2904549131 | 288 |
| 694 | 3300005334 | Ga0068869_100186912 | Ga0068869_1001869122 | 290 |
| 695 | 3300005456 | Ga0070678_100150380 | Ga0070678_1001503803 | 290 |
| 696 | 3300005548 | Ga0070665_100432345 | Ga0070665_1004323451 | 290 |
| 697 | 3300026121 | Ga0207683_10312163 | Ga0207683_103121632 | 290 |
| 698 | 3300046530 | Ga0495654_0005635 | Ga0495654_0005635_5137_6057 | 291 |
| 699 | 3300005459 | Ga0068867_100142473 | Ga0068867_1001424731 | 292 |
| 700 | iso_pu_bacteria | 2808606384 | 2808968388 | 298 |
| 701 | iso_pu_bacteria | 2808606390 | 2809003219 | 298 |
| 702 | iso_pu_bacteria | 2808606391 | 2809010496 | 298 |
| 703 | iso_pu_bacteria | 2519103095 | 2519459931 | 304 |
| 704 | iso_pu_bacteria | 2582581311 | 2585290557 | 304 |
| 705 | iso_pu_bacteria | 2599185239 | 2599740156 | 304 |
| 706 | iso_pu_bacteria | 2599185240 | 2599744175 | 304 |
| 707 | iso_pu_bacteria | 2599185355 | 2600206212 | 304 |
| 708 | iso_pu_bacteria | 2675903129 | 2676743474 | 304 |
| 709 | iso_pu_bacteria | 2816332253 | 2817262212 | 304 |
| 710 | iso_pu_bacteria | 2816332256 | 2817279930 | 304 |
| 711 | iso_pu_bacteria | 2816332286 | 2817455482 | 304 |
| 712 | iso_pu_bacteria | 2818991452 | 2819633617 | 304 |
| 713 | iso_pu_bacteria | 2863421361 | 2863427222 | 304 |
| 714 | iso_pu_bacteria | 2870068957 | 2870070019 | 304 |
| 715 | iso_pu_bacteria | 2904564687 | 2904567750 | 304 |
| 716 | iso_pu_bacteria | 2904571731 | 2904574848 | 304 |
| 717 | iso_pu_bacteria | 2928157003 | 2928161954 | 304 |
| 718 | iso_pu_bacteria | 2928163908 | 2928169214 | 304 |
| 719 | iso_pu_bacteria | 2928170801 | 2928178634 | 304 |
| 720 | iso_pu_bacteria | 2928536128 | 2928539061 | 304 |
| 721 | iso_pu_bacteria | 2981990288 | 2981992876 | 304 |
| 722 | iso_pu_bacteria | 641736154 | 642420682 | 304 |
| 723 | iso_pu_bacteria | 8018845410 | 8018846348 | 304 |
| 724 | iso_pu_bacteria | 8020807995 | 8020814181 | 304 |
| 725 | iso_pu_bacteria | 8020938398 | 8020939936 | 304 |
| 726 | iso_pu_bacteria | 8020945358 | 8020951566 | 304 |
| 727 | iso_pu_bacteria | 8020953355 | 8020954785 | 304 |
| 728 | iso_pu_bacteria | 8021120328 | 8021128284 | 304 |
| 729 | iso_pu_bacteria | 8039098773 | 8039104592 | 304 |
| 730 | iso_pu_bacteria | 8040167225 | 8040170183 | 304 |
| 731 | iso_pu_bacteria | 8040173305 | 8040174055 | 304 |
| 732 | 3300001979 | JGI24740J21852_10011450 | JGI24740J21852_100114503 | 308 |
| 733 | 3300001989 | JGI24739J22299_10020291 | JGI24739J22299_100202912 | 308 |
| 734 | 3300003758 | Ga0055532_1002575 | Ga0055532_10025755 | 308 |
| 735 | 3300003758 | Ga0055532_1005497 | Ga0055532_10054972 | 308 |
| 736 | 3300003760 | Ga0055527_1001292 | Ga0055527_10012925 | 308 |
| 737 | 3300003761 | Ga0055535_1002850 | Ga0055535_10028505 | 308 |
| 738 | 3300003762 | Ga0055542_1004152 | Ga0055542_10041522 | 308 |
| 739 | 3300005339 | Ga0070660_100000001 | Ga0070660_100000001103 | 308 |
| 740 | 3300005366 | Ga0070659_100000189 | Ga0070659_10000018932 | 308 |
| 741 | 3300005455 | Ga0070663_100012207 | Ga0070663_1000122076 | 308 |
| 742 | 3300005563 | Ga0068855_100221846 | Ga0068855_1002218463 | 308 |
| 743 | 3300005564 | Ga0070664_100077229 | Ga0070664_1000772292 | 308 |
| 744 | 3300005616 | Ga0068852_100011335 | Ga0068852_1000113354 | 308 |
| 745 | 3300005842 | Ga0068858_100093635 | Ga0068858_1000936352 | 308 |
| 746 | 3300009092 | Ga0105250_10003919 | Ga0105250_100039197 | 308 |
| 747 | 3300009093 | Ga0105240_10016993 | Ga0105240_100169939 | 308 |
| 748 | 3300009093 | Ga0105240_10068369 | Ga0105240_100683692 | 308 |
| 749 | 3300009545 | Ga0105237_10074686 | Ga0105237_100746863 | 308 |
| 750 | 3300009551 | Ga0105238_10006005 | Ga0105238_1000600510 | 308 |
| 751 | 3300010375 | Ga0105239_10005722 | Ga0105239_1000572211 | 308 |
| 752 | 3300013307 | Ga0157372_10948110 | Ga0157372_109481101 | 308 |
| 753 | 3300015262 | Ga0182007_10086821 | Ga0182007_100868211 | 308 |
| 754 | 3300025225 | Ga0209566_100878 | Ga0209566_1008786 | 308 |
| 755 | 3300025226 | Ga0209674_104904 | Ga0209674_1049042 | 308 |
| 756 | 3300025228 | Ga0209672_100041 | Ga0209672_1000415 | 308 |
| 757 | 3300025229 | Ga0209147_102422 | Ga0209147_1024226 | 308 |
| 758 | 3300025242 | Ga0209258_100822 | Ga0209258_10082216 | 308 |
| 759 | 3300025254 | Ga0209148_1001387 | Ga0209148_10013875 | 308 |
| 760 | 3300025904 | Ga0207647_10012826 | Ga0207647_100128263 | 308 |
| 761 | 3300025913 | Ga0207695_10001714 | Ga0207695_1000171431 | 308 |
| 762 | 3300025913 | Ga0207695_10030498 | Ga0207695_100304985 | 308 |
| 763 | 3300025919 | Ga0207657_10000022 | Ga0207657_1000002290 | 308 |
| 764 | 3300025924 | Ga0207694_10002756 | Ga0207694_1000275611 | 308 |
| 765 | 3300025932 | Ga0207690_10000010 | Ga0207690_10000010221 | 308 |
| 766 | 3300025945 | Ga0207679_10143970 | Ga0207679_101439702 | 308 |
| 767 | 3300025949 | Ga0207667_10328645 | Ga0207667_103286452 | 308 |
| 768 | 3300026035 | Ga0207703_10072967 | Ga0207703_100729672 | 308 |
| 769 | 3300026041 | Ga0207639_10033735 | Ga0207639_100337352 | 308 |
| 770 | 3300026067 | Ga0207678_10000013 | Ga0207678_10000013102 | 308 |
| 771 | 3300026142 | Ga0207698_10004420 | Ga0207698_100044206 | 308 |
| 772 | 3300039437 | Ga0436365_0972532 | Ga0436365_0972532_840_1766 | 308 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4tm5-assembly1.cif.gz_A-2 | x-ray crystal structure of a d-amino acid aminotransferase from burkholderia thailandensis e264 bound to the co-factor pyridoxal phosphate | 0.9926 | 7 | 298 |
| 4m0j-assembly1.cif.gz_B | crystal structure of a d-amino acid aminotransferase from burkholderia thailandensis e264 | 0.9853 | 7 | 298 |
| 4tm5-assembly1.cif.gz_A-2 | x-ray crystal structure of a d-amino acid aminotransferase from burkholderia thailandensis e264 bound to the co-factor pyridoxal phosphate | 0.976 | 7 | 298 |
| 4m0j-assembly1.cif.gz_B | crystal structure of a d-amino acid aminotransferase from burkholderia thailandensis e264 | 0.9749 | 7 | 298 |
| 4m0j-assembly1.cif.gz_A | crystal structure of a d-amino acid aminotransferase from burkholderia thailandensis e264 | 0.9713 | 7 | 298 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4pbcA01 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain | 0.9996 | 7 | 136 | 3.30.470.10 |
| 4pbcA01 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain | 0.992 | 7 | 136 | 3.30.470.10 |
| 4m0jB02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9872 | 137 | 298 | 3.20.10.10 |
| 4pbcB02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9857 | 167 | 305 | 3.20.10.10 |
| 4m0jB02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9741 | 137 | 298 | 3.20.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A660NIT6-F1-model_v4 | D-amino acid aminotransferase | 0.999 | 164 | 301 |
GO:0005829
GO:0008483 GO:0046394 |
| AF-A0A1J5BHS3-F1-model_v4 | D-amino acid aminotransferase | 0.9936 | 104 | 296 |
GO:0005829
GO:0008483 GO:0046394 |
| AF-A0A4Y1Z9P1-F1-model_v4 | D-alanine aminotransferase (EC 2.6.1.21) | 0.9905 | 152 | 297 |
GO:0005829
GO:0046394 GO:0047810 |
| AF-A0A534E1N1-F1-model_v4 | D-amino acid aminotransferase | 0.9878 | 111 | 272 |
GO:0005829
GO:0008483 GO:0046394 |
| AF-A0A1B4JSP2-F1-model_v4 | deleted | 0.9848 | 1 | 301 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar