F480124

General Info

Members Datasets Scaffolds Average Seq Length
772 381 726 295

Family's Representative Sequence

Representative Sequence 3300035410|Ga0373924_0145528|Ga0373924_0145528_28_1002
Length 324
Sequence MASRRAARLTFGASSHKTLRCAQRDNAAMHTPLPDTLCYLNGEYLPLNEAKVSVLDRGFIFGDGIYEVVPVYGKKLFCFDEHLARLGRSLAKLRIANPHSRDQWLERCRKLIAALAERGGATDQLVYIQVTRGVALRDHVMPVGVEPTVFMMANAMKPASGEQRHHGVACVSARDFRWERGDIKSTSLLGNVLARQMSADHDAVETIMFRGGYLTEASASNVWIVHEGAVLGAPKSEHVLEGIRYELIKELCEECGIAYNLRPIAEADVTAADEILLSSATKEVLPVTTLDGEGVGHGALRGKPGPVYARLYEAYQRAKLTQTI

Samples

Sample ID Description Type Environment
1 2519103095 Burkholderia sp. KJ006 Isolate Nodule
2 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
3 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
4 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
5 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
6 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
7 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
8 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
9 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
10 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
11 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
12 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
13 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
14 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
15 2643221660 Methylibium sp. Root1272 Isolate Unclassified
16 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
17 2738543013 Variovorax sp. BT01 Isolate Unclassified
18 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
19 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
20 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
21 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
22 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
23 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
24 2818991452 Burkholderia cepacia 561 Isolate Unclassified
25 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
26 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
27 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
28 2904564687 Burkholderia sp. 571 Isolate Unclassified
29 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
30 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
31 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
32 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
33 2928163908 Burkholderia sp. 567 Isolate Unclassified
34 2928170801 Burkholderia sp. 572 Isolate Unclassified
35 2928536128 Burkholderia sola 565 Isolate Unclassified
36 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
37 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
38 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
39 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
40 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
41 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
42 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
43 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
44 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
45 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
46 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
47 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
48 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
49 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
50 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
51 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
52 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
53 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
54 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
55 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
56 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
57 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
58 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
59 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
60 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
61 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
62 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
63 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
64 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
65 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
66 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
67 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
68 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
69 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
70 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
71 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
72 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
73 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
74 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
75 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
76 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
77 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
78 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
79 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
80 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
81 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
82 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
83 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
84 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
85 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
86 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
87 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
88 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
89 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
90 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
91 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
92 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
93 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
97 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
98 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
99 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
100 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
101 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
102 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
103 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
104 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
105 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
106 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
107 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
108 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
109 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
110 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
111 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
112 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
113 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
114 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
115 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
117 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
118 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
119 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
126 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
127 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
128 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
131 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
141 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
142 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
143 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
144 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
148 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
155 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
157 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
165 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
224 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
229 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
230 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
231 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
232 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
233 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
234 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
235 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
236 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
237 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
238 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
239 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
240 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
241 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
242 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
243 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
244 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
245 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
246 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
247 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
248 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
249 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
250 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
251 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
253 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
254 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
255 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
256 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
257 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
258 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
259 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
260 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
261 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
262 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
263 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
264 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
265 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
266 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
267 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
268 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
269 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
270 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
271 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
272 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
273 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
274 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
275 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
276 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
277 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
278 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
279 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
280 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
281 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
282 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
283 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
284 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
285 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
286 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
287 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
288 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
289 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
290 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
291 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
292 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
293 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
294 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
295 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
296 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
297 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
298 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
299 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
300 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
301 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
302 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
303 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
304 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
305 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
306 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
307 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
308 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
309 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
310 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
315 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
317 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
318 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
319 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
322 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
323 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
324 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
325 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
326 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
327 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
328 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
329 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
330 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
331 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
336 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
337 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
338 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
339 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
340 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
341 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
342 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
343 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
344 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
345 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
346 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
347 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
348 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
349 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
350 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
351 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
352 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
353 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
354 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
355 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
356 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
357 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
358 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
359 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
360 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
361 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
362 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
363 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
364 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
365 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
366 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
367 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
368 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
369 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
370 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
371 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
372 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
373 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
374 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
375 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
376 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
377 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
378 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
379 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
380 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
381 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.78
Metatranscriptomes 0.26
Isolates 5.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.95
Nodule 0.13
Rhizoplane 3.63
Rhizosphere 68.01
Stem 0
Stem Tuber 0
Unclassified 8.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10011450 3300001979 Bacteria 3375
2 JGI24739J22299_10020291 3300001989 Bacteria 2374
3 JGI25152J39213_1001430 3300002773 Bacteria 10303
4 JGI25153J46596_10006137 3300003215 Bacteria 6160
5 JGI25153J46596_10029984 3300003215 Bacteria 1859
6 rootH1_10059918 3300003316 Bacteria 2257
7 rootH2_10090249 3300003320 Bacteria 2666
8 rootL2_10074920 3300003322 Bacteria 2223
9 rootL2_10190253 3300003322 Bacteria 1773
10 rootH1_10182120 3300003323 Bacteria 3236
11 Ga0055532_1002575 3300003758 Bacteria 3646
12 Ga0055532_1003704 3300003758 Bacteria 2512
13 Ga0055532_1005497 3300003758 Bacteria 1777
14 Ga0055525_1000056 3300003759 Bacteria 212321
15 Ga0055527_1001292 3300003760 Bacteria 5439
16 Ga0055527_1001533 3300003760 Bacteria 4730
17 Ga0055535_1002809 3300003761 Bacteria 5536
18 Ga0055535_1002850 3300003761 Bacteria 5439
19 Ga0055542_1002605 3300003762 Bacteria 5698
20 Ga0055542_1004152 3300003762 Bacteria 3637
21 Ga0055529_1000823 3300003763 Bacteria 18476
22 Ga0055534_1000722 3300003784 Bacteria 15998
23 Ga0055528_1001010 3300003790 Bacteria 18684
24 Ga0055528_1031440 3300003790 Bacteria 1381
25 Ga0055540_1012226 3300003792 Bacteria 2710
26 Ga0058692_1001284 3300003856 Bacteria 9534
27 Ga0065165_1000910 3300005262 Bacteria 38170
28 Ga0065707_10099760 3300005295 Bacteria 2981
29 Ga0070676_10002478 3300005328 Bacteria 9462
30 Ga0070676_10029595 3300005328 Bacteria 3116
31 Ga0070676_10115885 3300005328 Bacteria 1675
32 Ga0070683_100009017 3300005329 Bacteria 8510
33 Ga0070683_100234578 3300005329 Bacteria 1744
34 Ga0070683_100312746 3300005329 Bacteria 1495
35 Ga0070690_100185470 3300005330 Bacteria 1439
36 Ga0070690_100325991 3300005330 Bacteria 1108
37 Ga0070670_100000775 3300005331 Bacteria 24812
38 Ga0070670_100004150 3300005331 Bacteria 12113
39 Ga0070670_100019018 3300005331 Bacteria 5891
40 Ga0070670_100068564 3300005331 Bacteria 3044
41 Ga0070670_100132670 3300005331 Bacteria 2151
42 Ga0070670_100171586 3300005331 Bacteria 1881
43 Ga0070670_100228926 3300005331 Bacteria 1617
44 Ga0070677_10043499 3300005333 Bacteria 1784
45 Ga0070677_10059229 3300005333 Bacteria 1575
46 Ga0068869_100001648 3300005334 Bacteria 13321
47 Ga0068869_100002505 3300005334 Bacteria 11079
48 Ga0068869_100186912 3300005334 Bacteria 1627
49 Ga0070666_10002795 3300005335 Bacteria 10542
50 Ga0070666_10019439 3300005335 Bacteria 4385
51 Ga0070666_10069547 3300005335 Bacteria 2394
52 Ga0070680_100163072 3300005336 Bacteria 1873
53 Ga0068868_100041022 3300005338 Bacteria 3605
54 Ga0068868_100084774 3300005338 Bacteria 2545
55 Ga0068868_100299470 3300005338 Bacteria 1366
56 Ga0068868_100420606 3300005338 Bacteria 1157
57 Ga0070660_100000001 3300005339 Bacteria 190487
58 Ga0070660_100056956 3300005339 Bacteria 3026
59 Ga0070668_100135605 3300005347 Bacteria 1979
60 Ga0070668_100207372 3300005347 Bacteria 1611
61 Ga0070668_100337928 3300005347 Bacteria 1272
62 Ga0070669_100005859 3300005353 Bacteria 8865
63 Ga0070669_100012845 3300005353 Bacteria 5947
64 Ga0070669_100171684 3300005353 Bacteria 1691
65 Ga0070669_100305094 3300005353 Bacteria 1281
66 Ga0070669_100402027 3300005353 Bacteria 1121
67 Ga0070675_100001482 3300005354 Bacteria 17319
68 Ga0070675_100020379 3300005354 Bacteria 5292
69 Ga0070675_100034226 3300005354 Bacteria 4122
70 Ga0070675_100035035 3300005354 Bacteria 4076
71 Ga0070675_100092730 3300005354 Bacteria 2532
72 Ga0070675_100095980 3300005354 Bacteria 2490
73 Ga0070671_100039517 3300005355 Bacteria 3916
74 Ga0070671_100042415 3300005355 Bacteria 3781
75 Ga0070671_100042863 3300005355 Bacteria 3763
76 Ga0070671_100055566 3300005355 Bacteria 3293
77 Ga0070671_100082453 3300005355 Bacteria 2689
78 Ga0070671_100187226 3300005355 Bacteria 1754
79 Ga0070671_100272828 3300005355 Bacteria 1438
80 Ga0070674_100040038 3300005356 Bacteria 3168
81 Ga0070674_100120808 3300005356 Bacteria 1939
82 Ga0070674_100423751 3300005356 Bacteria 1092
83 Ga0070673_100003372 3300005364 Bacteria 9941
84 Ga0070673_100044736 3300005364 Bacteria 3429
85 Ga0070673_100215499 3300005364 Bacteria 1660
86 Ga0070673_100236798 3300005364 Bacteria 1585
87 Ga0070673_100252437 3300005364 Bacteria 1538
88 Ga0070659_100000189 3300005366 Bacteria 47370
89 Ga0070667_100001504 3300005367 Bacteria 20851
90 Ga0070667_100006001 3300005367 Bacteria 10096
91 Ga0070667_100006649 3300005367 Bacteria 9611
92 Ga0070667_100082325 3300005367 Bacteria 2755
93 Ga0070667_100101241 3300005367 Bacteria 2488
94 Ga0070667_100131122 3300005367 Bacteria 2188
95 Ga0070701_10173876 3300005438 Bacteria 1256
96 Ga0070700_100210142 3300005441 Bacteria 1373
97 Ga0070708_100258413 3300005445 Bacteria 1637
98 Ga0070663_100012207 3300005455 Bacteria 5424
99 Ga0070663_100020206 3300005455 Bacteria 4405
100 Ga0070678_100015954 3300005456 Bacteria 4788
101 Ga0070678_100017348 3300005456 Bacteria 4632
102 Ga0070678_100060580 3300005456 Bacteria 2787
103 Ga0070678_100061375 3300005456 Bacteria 2770
104 Ga0070678_100150380 3300005456 Bacteria 1875
105 Ga0070662_100007654 3300005457 Bacteria 7008
106 Ga0070662_100013829 3300005457 Bacteria 5376
107 Ga0070662_100045971 3300005457 Bacteria 3135
108 Ga0070662_100148501 3300005457 Bacteria 1823
109 Ga0070662_100189138 3300005457 Bacteria 1627
110 Ga0070662_100333430 3300005457 Bacteria 1240
111 Ga0068867_100002317 3300005459 Bacteria 13397
112 Ga0068867_100005331 3300005459 Bacteria 9088
113 Ga0068867_100046359 3300005459 Bacteria 3193
114 Ga0068867_100103912 3300005459 Bacteria 2173
115 Ga0068867_100142473 3300005459 Bacteria 1875
116 Ga0068867_100167322 3300005459 Bacteria 1738
117 Ga0068867_100517055 3300005459 Bacteria 1029
118 Ga0070685_10101141 3300005466 Bacteria 1761
119 Ga0070706_100000367 3300005467 Bacteria 54314
120 Ga0070706_100074527 3300005467 Bacteria 3141
121 Ga0070707_100185816 3300005468 Bacteria 2026
122 Ga0070684_100166425 3300005535 Bacteria 2001
123 Ga0068853_100039755 3300005539 Bacteria 4012
124 Ga0068853_100293718 3300005539 Bacteria 1501
125 Ga0070672_100000485 3300005543 Bacteria 23134
126 Ga0070672_100003226 3300005543 Bacteria 10557
127 Ga0070672_100009095 3300005543 Bacteria 6832
128 Ga0070672_100050694 3300005543 Bacteria 3234
129 Ga0070672_100079414 3300005543 Bacteria 2626
130 Ga0070672_100166826 3300005543 Bacteria 1829
131 Ga0070693_100325643 3300005547 Bacteria 1044
132 Ga0070665_100058116 3300005548 Bacteria 3877
133 Ga0070665_100342154 3300005548 Bacteria 1501
134 Ga0070665_100432345 3300005548 Bacteria 1325
135 Ga0070665_100472217 3300005548 Bacteria 1265
136 Ga0070704_100034005 3300005549 Bacteria 3453
137 Ga0068855_100221846 3300005563 Bacteria 2119
138 Ga0070664_100077229 3300005564 Bacteria 2863
139 Ga0070664_100091085 3300005564 Bacteria 2640
140 Ga0068857_100289944 3300005577 Bacteria 1507
141 Ga0068854_100039816 3300005578 Bacteria 3313
142 Ga0068854_100042167 3300005578 Bacteria 3228
143 Ga0068854_100057248 3300005578 Bacteria 2812
144 Ga0068854_100081993 3300005578 Bacteria 2384
145 Ga0068856_100097818 3300005614 Bacteria 2924
146 Ga0068856_100432177 3300005614 Bacteria 1337
147 Ga0068852_100001454 3300005616 Bacteria 15992
148 Ga0068852_100006370 3300005616 Bacteria 8525
149 Ga0068852_100007209 3300005616 Bacteria 8107
150 Ga0068852_100011335 3300005616 Bacteria 6706
151 Ga0068852_100048807 3300005616 Bacteria 3619
152 Ga0068852_100082732 3300005616 Bacteria 2853
153 Ga0068852_100108555 3300005616 Bacteria 2519
154 Ga0068859_100274935 3300005617 Bacteria 1777
155 Ga0068864_100008292 3300005618 Bacteria 8570
156 Ga0068864_100011131 3300005618 Bacteria 7434
157 Ga0068864_100012300 3300005618 Bacteria 7074
158 Ga0068864_100018209 3300005618 Bacteria 5863
159 Ga0068864_100035355 3300005618 Bacteria 4253
160 Ga0068864_100158532 3300005618 Bacteria 2056
161 Ga0068866_10005941 3300005718 Bacteria 5074
162 Ga0068861_100002678 3300005719 Bacteria 11666
163 Ga0068861_100011019 3300005719 Bacteria 6284
164 Ga0068861_100478323 3300005719 Bacteria 1122
165 Ga0068851_10028063 3300005834 Bacteria 2778
166 Ga0068851_10083848 3300005834 Bacteria 1668
167 Ga0068851_10090779 3300005834 Bacteria 1608
168 Ga0068863_100010999 3300005841 Bacteria 8776
169 Ga0068863_100425543 3300005841 Bacteria 1301
170 Ga0068863_100582935 3300005841 Bacteria 1106
171 Ga0068858_100004441 3300005842 Bacteria 13757
172 Ga0068858_100093635 3300005842 Bacteria 2797
173 Ga0068860_100001559 3300005843 Bacteria 24688
174 Ga0068860_100006168 3300005843 Bacteria 12055
175 Ga0068860_100013982 3300005843 Bacteria 7871
176 Ga0068860_100033277 3300005843 Bacteria 4947
177 Ga0068862_100056270 3300005844 Bacteria 3370
178 Ga0068862_100081824 3300005844 Bacteria 2802
179 Ga0068862_100162356 3300005844 Bacteria 1995
180 Ga0081455_10060841 3300005937 Bacteria 3181
181 Ga0075365_10057943 3300006038 Bacteria 2578
182 Ga0075365_10082684 3300006038 Bacteria 2177
183 Ga0075368_10003231 3300006042 Bacteria 5425
184 Ga0075368_10005709 3300006042 Bacteria 4300
185 Ga0075368_10029201 3300006042 Bacteria 2132
186 Ga0075363_100000145 3300006048 Bacteria 17501
187 Ga0075363_100015708 3300006048 Bacteria 3727
188 Ga0075363_100050668 3300006048 Bacteria 2213
189 Ga0075363_100074539 3300006048 Bacteria 1847
190 Ga0075363_100122212 3300006048 Bacteria 1455
191 Ga0075364_10058438 3300006051 Bacteria 2527
192 Ga0075362_10000580 3300006177 Bacteria 10685
193 Ga0075362_10003899 3300006177 Bacteria 5296
194 Ga0075362_10047649 3300006177 Bacteria 1909
195 Ga0075362_10090893 3300006177 Bacteria 1417
196 Ga0075367_10002249 3300006178 Bacteria 8731
197 Ga0075367_10004330 3300006178 Bacteria 6910
198 Ga0075367_10012127 3300006178 Bacteria 4585
199 Ga0075367_10024628 3300006178 Bacteria 3395
200 Ga0075367_10034912 3300006178 Bacteria 2908
201 Ga0075367_10160829 3300006178 Bacteria 1396
202 Ga0075367_10275422 3300006178 Bacteria 1057
203 Ga0075369_10003203 3300006186 Bacteria 5939
204 Ga0075369_10018407 3300006186 Bacteria 2843
205 Ga0075369_10064800 3300006186 Bacteria 1601
206 Ga0075366_10000582 3300006195 Bacteria 17130
207 Ga0075366_10001974 3300006195 Bacteria 10379
208 Ga0075366_10007235 3300006195 Bacteria 6116
209 Ga0075366_10009087 3300006195 Bacteria 5542
210 Ga0075366_10016069 3300006195 Bacteria 4297
211 Ga0075366_10017325 3300006195 Bacteria 4146
212 Ga0075366_10022472 3300006195 Bacteria 3669
213 Ga0075366_10052321 3300006195 Bacteria 2427
214 Ga0075366_10138256 3300006195 Bacteria 1472
215 Ga0075366_10148112 3300006195 Bacteria 1421
216 Ga0075366_10165633 3300006195 Bacteria 1340
217 Ga0075366_10186592 3300006195 Bacteria 1260
218 Ga0097621_100025465 3300006237 Bacteria 4630
219 Ga0097621_100025620 3300006237 Bacteria 4616
220 Ga0097621_100055415 3300006237 Bacteria 3237
221 Ga0075370_10000854 3300006353 Bacteria 12360
222 Ga0075370_10001171 3300006353 Bacteria 11031
223 Ga0075370_10002800 3300006353 Bacteria 8175
224 Ga0075370_10010740 3300006353 Bacteria 4800
225 Ga0075370_10012014 3300006353 Bacteria 4565
226 Ga0075370_10045564 3300006353 Bacteria 2480
227 Ga0075370_10057297 3300006353 Bacteria 2215
228 Ga0068871_100007855 3300006358 Bacteria 7643
229 Ga0068871_100040253 3300006358 Bacteria 3743
230 Ga0068871_100050810 3300006358 Bacteria 3355
231 Ga0075429_100038607 3300006880 Bacteria 4157
232 Ga0068865_100122943 3300006881 Bacteria 1933
233 Ga0068865_100297440 3300006881 Bacteria 1291
234 Ga0097620_100274948 3300006931 Bacteria 1777
235 Ga0105250_10003919 3300009092 Bacteria 6950
236 Ga0105240_10016993 3300009093 Bacteria 9829
237 Ga0105240_10018949 3300009093 Bacteria 9215
238 Ga0105240_10068369 3300009093 Bacteria 4399
239 Ga0105240_10081673 3300009093 Bacteria 3971
240 Ga0105240_10290860 3300009093 Bacteria 1873
241 Ga0105240_10476165 3300009093 Bacteria 1393
242 Ga0105245_10039692 3300009098 Bacteria 4190
243 Ga0105243_10000649 3300009148 Bacteria 34418
244 Ga0105243_10035667 3300009148 Bacteria 3856
245 Ga0105248_10033310 3300009177 Bacteria 5755
246 Ga0105248_10112249 3300009177 Bacteria 3074
247 Ga0105248_10144405 3300009177 Bacteria 2685
248 Ga0105248_10157950 3300009177 Bacteria 2559
249 Ga0105237_10001988 3300009545 Bacteria 26016
250 Ga0105237_10044846 3300009545 Bacteria 4451
251 Ga0105237_10074686 3300009545 Bacteria 3382
252 Ga0105238_10006005 3300009551 Bacteria 12036
253 Ga0105238_10014640 3300009551 Bacteria 7932
254 Ga0105238_10286934 3300009551 Bacteria 1628
255 Ga0105238_10299583 3300009551 Bacteria 1591
256 Ga0105249_10009613 3300009553 Bacteria 8474
257 Ga0105249_10018682 3300009553 Bacteria 6174
258 Ga0105249_10094890 3300009553 Bacteria 2796
259 Ga0105249_10403396 3300009553 Bacteria 1398
260 Ga0105239_10004146 3300010375 Bacteria 17401
261 Ga0105239_10005722 3300010375 Bacteria 14521
262 Ga0105239_10142381 3300010375 Bacteria 2673
263 Ga0105246_10058179 3300011119 Bacteria 2677
264 Ga0157373_10056772 3300013100 Bacteria 2778
265 Ga0157371_10122165 3300013102 Bacteria 1852
266 Ga0157374_10143755 3300013296 Bacteria 2316
267 Ga0157378_10001811 3300013297 Bacteria 19191
268 Ga0157378_10289253 3300013297 Bacteria 1582
269 Ga0157378_10459111 3300013297 Bacteria 1265
270 Ga0163162_10011522 3300013306 Bacteria 8623
271 Ga0163162_10011677 3300013306 Bacteria 8564
272 Ga0163162_10061442 3300013306 Bacteria 3795
273 Ga0163162_10311123 3300013306 Bacteria 1708
274 Ga0157372_10011373 3300013307 Bacteria 9468
275 Ga0157372_10017578 3300013307 Bacteria 7673
276 Ga0157372_10520383 3300013307 Bacteria 1387
277 Ga0157372_10948110 3300013307 Bacteria 997
278 Ga0157375_10005345 3300013308 Bacteria 11160
279 Ga0157375_10069609 3300013308 Bacteria 3526
280 Ga0157375_10090733 3300013308 Bacteria 3115
281 Ga0157375_10120376 3300013308 Bacteria 2734
282 Ga0157375_10168125 3300013308 Bacteria 2339
283 Ga0163163_10011394 3300014325 Bacteria 8062
284 Ga0163163_10254879 3300014325 Bacteria 1805
285 Ga0163163_10296297 3300014325 Bacteria 1670
286 Ga0157380_10006323 3300014326 Bacteria 8324
287 Ga0157380_10369806 3300014326 Bacteria 1349
288 Ga0182008_10000148 3300014497 Bacteria 54597
289 Ga0157377_10000006 3300014745 Bacteria 419853
290 Ga0157377_10218869 3300014745 Bacteria 1218
291 Ga0157379_10003479 3300014968 Bacteria 13332
292 Ga0157379_10015125 3300014968 Bacteria 6768
293 Ga0157379_10016325 3300014968 Bacteria 6531
294 Ga0157379_10125292 3300014968 Bacteria 2312
295 Ga0157376_10023415 3300014969 Bacteria 4833
296 Ga0157376_10052668 3300014969 Bacteria 3385
297 Ga0182007_10086821 3300015262 Bacteria 1029
298 Ga0163161_10009633 3300017792 Bacteria 6682
299 Ga0163161_10025036 3300017792 Bacteria 4220
300 Ga0163161_10103176 3300017792 Bacteria 2125
301 Ga0206353_11878195 3300020082 Bacteria 1195
302 Ga0213872_10000120 3300021361 Bacteria 73389
303 Ga0213872_10000141 3300021361 Bacteria 64990
304 Ga0213872_10000155 3300021361 Bacteria 62940
305 Ga0213872_10000277 3300021361 Bacteria 43679
306 Ga0213872_10014511 3300021361 Bacteria 3676
307 Ga0213872_10022453 3300021361 Bacteria 2906
308 Ga0213872_10041095 3300021361 Bacteria 2110
309 Ga0209566_100878 3300025225 Bacteria 14676
310 Ga0209674_104904 3300025226 Bacteria 2081
311 Ga0209672_100041 3300025228 Bacteria 278535
312 Ga0209672_100153 3300025228 Bacteria 61197
313 Ga0209147_100043 3300025229 Bacteria 300460
314 Ga0209147_102422 3300025229 Bacteria 4653
315 Ga0209563_100014 3300025230 Bacteria 940582
316 Ga0209258_100023 3300025242 Bacteria 547286
317 Ga0209258_100822 3300025242 Bacteria 17427
318 Ga0207425_1000703 3300025245 Bacteria 18068
319 Ga0209148_1000029 3300025254 Bacteria 579199
320 Ga0209148_1001387 3300025254 Bacteria 12523
321 Ga0209129_1000933 3300025258 Bacteria 17722
322 Ga0209565_1013438 3300025263 Bacteria 1917
323 Ga0207666_1005498 3300025271 Bacteria 1620
324 Ga0209455_1000064 3300025272 Bacteria 332404
325 Ga0209455_1000722 3300025272 Bacteria 19152
326 Ga0209673_1000084 3300025273 Bacteria 215878
327 Ga0209673_1008819 3300025273 Bacteria 4443
328 Ga0209673_1014498 3300025273 Bacteria 3046
329 Ga0209675_1002104 3300025291 Bacteria 10553
330 Ga0209676_1030785 3300025292 Bacteria 1635
331 Ga0209564_1000627 3300025295 Bacteria 53872
332 Ga0209564_1003064 3300025295 Bacteria 11871
333 Ga0209758_1000593 3300025297 Bacteria 56468
334 Ga0209758_1000769 3300025297 Bacteria 46067
335 Ga0209050_1000799 3300025298 Bacteria 44543
336 Ga0209256_1012880 3300025299 Bacteria 3151
337 Ga0209051_1023211 3300025303 Bacteria 2586
338 Ga0209257_1011852 3300025304 Bacteria 4125
339 Ga0209257_1047282 3300025304 Bacteria 1238
340 Ga0207697_10017039 3300025315 Bacteria 2988
341 Ga0207697_10021253 3300025315 Bacteria 2657
342 Ga0207656_10003851 3300025321 Bacteria 5200
343 Ga0207656_10057781 3300025321 Bacteria 1693
344 Ga0207682_10004387 3300025893 Bacteria 5908
345 Ga0207682_10010609 3300025893 Bacteria 3607
346 Ga0207682_10013701 3300025893 Bacteria 3157
347 Ga0207682_10019286 3300025893 Bacteria 2670
348 Ga0207642_10009093 3300025899 Bacteria 3441
349 Ga0207642_10073719 3300025899 Bacteria 1634
350 Ga0207688_10026931 3300025901 Bacteria 3162
351 Ga0207680_10109929 3300025903 Bacteria 1786
352 Ga0207647_10012826 3300025904 Bacteria 5823
353 Ga0207645_10038735 3300025907 Bacteria 3055
354 Ga0207645_10144160 3300025907 Bacteria 1552
355 Ga0207684_10008798 3300025910 Bacteria 8962
356 Ga0207684_10139365 3300025910 Bacteria 2084
357 Ga0207695_10001714 3300025913 Bacteria 35105
358 Ga0207695_10030498 3300025913 Bacteria 5935
359 Ga0207695_10164414 3300025913 Bacteria 2148
360 Ga0207671_10002519 3300025914 Bacteria 19541
361 Ga0207671_10031240 3300025914 Bacteria 3968
362 Ga0207660_10025648 3300025917 Bacteria 4004
363 Ga0207662_10020118 3300025918 Bacteria 3807
364 Ga0207657_10000022 3300025919 Bacteria 154101
365 Ga0207649_10159182 3300025920 Bacteria 1563
366 Ga0207652_10008831 3300025921 Bacteria 8117
367 Ga0207646_10143806 3300025922 Bacteria 2149
368 Ga0207681_10001432 3300025923 Bacteria 15375
369 Ga0207681_10027585 3300025923 Bacteria 3673
370 Ga0207681_10166070 3300025923 Bacteria 1669
371 Ga0207694_10002756 3300025924 Bacteria 14193
372 Ga0207694_10356368 3300025924 Bacteria 1212
373 Ga0207650_10000275 3300025925 Bacteria 53824
374 Ga0207650_10003009 3300025925 Bacteria 11613
375 Ga0207650_10013330 3300025925 Bacteria 5691
376 Ga0207650_10076434 3300025925 Bacteria 2530
377 Ga0207659_10003305 3300025926 Bacteria 9661
378 Ga0207659_10019588 3300025926 Bacteria 4457
379 Ga0207659_10039814 3300025926 Bacteria 3282
380 Ga0207644_10005477 3300025931 Bacteria 8268
381 Ga0207644_10048247 3300025931 Bacteria 3043
382 Ga0207644_10061537 3300025931 Bacteria 2719
383 Ga0207644_10126323 3300025931 Bacteria 1952
384 Ga0207690_10000010 3300025932 Bacteria 330298
385 Ga0207690_10267286 3300025932 Bacteria 1327
386 Ga0207706_10002925 3300025933 Bacteria 16502
387 Ga0207706_10100784 3300025933 Bacteria 2541
388 Ga0207706_10227080 3300025933 Bacteria 1634
389 Ga0207706_10241037 3300025933 Bacteria 1581
390 Ga0207709_10001139 3300025935 Bacteria 19377
391 Ga0207709_10170600 3300025935 Bacteria 1526
392 Ga0207670_10053469 3300025936 Bacteria 2721
393 Ga0207669_10001031 3300025937 Bacteria 11905
394 Ga0207669_10001953 3300025937 Bacteria 8743
395 Ga0207704_10157907 3300025938 Bacteria 1610
396 Ga0207691_10001335 3300025940 Bacteria 24610
397 Ga0207691_10003672 3300025940 Bacteria 14890
398 Ga0207691_10007054 3300025940 Bacteria 10841
399 Ga0207691_10048981 3300025940 Bacteria 3872
400 Ga0207691_10095462 3300025940 Bacteria 2660
401 Ga0207691_10170069 3300025940 Bacteria 1909
402 Ga0207691_10182758 3300025940 Bacteria 1832
403 Ga0207691_10416470 3300025940 Bacteria 1145
404 Ga0207711_10009412 3300025941 Bacteria 8157
405 Ga0207711_10033637 3300025941 Bacteria 4339
406 Ga0207711_10079455 3300025941 Bacteria 2863
407 Ga0207711_10132439 3300025941 Bacteria 2236
408 Ga0207689_10001138 3300025942 Bacteria 25663
409 Ga0207689_10013440 3300025942 Bacteria 6990
410 Ga0207689_10049644 3300025942 Bacteria 3461
411 Ga0207689_10051233 3300025942 Bacteria 3403
412 Ga0207661_10102125 3300025944 Bacteria 2410
413 Ga0207661_10133640 3300025944 Bacteria 2128
414 Ga0207679_10016675 3300025945 Bacteria 4879
415 Ga0207679_10078325 3300025945 Bacteria 2517
416 Ga0207679_10143970 3300025945 Bacteria 1930
417 Ga0207679_10365964 3300025945 Bacteria 1260
418 Ga0207667_10018841 3300025949 Bacteria 7728
419 Ga0207667_10328645 3300025949 Bacteria 1561
420 Ga0207651_10015270 3300025960 Bacteria 4458
421 Ga0207651_10034820 3300025960 Bacteria 3266
422 Ga0207651_10064540 3300025960 Bacteria 2563
423 Ga0207651_10451241 3300025960 Bacteria 1103
424 Ga0207712_10020151 3300025961 Bacteria 4365
425 Ga0207712_10187570 3300025961 Bacteria 1630
426 Ga0207668_10081035 3300025972 Bacteria 2353
427 Ga0207668_10092283 3300025972 Bacteria 2228
428 Ga0207668_10152178 3300025972 Bacteria 1792
429 Ga0207640_10155938 3300025981 Bacteria 1683
430 Ga0207640_10379215 3300025981 Bacteria 1145
431 Ga0207658_10006476 3300025986 Bacteria 7992
432 Ga0207658_10007334 3300025986 Bacteria 7517
433 Ga0207658_10037844 3300025986 Bacteria 3471
434 Ga0207658_10106977 3300025986 Bacteria 2203
435 Ga0207677_10061139 3300026023 Bacteria 2607
436 Ga0207677_10084498 3300026023 Bacteria 2288
437 Ga0207677_10131825 3300026023 Bacteria 1899
438 Ga0207677_10274858 3300026023 Bacteria 1380
439 Ga0207703_10009043 3300026035 Bacteria 7845
440 Ga0207703_10026809 3300026035 Bacteria 4539
441 Ga0207703_10072967 3300026035 Bacteria 2838
442 Ga0207703_10236104 3300026035 Bacteria 1641
443 Ga0207639_10015322 3300026041 Bacteria 5406
444 Ga0207639_10022020 3300026041 Bacteria 4586
445 Ga0207639_10033735 3300026041 Bacteria 3779
446 Ga0207639_10549776 3300026041 Bacteria 1060
447 Ga0207678_10000013 3300026067 Bacteria 141619
448 Ga0207678_10021701 3300026067 Bacteria 5631
449 Ga0207708_10117053 3300026075 Bacteria 2074
450 Ga0207641_10003042 3300026088 Bacteria 15111
451 Ga0207641_10016486 3300026088 Bacteria 6051
452 Ga0207641_10073800 3300026088 Bacteria 2941
453 Ga0207641_10100741 3300026088 Bacteria 2544
454 Ga0207641_10568486 3300026088 Bacteria 1107
455 Ga0207648_10000254 3300026089 Bacteria 57696
456 Ga0207648_10000419 3300026089 Bacteria 46680
457 Ga0207648_10012495 3300026089 Bacteria 7950
458 Ga0207648_10024822 3300026089 Bacteria 5347
459 Ga0207648_10026116 3300026089 Bacteria 5193
460 Ga0207648_10066548 3300026089 Bacteria 3142
461 Ga0207648_10425365 3300026089 Bacteria 1206
462 Ga0207676_10019987 3300026095 Bacteria 4893
463 Ga0207676_10037501 3300026095 Bacteria 3694
464 Ga0207676_10063117 3300026095 Bacteria 2941
465 Ga0207676_10176961 3300026095 Bacteria 1864
466 Ga0207676_10465127 3300026095 Bacteria 1195
467 Ga0207674_10065213 3300026116 Bacteria 3672
468 Ga0207675_100002557 3300026118 Bacteria 18015
469 Ga0207675_100004240 3300026118 Bacteria 13863
470 Ga0207675_100012087 3300026118 Bacteria 8066
471 Ga0207683_10055802 3300026121 Bacteria 3465
472 Ga0207683_10061301 3300026121 Bacteria 3310
473 Ga0207683_10077576 3300026121 Bacteria 2943
474 Ga0207683_10101938 3300026121 Bacteria 2563
475 Ga0207683_10307523 3300026121 Bacteria 1451
476 Ga0207683_10312163 3300026121 Bacteria 1439
477 Ga0207683_10367252 3300026121 Bacteria 1322
478 Ga0207698_10004407 3300026142 Bacteria 8577
479 Ga0207698_10004420 3300026142 Bacteria 8566
480 Ga0207698_10008959 3300026142 Bacteria 6349
481 Ga0207698_10092623 3300026142 Bacteria 2478
482 Ga0207698_10317308 3300026142 Bacteria 1458
483 Ga0207698_10647761 3300026142 Bacteria 1046
484 Ga0209371_1000526 3300027312 Bacteria 36476
485 Ga0209968_1000617 3300027526 Bacteria 5511
486 Ga0209966_1000517 3300027695 Bacteria 9984
487 Ga0209813_10008813 3300027866 Bacteria 2559
488 Ga0209974_10001326 3300027876 Bacteria 8891
489 Ga0268266_10021143 3300028379 Bacteria 5544
490 Ga0268266_10191859 3300028379 Bacteria 1866
491 Ga0268265_10009051 3300028380 Bacteria 6733
492 Ga0268265_10037721 3300028380 Bacteria 3549
493 Ga0268265_10293563 3300028380 Bacteria 1460
494 Ga0268264_10002884 3300028381 Bacteria 14955
495 Ga0268264_10099566 3300028381 Bacteria 2523
496 Ga0268264_10132357 3300028381 Bacteria 2213
497 Ga0307517_10004486 3300028786 Bacteria 21426
498 Ga0307517_10128757 3300028786 Bacteria 1833
499 Ga0307515_10001761 3300028794 Bacteria 48250
500 Ga0307515_10011753 3300028794 Bacteria 16566
501 Ga0307515_10209215 3300028794 Bacteria 1800
502 Ga0307515_10221009 3300028794 Bacteria 1712
503 Ga0307515_10227993 3300028794 Bacteria 1663
504 Ga0268256_1000860 3300030500 Bacteria 21270
505 Ga0265328_10081360 3300031239 Bacteria 1193
506 Ga0265331_10001051 3300031250 Bacteria 21516
507 Ga0265327_10000149 3300031251 Bacteria 150385
508 Ga0307513_10116245 3300031456 Bacteria 2655
509 Ga0307513_10121506 3300031456 Bacteria 2578
510 Ga0307513_10323162 3300031456 Bacteria 1300
511 Ga0307509_10000405 3300031507 Bacteria 72472
512 Ga0307509_10015076 3300031507 Bacteria 9049
513 Ga0307509_10065554 3300031507 Bacteria 3813
514 Ga0307509_10127153 3300031507 Bacteria 2512
515 Ga0307408_100204666 3300031548 Bacteria 1600
516 Ga0307408_100220807 3300031548 Bacteria 1546
517 Ga0307508_10000440 3300031616 Bacteria 49668
518 Ga0307508_10004752 3300031616 Bacteria 13130
519 Ga0307508_10015474 3300031616 Bacteria 6948
520 Ga0307508_10172040 3300031616 Bacteria 1769
521 Ga0307514_10012264 3300031649 Bacteria 7133
522 Ga0307516_10001028 3300031730 Bacteria 38713
523 Ga0307516_10001466 3300031730 Bacteria 32597
524 Ga0307516_10087052 3300031730 Bacteria 2959
525 Ga0307405_10020862 3300031731 Bacteria 3670
526 Ga0307405_10364613 3300031731 Bacteria 1119
527 Ga0307413_10108421 3300031824 Bacteria 1853
528 Ga0307413_10267254 3300031824 Bacteria 1278
529 Ga0307518_10178984 3300031838 Bacteria 1436
530 Ga0307410_10378109 3300031852 Bacteria 1139
531 Ga0307406_10035628 3300031901 Bacteria 3062
532 Ga0307407_10026775 3300031903 Bacteria 3059
533 Ga0307412_10016042 3300031911 Bacteria 4452
534 Ga0307409_100253842 3300031995 Bacteria 1609
535 Ga0307409_100413856 3300031995 Bacteria 1291
536 Ga0307416_100093487 3300032002 Bacteria 2590
537 Ga0307416_100111725 3300032002 Bacteria 2410
538 Ga0307416_100356078 3300032002 Bacteria 1483
539 Ga0307411_10043269 3300032005 Bacteria 2880
540 Ga0307411_10095287 3300032005 Bacteria 2089
541 Ga0307415_100029395 3300032126 Bacteria 3512
542 Ga0307415_100032311 3300032126 Bacteria 3383
543 Ga0316593_10008342 3300032168 Bacteria 2884
544 Ga0307507_10092918 3300033179 Bacteria 2572
545 Ga0307507_10105932 3300033179 Bacteria 2325
546 Ga0307510_10003419 3300033180 Bacteria 18519
547 Ga0307510_10016969 3300033180 Bacteria 8587
548 Ga0307510_10063734 3300033180 Bacteria 3750
549 Ga0373932_0013862 3300035112 Bacteria 2015
550 Ga0373946_0140151 3300035171 Bacteria 1120
551 Ga0316574_0089740 3300035398 Bacteria 1958
552 Ga0373924_0145528 3300035410 Bacteria 1035
553 Ga0373931_0004344 3300035691 Bacteria 6472
554 Ga0373931_0029921 3300035691 Bacteria 2800
555 Ga0373933_0145398 3300035724 Bacteria 1499
556 Ga0373937_0108263 3300036401 Bacteria 2584
557 Ga0373937_0269388 3300036401 Bacteria 1607
558 Ga0373937_0555889 3300036401 Bacteria 1090
559 Ga0316582_0022105 3300036647 Bacteria 3771
560 Ga0316582_0072290 3300036647 Bacteria 2236
561 Ga0316584_0119348 3300036712 Bacteria 1971
562 Ga0373925_0024575 3300037068 Bacteria 4399
563 Ga0373925_0048827 3300037068 Bacteria 3154
564 Ga0373925_0107796 3300037068 Bacteria 2149
565 Ga0395905_0382148 3300037471 Bacteria 1302
566 Ga0400487_56809 3300039110 Bacteria 2903
567 Ga0436365_0972532 3300039437 Bacteria 2343
568 Ga0436365_1295259 3300039437 Bacteria 8569
569 Ga0436361_0004041 3300039447 Bacteria 50055
570 Ga0436361_0006095 3300039447 Bacteria 919
571 Ga0436361_0097160 3300039447 Bacteria 66004
572 Ga0436361_0508822 3300039447 Bacteria 44352
573 Ga0436361_0616064 3300039447 Bacteria 4507
574 Ga0436361_0813098 3300039447 Bacteria 136133
575 Ga0436361_0890342 3300039447 Bacteria 2318
576 Ga0436361_0997353 3300039447 Bacteria 3564
577 Ga0436361_1067841 3300039447 Bacteria 1761
578 Ga0451789_0850686 3300041443 Bacteria 2795
579 Ga0451791_1448603 3300041451 Bacteria 1669
580 Ga0451793_0036517 3300041452 Bacteria 2122
581 Ga0451795_0755555 3300041456 Bacteria 1996
582 Ga0451798_0683313 3300041458 Bacteria 1091
583 Ga0451802_0060270 3300041460 Bacteria 1961
584 Ga0451839_0934005 3300041496 Bacteria 1212
585 Ga0451853_0888552 3300041512 Bacteria 1157
586 Ga0439455_0050885 3300042012 Bacteria 1082
587 Ga0450911_000958 3300042115 Bacteria 7525
588 Ga0439464_0002359 3300042439 Bacteria 4640
589 Ga0451577_0246756 3300042876 Bacteria 1616
590 Ga0453684_0029228 3300044712 Bacteria 7838
591 Ga0453684_0216774 3300044712 Bacteria 2220
592 Ga0451576_0126117 3300045051 Bacteria 2667
593 Ga0451576_0170695 3300045051 Bacteria 2270
594 Ga0495592_0000528 3300046454 Bacteria 27565
595 Ga0495590_0038871 3300046457 Bacteria 1660
596 Ga0495629_0374654 3300046459 Bacteria 969
597 Ga0495638_0083555 3300046460 Bacteria 1934
598 Ga0495580_0077961 3300046472 Bacteria 2311
599 Ga0495605_0128925 3300046474 Bacteria 1142
600 Ga0495639_0116624 3300046475 Bacteria 1271
601 Ga0495664_0094528 3300046477 Bacteria 1799
602 Ga0495585_0010716 3300046492 Bacteria 5444
603 Ga0495606_0046495 3300046507 Bacteria 2868
604 Ga0495610_0044046 3300046512 Bacteria 2219
605 Ga0495620_0057588 3300046515 Bacteria 1630
606 Ga0495628_0224975 3300046516 Bacteria 1408
607 Ga0495632_0001689 3300046519 Bacteria 18062
608 Ga0495632_0015621 3300046519 Bacteria 4246
609 Ga0495632_0027029 3300046519 Bacteria 3011
610 Ga0495632_0036013 3300046519 Bacteria 2520
611 Ga0495648_0125861 3300046524 Bacteria 1370
612 Ga0495654_0005635 3300046530 Bacteria 7244
613 Ga0495598_0009291 3300046537 Bacteria 2320
614 Ga0495598_0026501 3300046537 Bacteria 1590
615 Ga0495621_0044763 3300046539 Bacteria 1565
616 Ga0495597_0010750 3300046542 Bacteria 4460
617 Ga0495625_0008661 3300046660 Bacteria 8648
618 Ga0495625_0023081 3300046660 Bacteria 4757
619 Ga0495625_0222375 3300046660 Bacteria 1236
620 Ga0495647_0009287 3300046681 Bacteria 3327
621 Ga0495658_0033364 3300046683 Bacteria 2818
622 Ga0495649_0003993 3300046694 Bacteria 9723
623 Ga0495660_0035588 3300046810 Bacteria 2781
624 Ga0495676_0019792 3300047321 Bacteria 5917
625 Ga0495687_001797 3300047443 Bacteria 18906
626 Ga0495687_007155 3300047443 Bacteria 6646
627 Ga0495686_0044943 3300047472 Bacteria 2796
628 Ga0495593_0045863 3300047673 Bacteria 2331
629 Ga0495626_0045695 3300048091 Bacteria 2043
630 Ga0496101_0051814 3300048904 Bacteria 2958
631 Ga0496102_0018789 3300048905 Bacteria 6080
632 Ga0496103_0098087 3300048906 Bacteria 1853
633 Ga0496104_0018943 3300048907 Bacteria 6288
634 Ga0496104_0095478 3300048907 Bacteria 2844
635 Ga0496105_0176831 3300048908 Bacteria 1748
636 Ga0496106_0306686 3300048909 Bacteria 1273
637 Ga0496107_0211422 3300048910 Bacteria 1442
638 Ga0496108_0009600 3300048911 Bacteria 7843
639 Ga0496108_0150854 3300048911 Bacteria 2005
640 Ga0496109_0043536 3300048912 Bacteria 4069
641 Ga0496110_0200555 3300048913 Bacteria 1813
642 Ga0496111_0013244 3300048914 Bacteria 5606
643 Ga0496112_0109655 3300048915 Bacteria 2730
644 Ga0496112_0220849 3300048915 Bacteria 1851
645 Ga0496113_0126219 3300048916 Bacteria 2004
646 Ga0496114_0405558 3300048917 Bacteria 1207
647 Ga0496115_0148915 3300048918 Bacteria 1932
648 Ga0496121_0007296 3300048924 Bacteria 13370
649 Ga0496122_0122437 3300048925 Bacteria 1674
650 Ga0496123_0129409 3300048926 Bacteria 1402
651 Ga0496124_0072578 3300048927 Bacteria 2850
652 Ga0496125_0040624 3300048928 Bacteria 3987
653 Ga0496125_0059109 3300048928 Bacteria 3091
654 Ga0501043_0000277 3300049579 Bacteria 46284
655 Ga0501046_0000345 3300049580 Bacteria 46730
656 Ga0501047_0000395 3300049581 Bacteria 48969
657 Ga0501048_0000111 3300049582 Bacteria 46009
658 Ga0501198_000023 3300049649 Bacteria 69100
659 Ga0501222_000031 3300049662 Bacteria 56867
660 Ga0501276_003863 3300049773 Bacteria 1104
661 Ga0501045_0071736 3300049824 Bacteria 2549
662 nmdc:mga03683_37286_c1 3300050489 Bacteria 1540
663 nmdc:mga03683_90202_c1 3300050489 Bacteria 1335
664 nmdc:mga03n38_103612_c1 3300050490 Bacteria 1376
665 nmdc:mga03n38_4126_c1 3300050490 Bacteria 4771
666 nmdc:mga00v17_27516_c1 3300050491 Bacteria 3320
667 nmdc:mga00v17_8528_c1 3300050491 Bacteria 5517
668 nmdc:mga0yw44_300239_c1 3300050492 Bacteria 1076
669 nmdc:mga0k408_11259_c1 3300050493 Bacteria 4864
670 nmdc:mga0k408_13795_c1 3300050493 Bacteria 4438
671 nmdc:mga0k408_1405_c1 3300050493 Bacteria 13025
672 nmdc:mga0k408_1412_c1 3300050493 Bacteria 12975
673 nmdc:mga0k408_2728_c1 3300050493 Bacteria 4496
674 nmdc:mga0k408_316661_c1 3300050493 Bacteria 931
675 nmdc:mga0k408_40965_c1 3300050493 Bacteria 2666
676 nmdc:mga0k408_4980_c1 3300050493 Bacteria 7039
677 nmdc:mga0k408_5321_c1 3300050493 Bacteria 6838
678 nmdc:mga0k408_5383_c1 3300050493 Bacteria 6807
679 nmdc:mga0k408_92577_c1 3300050493 Bacteria 1777
680 nmdc:mga06z11_10035_c1 3300050494 Bacteria 4016
681 nmdc:mga06z11_105112_c1 3300050494 Bacteria 1555
682 nmdc:mga06z11_13948_c1 3300050494 Bacteria 3544
683 nmdc:mga06z11_15236_c1 3300050494 Bacteria 3427
684 nmdc:mga06z11_3034_c1 3300050494 Bacteria 6460
685 nmdc:mga06z11_58993_c1 3300050494 Bacteria 1993
686 nmdc:mga04h51_5190_c1 3300050495 Bacteria 3305
687 nmdc:mga07m45_1136_c1 3300050496 Bacteria 11938
688 nmdc:mga07m45_162486_c1 3300050496 Bacteria 1297
689 nmdc:mga07m45_172704_c1 3300050496 Bacteria 1256
690 nmdc:mga07m45_1876_c1 3300050496 Bacteria 9712
691 nmdc:mga07m45_65850_c1 3300050496 Bacteria 2058
692 nmdc:mga07m45_8856_c1 3300050496 Bacteria 5193
693 nmdc:mga09592_9369_c1 3300050508 Bacteria 7965
694 nmdc:mga0qj67_41652_c1 3300050509 Bacteria 3613
695 nmdc:mga0sz30_114364_c1 3300050516 Bacteria 1184
696 Ga0495601_0235306 3300053077 Bacteria 1196
697 Ga0495595_0083762 3300053084 Bacteria 1523
698 Ga0495619_0276097 3300053085 Bacteria 1164
699 Ga0500578_0000406 3300053086 Bacteria 52894
700 Ga0500578_0050971 3300053086 Bacteria 2653
701 Ga0500578_0205033 3300053086 Bacteria 1205
702 Ga0500644_0028023 3300053088 Bacteria 1758
703 Ga0500646_0005193 3300053090 Bacteria 3296
704 Ga0500651_0000877 3300053093 Bacteria 14753
705 Ga0500651_0188997 3300053093 Bacteria 1220
706 Ga0500641_0153343 3300053096 Bacteria 994
707 Ga0500650_0146576 3300053098 Bacteria 1093
708 Ga0500569_018620 3300053109 Bacteria 1796
709 Ga0500593_000740 3300053117 Bacteria 12307
710 Ga0500593_132659 3300053117 Bacteria 992
711 Ga0500628_003477 3300053129 Bacteria 2600
712 Ga0500642_0026417 3300053130 Bacteria 2370
713 Ga0500642_0058307 3300053130 Bacteria 1725
714 Ga0500652_000420 3300053131 Bacteria 15148
715 Ga0500652_006725 3300053131 Bacteria 3721
716 Ga0500658_0006265 3300053134 Bacteria 4423
717 Ga0500559_0000265 3300053136 Bacteria 40939
718 Ga0500561_0019744 3300053137 Bacteria 1565
719 Ga0500568_0011911 3300053139 Bacteria 4014
720 Ga0500568_0073755 3300053139 Bacteria 1303
721 Ga0500622_0001047 3300053156 Bacteria 23044
722 Ga0500622_0002039 3300053156 Bacteria 15066
723 Ga0500622_0063954 3300053156 Bacteria 1872
724 Ga0500636_0109930 3300053177 Bacteria 1559
725 Ga0500645_003124 3300053730 Bacteria 6902
726 Ga0500587_001927 3300053739 Bacteria 2956

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031456 Ga0307513_10116245 Ga0307513_101162452 249
2 3300013308 Ga0157375_10168125 Ga0157375_101681252 258
3 3300050493 nmdc:mga0k408_2728_c1 nmdc:mga0k408_2728_c1_10_822 265
4 3300050516 nmdc:mga0sz30_114364_c1 nmdc:mga0sz30_114364_c1_355_1170 266
5 3300006048 Ga0075363_100015708 Ga0075363_1000157083 268
6 3300006195 Ga0075366_10017325 Ga0075366_100173253 268
7 3300006353 Ga0075370_10012014 Ga0075370_100120143 268
8 3300013306 Ga0163162_10061442 Ga0163162_100614423 268
9 3300050490 nmdc:mga03n38_103612_c1 nmdc:mga03n38_103612_c1_311_1192 268
10 3300050493 nmdc:mga0k408_11259_c1 nmdc:mga0k408_11259_c1_3180_4061 268
11 3300050494 nmdc:mga06z11_58993_c1 nmdc:mga06z11_58993_c1_917_1798 268
12 3300035398 Ga0316574_0089740 Ga0316574_0089740_15_878 269
13 3300021361 Ga0213872_10000141 Ga0213872_1000014121 270
14 3300032168 Ga0316593_10008342 Ga0316593_100083422 270
15 3300039447 Ga0436361_0508822 Ga0436361_0508822_21564_22457 270
16 3300021361 Ga0213872_10041095 Ga0213872_100410953 271
17 3300039447 Ga0436361_0890342 Ga0436361_0890342_835_1716 271
18 3300005549 Ga0070704_100034005 Ga0070704_1000340053 272
19 iso_pu_bacteria 2574179768 2574429964 272
20 3300039447 Ga0436361_0006095 Ga0436361_0006095_16_864 275
21 3300039110 Ga0400487_56809 Ga0400487_56809_1614_2474 276
22 3300026041 Ga0207639_10549776 Ga0207639_105497761 279
23 3300036647 Ga0316582_0022105 Ga0316582_0022105_1724_2587 279
24 3300036647 Ga0316582_0072290 Ga0316582_0072290_1349_2212 279
25 3300036712 Ga0316584_0119348 Ga0316584_0119348_447_1310 279
26 3300014497 Ga0182008_10000148 Ga0182008_1000014823 280
27 3300003320 rootH2_10090249 rootH2_100902492 281
28 3300003323 rootH1_10182120 rootH1_101821203 281
29 3300003758 Ga0055532_1003704 Ga0055532_10037042 281
30 3300003759 Ga0055525_1000056 Ga0055525_1000056173 281
31 3300003760 Ga0055527_1001533 Ga0055527_10015335 281
32 3300003761 Ga0055535_1002809 Ga0055535_10028095 281
33 3300003762 Ga0055542_1002605 Ga0055542_10026055 281
34 3300003763 Ga0055529_1000823 Ga0055529_10008235 281
35 3300003790 Ga0055528_1001010 Ga0055528_10010106 281
36 3300003856 Ga0058692_1001284 Ga0058692_10012849 281
37 3300021361 Ga0213872_10000120 Ga0213872_1000012039 281
38 3300025228 Ga0209672_100153 Ga0209672_10015351 281
39 3300025229 Ga0209147_100043 Ga0209147_100043271 281
40 3300025230 Ga0209563_100014 Ga0209563_10001421 281
41 3300025242 Ga0209258_100023 Ga0209258_100023470 281
42 3300025254 Ga0209148_1000029 Ga0209148_1000029537 281
43 3300025263 Ga0209565_1013438 Ga0209565_10134381 281
44 3300025272 Ga0209455_1000064 Ga0209455_1000064266 281
45 3300025272 Ga0209455_1000722 Ga0209455_10007226 281
46 3300025273 Ga0209673_1000084 Ga0209673_100008482 281
47 3300025295 Ga0209564_1003064 Ga0209564_10030643 281
48 3300027312 Ga0209371_1000526 Ga0209371_100052619 281
49 3300030500 Ga0268256_1000860 Ga0268256_100086017 281
50 3300039447 Ga0436361_0097160 Ga0436361_0097160_39116_39988 281
51 iso_pu_bacteria 2585428057 2587730577 281
52 iso_pu_bacteria 2585428058 2587736805 281
53 iso_pu_bacteria 2585428062 2587758931 281
54 iso_pu_bacteria 2588253510 2588294948 281
55 iso_pu_bacteria 2643221592 2643967807 281
56 iso_pu_bacteria 2643221625 2644140629 281
57 iso_pu_bacteria 2643221648 2644273596 281
58 iso_pu_bacteria 2738543013 2739249845 281
59 3300003322 rootL2_10190253 rootL2_101902531 282
60 3300003784 Ga0055534_1000722 Ga0055534_100072215 282
61 3300003792 Ga0055540_1012226 Ga0055540_10122262 282
62 3300005295 Ga0065707_10099760 Ga0065707_100997603 282
63 3300005328 Ga0070676_10029595 Ga0070676_100295954 282
64 3300005330 Ga0070690_100325991 Ga0070690_1003259911 282
65 3300005347 Ga0070668_100207372 Ga0070668_1002073723 282
66 3300005456 Ga0070678_100015954 Ga0070678_1000159545 282
67 3300005459 Ga0068867_100005331 Ga0068867_1000053314 282
68 3300005467 Ga0070706_100074527 Ga0070706_1000745272 282
69 3300005543 Ga0070672_100009095 Ga0070672_1000090953 282
70 3300005616 Ga0068852_100006370 Ga0068852_1000063702 282
71 3300005719 Ga0068861_100011019 Ga0068861_1000110194 282
72 3300005841 Ga0068863_100425543 Ga0068863_1004255432 282
73 3300005843 Ga0068860_100001559 Ga0068860_10000155911 282
74 3300005843 Ga0068860_100033277 Ga0068860_1000332772 282
75 3300005844 Ga0068862_100056270 Ga0068862_1000562704 282
76 3300005937 Ga0081455_10060841 Ga0081455_100608413 282
77 3300006048 Ga0075363_100074539 Ga0075363_1000745392 282
78 3300006177 Ga0075362_10047649 Ga0075362_100476491 282
79 3300006178 Ga0075367_10160829 Ga0075367_101608292 282
80 3300006195 Ga0075366_10009087 Ga0075366_100090875 282
81 3300006195 Ga0075366_10148112 Ga0075366_101481122 282
82 3300006880 Ga0075429_100038607 Ga0075429_1000386074 282
83 3300009093 Ga0105240_10018949 Ga0105240_100189494 282
84 3300009093 Ga0105240_10290860 Ga0105240_102908602 282
85 3300009148 Ga0105243_10000649 Ga0105243_100006494 282
86 3300009545 Ga0105237_10001988 Ga0105237_1000198819 282
87 3300009551 Ga0105238_10014640 Ga0105238_100146404 282
88 3300009553 Ga0105249_10018682 Ga0105249_100186822 282
89 3300010375 Ga0105239_10004146 Ga0105239_1000414612 282
90 3300013297 Ga0157378_10001811 Ga0157378_1000181111 282
91 3300013308 Ga0157375_10120376 Ga0157375_101203763 282
92 3300014745 Ga0157377_10000006 Ga0157377_10000006406 282
93 3300014968 Ga0157379_10125292 Ga0157379_101252922 282
94 3300021361 Ga0213872_10014511 Ga0213872_100145113 282
95 3300025291 Ga0209675_1002104 Ga0209675_100210410 282
96 3300025292 Ga0209676_1030785 Ga0209676_10307852 282
97 3300025303 Ga0209051_1023211 Ga0209051_10232112 282
98 3300025304 Ga0209257_1011852 Ga0209257_10118522 282
99 3300025899 Ga0207642_10073719 Ga0207642_100737192 282
100 3300025907 Ga0207645_10038735 Ga0207645_100387354 282
101 3300025910 Ga0207684_10139365 Ga0207684_101393652 282
102 3300025913 Ga0207695_10164414 Ga0207695_101644143 282
103 3300025914 Ga0207671_10002519 Ga0207671_100025196 282
104 3300025935 Ga0207709_10001139 Ga0207709_100011394 282
105 3300025940 Ga0207691_10048981 Ga0207691_100489814 282
106 3300025940 Ga0207691_10416470 Ga0207691_104164701 282
107 3300025972 Ga0207668_10092283 Ga0207668_100922834 282
108 3300026035 Ga0207703_10236104 Ga0207703_102361042 282
109 3300026041 Ga0207639_10022020 Ga0207639_100220204 282
110 3300026089 Ga0207648_10000254 Ga0207648_1000025454 282
111 3300026089 Ga0207648_10000419 Ga0207648_1000041912 282
112 3300026118 Ga0207675_100004240 Ga0207675_1000042406 282
113 3300026121 Ga0207683_10077576 Ga0207683_100775763 282
114 3300026121 Ga0207683_10367252 Ga0207683_103672522 282
115 3300026142 Ga0207698_10317308 Ga0207698_103173082 282
116 3300027876 Ga0209974_10001326 Ga0209974_100013262 282
117 3300028380 Ga0268265_10037721 Ga0268265_100377214 282
118 3300028380 Ga0268265_10293563 Ga0268265_102935632 282
119 3300028381 Ga0268264_10002884 Ga0268264_1000288411 282
120 3300028381 Ga0268264_10099566 Ga0268264_100995663 282
121 3300028794 Ga0307515_10001761 Ga0307515_1000176118 282
122 3300031239 Ga0265328_10081360 Ga0265328_100813602 282
123 3300031250 Ga0265331_10001051 Ga0265331_100010516 282
124 3300031251 Ga0265327_10000149 Ga0265327_100001497 282
125 3300031456 Ga0307513_10121506 Ga0307513_101215063 282
126 3300031548 Ga0307408_100204666 Ga0307408_1002046662 282
127 3300031616 Ga0307508_10000440 Ga0307508_1000044032 282
128 3300031649 Ga0307514_10012264 Ga0307514_100122643 282
129 3300031730 Ga0307516_10001466 Ga0307516_1000146618 282
130 3300031730 Ga0307516_10087052 Ga0307516_100870522 282
131 3300031731 Ga0307405_10364613 Ga0307405_103646132 282
132 3300032002 Ga0307416_100111725 Ga0307416_1001117251 282
133 3300033179 Ga0307507_10105932 Ga0307507_101059322 282
134 3300035171 Ga0373946_0140151 Ga0373946_0140151_195_1097 282
135 3300037068 Ga0373925_0048827 Ga0373925_0048827_1447_2349 282
136 3300037471 Ga0395905_0382148 Ga0395905_0382148_11_901 282
137 3300039447 Ga0436361_0616064 Ga0436361_0616064_2300_3187 282
138 3300041496 Ga0451839_0934005 Ga0451839_0934005_70_957 282
139 3300042115 Ga0450911_000958 Ga0450911_000958_3517_4386 282
140 3300046475 Ga0495639_0116624 Ga0495639_0116624_244_1146 282
141 3300046477 Ga0495664_0094528 Ga0495664_0094528_36_953 282
142 3300046492 Ga0495585_0010716 Ga0495585_0010716_2495_3385 282
143 3300046519 Ga0495632_0015621 Ga0495632_0015621_1564_2451 282
144 3300046660 Ga0495625_0008661 Ga0495625_0008661_5100_5987 282
145 3300047472 Ga0495686_0044943 Ga0495686_0044943_1175_2062 282
146 3300048905 Ga0496102_0018789 Ga0496102_0018789_367_1242 282
147 3300048924 Ga0496121_0007296 Ga0496121_0007296_8939_9808 282
148 3300048927 Ga0496124_0072578 Ga0496124_0072578_890_1759 282
149 3300048928 Ga0496125_0040624 Ga0496125_0040624_680_1549 282
150 3300048928 Ga0496125_0059109 Ga0496125_0059109_1538_2407 282
151 3300049579 Ga0501043_0000277 Ga0501043_0000277_33941_34834 282
152 3300049580 Ga0501046_0000345 Ga0501046_0000345_11897_12790 282
153 3300049581 Ga0501047_0000395 Ga0501047_0000395_33941_34834 282
154 3300049582 Ga0501048_0000111 Ga0501048_0000111_33891_34784 282
155 3300049649 Ga0501198_000023 Ga0501198_000023_61972_62847 282
156 3300049662 Ga0501222_000031 Ga0501222_000031_6270_7145 282
157 3300049773 Ga0501276_003863 Ga0501276_003863_131_1006 282
158 3300049824 Ga0501045_0071736 Ga0501045_0071736_439_1332 282
159 3300050493 nmdc:mga0k408_1412_c1 nmdc:mga0k408_1412_c1_9676_10551 282
160 3300050493 nmdc:mga0k408_316661_c1 nmdc:mga0k408_316661_c1_27_902 282
161 3300050508 nmdc:mga09592_9369_c1 nmdc:mga09592_9369_c1_5922_6797 282
162 3300050509 nmdc:mga0qj67_41652_c1 nmdc:mga0qj67_41652_c1_2467_3342 282
163 3300053117 Ga0500593_000740 Ga0500593_000740_2894_3784 282
164 3300053739 Ga0500587_001927 Ga0500587_001927_1145_2032 282
165 iso_pu_bacteria 2928115317 2928120505 282
166 3300002773 JGI25152J39213_1001430 JGI25152J39213_10014305 283
167 3300003215 JGI25153J46596_10006137 JGI25153J46596_100061374 283
168 3300003215 JGI25153J46596_10029984 JGI25153J46596_100299842 283
169 3300003790 Ga0055528_1031440 Ga0055528_10314401 283
170 3300005262 Ga0065165_1000910 Ga0065165_10009105 283
171 3300006038 Ga0075365_10057943 Ga0075365_100579433 283
172 3300006178 Ga0075367_10024628 Ga0075367_100246282 283
173 3300006195 Ga0075366_10007235 Ga0075366_100072354 283
174 3300006353 Ga0075370_10001171 Ga0075370_1000117112 283
175 3300021361 Ga0213872_10000155 Ga0213872_1000015554 283
176 3300021361 Ga0213872_10022453 Ga0213872_100224532 283
177 3300025245 Ga0207425_1000703 Ga0207425_100070314 283
178 3300025258 Ga0209129_1000933 Ga0209129_10009339 283
179 3300025273 Ga0209673_1008819 Ga0209673_10088194 283
180 3300025273 Ga0209673_1014498 Ga0209673_10144981 283
181 3300025295 Ga0209564_1000627 Ga0209564_100062747 283
182 3300025297 Ga0209758_1000593 Ga0209758_100059349 283
183 3300025297 Ga0209758_1000769 Ga0209758_100076938 283
184 3300025298 Ga0209050_1000799 Ga0209050_100079935 283
185 3300025299 Ga0209256_1012880 Ga0209256_10128802 283
186 3300025304 Ga0209257_1047282 Ga0209257_10472822 283
187 3300039447 Ga0436361_0813098 Ga0436361_0813098_10358_11236 283
188 3300039447 Ga0436361_0997353 Ga0436361_0997353_1451_2329 283
189 3300041443 Ga0451789_0850686 Ga0451789_0850686_750_1625 283
190 3300041451 Ga0451791_1448603 Ga0451791_1448603_596_1471 283
191 3300041452 Ga0451793_0036517 Ga0451793_0036517_759_1634 283
192 3300041456 Ga0451795_0755555 Ga0451795_0755555_1058_1933 283
193 3300041458 Ga0451798_0683313 Ga0451798_0683313_183_1058 283
194 3300041460 Ga0451802_0060270 Ga0451802_0060270_244_1119 283
195 3300046512 Ga0495610_0044046 Ga0495610_0044046_908_1783 283
196 3300046519 Ga0495632_0001689 Ga0495632_0001689_1024_1899 283
197 3300050494 nmdc:mga06z11_15236_c1 nmdc:mga06z11_15236_c1_2084_2959 283
198 3300050496 nmdc:mga07m45_8856_c1 nmdc:mga07m45_8856_c1_3808_4683 283
199 3300053086 Ga0500578_0000406 Ga0500578_0000406_41579_42454 283
200 3300053088 Ga0500644_0028023 Ga0500644_0028023_359_1234 283
201 3300053090 Ga0500646_0005193 Ga0500646_0005193_150_1025 283
202 3300053093 Ga0500651_0000877 Ga0500651_0000877_10240_11115 283
203 3300053096 Ga0500641_0153343 Ga0500641_0153343_53_928 283
204 3300053098 Ga0500650_0146576 Ga0500650_0146576_133_1008 283
205 3300053109 Ga0500569_018620 Ga0500569_018620_640_1515 283
206 3300053117 Ga0500593_132659 Ga0500593_132659_30_905 283
207 3300053129 Ga0500628_003477 Ga0500628_003477_1044_1919 283
208 3300053130 Ga0500642_0026417 Ga0500642_0026417_829_1704 283
209 3300053130 Ga0500642_0058307 Ga0500642_0058307_254_1129 283
210 3300053131 Ga0500652_000420 Ga0500652_000420_2781_3656 283
211 3300053137 Ga0500561_0019744 Ga0500561_0019744_333_1208 283
212 3300053139 Ga0500568_0073755 Ga0500568_0073755_317_1192 283
213 3300053156 Ga0500622_0001047 Ga0500622_0001047_14018_14893 283
214 3300053156 Ga0500622_0063954 Ga0500622_0063954_349_1224 283
215 3300005331 Ga0070670_100132670 Ga0070670_1001326701 284
216 3300006177 Ga0075362_10090893 Ga0075362_100908933 284
217 3300021361 Ga0213872_10000277 Ga0213872_100002777 284
218 3300028794 Ga0307515_10209215 Ga0307515_102092152 284
219 3300039447 Ga0436361_0004041 Ga0436361_0004041_18891_19787 284
220 3300039447 Ga0436361_1067841 Ga0436361_1067841_858_1739 284
221 iso_pu_bacteria 2919704043 2919708972 284
222 3300005328 Ga0070676_10115885 Ga0070676_101158852 285
223 3300005331 Ga0070670_100228926 Ga0070670_1002289262 285
224 3300005333 Ga0070677_10043499 Ga0070677_100434991 285
225 3300005333 Ga0070677_10059229 Ga0070677_100592292 285
226 3300005335 Ga0070666_10019439 Ga0070666_100194395 285
227 3300005338 Ga0068868_100041022 Ga0068868_1000410224 285
228 3300005353 Ga0070669_100305094 Ga0070669_1003050941 285
229 3300005354 Ga0070675_100095980 Ga0070675_1000959803 285
230 3300005355 Ga0070671_100055566 Ga0070671_1000555662 285
231 3300005355 Ga0070671_100082453 Ga0070671_1000824534 285
232 3300005355 Ga0070671_100272828 Ga0070671_1002728282 285
233 3300005356 Ga0070674_100423751 Ga0070674_1004237511 285
234 3300005364 Ga0070673_100044736 Ga0070673_1000447364 285
235 3300005367 Ga0070667_100101241 Ga0070667_1001012412 285
236 3300005456 Ga0070678_100061375 Ga0070678_1000613752 285
237 3300005457 Ga0070662_100148501 Ga0070662_1001485012 285
238 3300005457 Ga0070662_100333430 Ga0070662_1003334302 285
239 3300005459 Ga0068867_100046359 Ga0068867_1000463594 285
240 3300005459 Ga0068867_100103912 Ga0068867_1001039122 285
241 3300005466 Ga0070685_10101141 Ga0070685_101011412 285
242 3300005548 Ga0070665_100342154 Ga0070665_1003421542 285
243 3300005578 Ga0068854_100057248 Ga0068854_1000572484 285
244 3300005618 Ga0068864_100011131 Ga0068864_1000111312 285
245 3300005719 Ga0068861_100478323 Ga0068861_1004783232 285
246 3300005834 Ga0068851_10090779 Ga0068851_100907792 285
247 3300005841 Ga0068863_100010999 Ga0068863_1000109996 285
248 3300005844 Ga0068862_100162356 Ga0068862_1001623563 285
249 3300009553 Ga0105249_10094890 Ga0105249_100948903 285
250 3300013296 Ga0157374_10143755 Ga0157374_101437554 285
251 3300013297 Ga0157378_10289253 Ga0157378_102892532 285
252 3300013308 Ga0157375_10090733 Ga0157375_100907334 285
253 3300014325 Ga0163163_10011394 Ga0163163_100113944 285
254 3300014968 Ga0157379_10016325 Ga0157379_100163254 285
255 3300014969 Ga0157376_10052668 Ga0157376_100526683 285
256 3300025271 Ga0207666_1005498 Ga0207666_10054981 285
257 3300025315 Ga0207697_10021253 Ga0207697_100212532 285
258 3300025893 Ga0207682_10010609 Ga0207682_100106092 285
259 3300025893 Ga0207682_10019286 Ga0207682_100192863 285
260 3300025907 Ga0207645_10144160 Ga0207645_101441602 285
261 3300025923 Ga0207681_10027585 Ga0207681_100275853 285
262 3300025931 Ga0207644_10048247 Ga0207644_100482472 285
263 3300025936 Ga0207670_10053469 Ga0207670_100534693 285
264 3300025942 Ga0207689_10049644 Ga0207689_100496442 285
265 3300025945 Ga0207679_10365964 Ga0207679_103659641 285
266 3300025961 Ga0207712_10187570 Ga0207712_101875701 285
267 3300025972 Ga0207668_10081035 Ga0207668_100810354 285
268 3300025981 Ga0207640_10155938 Ga0207640_101559382 285
269 3300026023 Ga0207677_10061139 Ga0207677_100611393 285
270 3300026088 Ga0207641_10100741 Ga0207641_101007413 285
271 3300026089 Ga0207648_10024822 Ga0207648_100248224 285
272 3300026089 Ga0207648_10066548 Ga0207648_100665484 285
273 3300026121 Ga0207683_10101938 Ga0207683_101019383 285
274 3300028379 Ga0268266_10191859 Ga0268266_101918592 285
275 3300036401 Ga0373937_0269388 Ga0373937_0269388_413_1297 285
276 3300042439 Ga0439464_0002359 Ga0439464_0002359_2406_3290 285
277 3300046537 Ga0495598_0009291 Ga0495598_0009291_615_1499 285
278 3300046537 Ga0495598_0026501 Ga0495598_0026501_326_1243 285
279 3300046539 Ga0495621_0044763 Ga0495621_0044763_560_1477 285
280 3300048907 Ga0496104_0095478 Ga0496104_0095478_754_1638 285
281 3300048908 Ga0496105_0176831 Ga0496105_0176831_177_1061 285
282 3300048925 Ga0496122_0122437 Ga0496122_0122437_644_1525 285
283 3300048926 Ga0496123_0129409 Ga0496123_0129409_55_936 285
284 iso_pu_bacteria 2643221654 2644303490 285
285 3300003316 rootH1_10059918 rootH1_100599182 286
286 3300003322 rootL2_10074920 rootL2_100749202 286
287 3300005331 Ga0070670_100000775 Ga0070670_10000077512 286
288 3300005331 Ga0070670_100019018 Ga0070670_1000190183 286
289 3300005338 Ga0068868_100084774 Ga0068868_1000847744 286
290 3300005338 Ga0068868_100299470 Ga0068868_1002994702 286
291 3300005338 Ga0068868_100420606 Ga0068868_1004206061 286
292 3300005347 Ga0070668_100135605 Ga0070668_1001356052 286
293 3300005353 Ga0070669_100171684 Ga0070669_1001716842 286
294 3300005353 Ga0070669_100402027 Ga0070669_1004020272 286
295 3300005354 Ga0070675_100001482 Ga0070675_10000148217 286
296 3300005354 Ga0070675_100034226 Ga0070675_1000342263 286
297 3300005355 Ga0070671_100042415 Ga0070671_1000424154 286
298 3300005355 Ga0070671_100187226 Ga0070671_1001872262 286
299 3300005356 Ga0070674_100120808 Ga0070674_1001208082 286
300 3300005364 Ga0070673_100003372 Ga0070673_1000033728 286
301 3300005364 Ga0070673_100236798 Ga0070673_1002367982 286
302 3300005367 Ga0070667_100006649 Ga0070667_1000066499 286
303 3300005367 Ga0070667_100131122 Ga0070667_1001311223 286
304 3300005445 Ga0070708_100258413 Ga0070708_1002584131 286
305 3300005456 Ga0070678_100017348 Ga0070678_1000173481 286
306 3300005457 Ga0070662_100189138 Ga0070662_1001891383 286
307 3300005459 Ga0068867_100002317 Ga0068867_1000023177 286
308 3300005459 Ga0068867_100517055 Ga0068867_1005170551 286
309 3300005467 Ga0070706_100000367 Ga0070706_10000036716 286
310 3300005468 Ga0070707_100185816 Ga0070707_1001858162 286
311 3300005543 Ga0070672_100000485 Ga0070672_10000048512 286
312 3300005543 Ga0070672_100050694 Ga0070672_1000506944 286
313 3300005547 Ga0070693_100325643 Ga0070693_1003256431 286
314 3300005548 Ga0070665_100058116 Ga0070665_1000581162 286
315 3300005548 Ga0070665_100472217 Ga0070665_1004722172 286
316 3300005564 Ga0070664_100091085 Ga0070664_1000910852 286
317 3300005578 Ga0068854_100081993 Ga0068854_1000819932 286
318 3300005616 Ga0068852_100048807 Ga0068852_1000488074 286
319 3300005616 Ga0068852_100108555 Ga0068852_1001085552 286
320 3300005618 Ga0068864_100035355 Ga0068864_1000353553 286
321 3300005618 Ga0068864_100158532 Ga0068864_1001585322 286
322 3300006038 Ga0075365_10082684 Ga0075365_100826842 286
323 3300006042 Ga0075368_10003231 Ga0075368_100032315 286
324 3300006042 Ga0075368_10005709 Ga0075368_100057095 286
325 3300006042 Ga0075368_10029201 Ga0075368_100292012 286
326 3300006048 Ga0075363_100000145 Ga0075363_10000014511 286
327 3300006048 Ga0075363_100050668 Ga0075363_1000506683 286
328 3300006048 Ga0075363_100122212 Ga0075363_1001222122 286
329 3300006051 Ga0075364_10058438 Ga0075364_100584383 286
330 3300006177 Ga0075362_10000580 Ga0075362_1000058010 286
331 3300006177 Ga0075362_10003899 Ga0075362_100038994 286
332 3300006178 Ga0075367_10002249 Ga0075367_100022495 286
333 3300006178 Ga0075367_10004330 Ga0075367_100043304 286
334 3300006178 Ga0075367_10012127 Ga0075367_100121273 286
335 3300006178 Ga0075367_10034912 Ga0075367_100349122 286
336 3300006178 Ga0075367_10275422 Ga0075367_102754221 286
337 3300006186 Ga0075369_10003203 Ga0075369_100032037 286
338 3300006186 Ga0075369_10018407 Ga0075369_100184074 286
339 3300006186 Ga0075369_10064800 Ga0075369_100648001 286
340 3300006195 Ga0075366_10000582 Ga0075366_1000058215 286
341 3300006195 Ga0075366_10001974 Ga0075366_100019749 286
342 3300006195 Ga0075366_10016069 Ga0075366_100160694 286
343 3300006195 Ga0075366_10022472 Ga0075366_100224724 286
344 3300006195 Ga0075366_10052321 Ga0075366_100523212 286
345 3300006195 Ga0075366_10138256 Ga0075366_101382563 286
346 3300006195 Ga0075366_10165633 Ga0075366_101656332 286
347 3300006195 Ga0075366_10186592 Ga0075366_101865921 286
348 3300006353 Ga0075370_10000854 Ga0075370_100008549 286
349 3300006353 Ga0075370_10002800 Ga0075370_100028007 286
350 3300006353 Ga0075370_10010740 Ga0075370_100107404 286
351 3300006353 Ga0075370_10045564 Ga0075370_100455643 286
352 3300006353 Ga0075370_10057297 Ga0075370_100572974 286
353 3300006358 Ga0068871_100040253 Ga0068871_1000402535 286
354 3300009093 Ga0105240_10081673 Ga0105240_100816731 286
355 3300009148 Ga0105243_10035667 Ga0105243_100356675 286
356 3300009545 Ga0105237_10044846 Ga0105237_100448464 286
357 3300010375 Ga0105239_10142381 Ga0105239_101423812 286
358 3300011119 Ga0105246_10058179 Ga0105246_100581792 286
359 3300013297 Ga0157378_10459111 Ga0157378_104591112 286
360 3300013306 Ga0163162_10311123 Ga0163162_103111232 286
361 3300013307 Ga0157372_10520383 Ga0157372_105203832 286
362 3300014325 Ga0163163_10254879 Ga0163163_102548793 286
363 3300014326 Ga0157380_10369806 Ga0157380_103698062 286
364 3300014745 Ga0157377_10218869 Ga0157377_102188692 286
365 3300014968 Ga0157379_10015125 Ga0157379_100151254 286
366 3300017792 Ga0163161_10103176 Ga0163161_101031762 286
367 3300025315 Ga0207697_10017039 Ga0207697_100170393 286
368 3300025321 Ga0207656_10057781 Ga0207656_100577812 286
369 3300025893 Ga0207682_10004387 Ga0207682_100043872 286
370 3300025901 Ga0207688_10026931 Ga0207688_100269313 286
371 3300025910 Ga0207684_10008798 Ga0207684_100087983 286
372 3300025914 Ga0207671_10031240 Ga0207671_100312405 286
373 3300025922 Ga0207646_10143806 Ga0207646_101438062 286
374 3300025923 Ga0207681_10166070 Ga0207681_101660702 286
375 3300025925 Ga0207650_10000275 Ga0207650_1000027545 286
376 3300025925 Ga0207650_10076434 Ga0207650_100764342 286
377 3300025926 Ga0207659_10003305 Ga0207659_1000330511 286
378 3300025931 Ga0207644_10005477 Ga0207644_100054772 286
379 3300025931 Ga0207644_10061537 Ga0207644_100615374 286
380 3300025933 Ga0207706_10241037 Ga0207706_102410372 286
381 3300025937 Ga0207669_10001031 Ga0207669_100010312 286
382 3300025940 Ga0207691_10001335 Ga0207691_1000133520 286
383 3300025942 Ga0207689_10051233 Ga0207689_100512335 286
384 3300025945 Ga0207679_10078325 Ga0207679_100783252 286
385 3300025960 Ga0207651_10015270 Ga0207651_100152702 286
386 3300025960 Ga0207651_10064540 Ga0207651_100645401 286
387 3300025986 Ga0207658_10006476 Ga0207658_100064767 286
388 3300025986 Ga0207658_10037844 Ga0207658_100378443 286
389 3300026023 Ga0207677_10274858 Ga0207677_102748582 286
390 3300026088 Ga0207641_10073800 Ga0207641_100738003 286
391 3300026089 Ga0207648_10012495 Ga0207648_100124952 286
392 3300026089 Ga0207648_10425365 Ga0207648_104253652 286
393 3300026095 Ga0207676_10176961 Ga0207676_101769612 286
394 3300026121 Ga0207683_10061301 Ga0207683_100613014 286
395 3300027526 Ga0209968_1000617 Ga0209968_10006173 286
396 3300027695 Ga0209966_1000517 Ga0209966_10005176 286
397 3300027866 Ga0209813_10008813 Ga0209813_100088132 286
398 3300028379 Ga0268266_10021143 Ga0268266_100211436 286
399 3300028381 Ga0268264_10132357 Ga0268264_101323572 286
400 3300028786 Ga0307517_10004486 Ga0307517_1000448621 286
401 3300028786 Ga0307517_10128757 Ga0307517_101287573 286
402 3300028794 Ga0307515_10011753 Ga0307515_1001175310 286
403 3300028794 Ga0307515_10221009 Ga0307515_102210093 286
404 3300028794 Ga0307515_10227993 Ga0307515_102279933 286
405 3300031456 Ga0307513_10323162 Ga0307513_103231622 286
406 3300031507 Ga0307509_10000405 Ga0307509_1000040565 286
407 3300031507 Ga0307509_10015076 Ga0307509_100150768 286
408 3300031507 Ga0307509_10065554 Ga0307509_100655544 286
409 3300031507 Ga0307509_10127153 Ga0307509_101271532 286
410 3300031616 Ga0307508_10004752 Ga0307508_1000475212 286
411 3300031616 Ga0307508_10015474 Ga0307508_100154748 286
412 3300031616 Ga0307508_10172040 Ga0307508_101720402 286
413 3300031730 Ga0307516_10001028 Ga0307516_1000102815 286
414 3300031731 Ga0307405_10020862 Ga0307405_100208622 286
415 3300031824 Ga0307413_10108421 Ga0307413_101084212 286
416 3300031824 Ga0307413_10267254 Ga0307413_102672542 286
417 3300031838 Ga0307518_10178984 Ga0307518_101789842 286
418 3300031901 Ga0307406_10035628 Ga0307406_100356284 286
419 3300031903 Ga0307407_10026775 Ga0307407_100267752 286
420 3300031911 Ga0307412_10016042 Ga0307412_100160424 286
421 3300031995 Ga0307409_100253842 Ga0307409_1002538422 286
422 3300031995 Ga0307409_100413856 Ga0307409_1004138561 286
423 3300032002 Ga0307416_100093487 Ga0307416_1000934873 286
424 3300032005 Ga0307411_10043269 Ga0307411_100432692 286
425 3300032005 Ga0307411_10095287 Ga0307411_100952873 286
426 3300032126 Ga0307415_100029395 Ga0307415_1000293954 286
427 3300033179 Ga0307507_10092918 Ga0307507_100929184 286
428 3300033180 Ga0307510_10003419 Ga0307510_100034198 286
429 3300033180 Ga0307510_10016969 Ga0307510_100169691 286
430 3300033180 Ga0307510_10063734 Ga0307510_100637345 286
431 3300035112 Ga0373932_0013862 Ga0373932_0013862_316_1203 286
432 3300035691 Ga0373931_0029921 Ga0373931_0029921_357_1244 286
433 3300036401 Ga0373937_0555889 Ga0373937_0555889_20_907 286
434 3300042012 Ga0439455_0050885 Ga0439455_0050885_173_1060 286
435 3300042876 Ga0451577_0246756 Ga0451577_0246756_605_1492 286
436 3300044712 Ga0453684_0029228 Ga0453684_0029228_2681_3568 286
437 3300044712 Ga0453684_0216774 Ga0453684_0216774_681_1568 286
438 3300046454 Ga0495592_0000528 Ga0495592_0000528_12175_13062 286
439 3300046457 Ga0495590_0038871 Ga0495590_0038871_142_1029 286
440 3300046459 Ga0495629_0374654 Ga0495629_0374654_13_900 286
441 3300046460 Ga0495638_0083555 Ga0495638_0083555_493_1380 286
442 3300046474 Ga0495605_0128925 Ga0495605_0128925_55_942 286
443 3300046507 Ga0495606_0046495 Ga0495606_0046495_1584_2477 286
444 3300046515 Ga0495620_0057588 Ga0495620_0057588_87_974 286
445 3300046519 Ga0495632_0027029 Ga0495632_0027029_377_1264 286
446 3300046519 Ga0495632_0036013 Ga0495632_0036013_968_1855 286
447 3300046524 Ga0495648_0125861 Ga0495648_0125861_275_1162 286
448 3300046542 Ga0495597_0010750 Ga0495597_0010750_818_1705 286
449 3300046660 Ga0495625_0023081 Ga0495625_0023081_520_1407 286
450 3300046660 Ga0495625_0222375 Ga0495625_0222375_158_1045 286
451 3300046694 Ga0495649_0003993 Ga0495649_0003993_7450_8337 286
452 3300046810 Ga0495660_0035588 Ga0495660_0035588_322_1209 286
453 3300047321 Ga0495676_0019792 Ga0495676_0019792_1526_2413 286
454 3300047443 Ga0495687_001797 Ga0495687_001797_6394_7281 286
455 3300047443 Ga0495687_007155 Ga0495687_007155_4787_5674 286
456 3300047673 Ga0495593_0045863 Ga0495593_0045863_878_1765 286
457 3300048091 Ga0495626_0045695 Ga0495626_0045695_1128_2015 286
458 3300048917 Ga0496114_0405558 Ga0496114_0405558_100_987 286
459 3300050489 nmdc:mga03683_37286_c1 nmdc:mga03683_37286_c1_34_921 286
460 3300050489 nmdc:mga03683_90202_c1 nmdc:mga03683_90202_c1_107_994 286
461 3300050490 nmdc:mga03n38_4126_c1 nmdc:mga03n38_4126_c1_1772_2659 286
462 3300050491 nmdc:mga00v17_27516_c1 nmdc:mga00v17_27516_c1_1231_2118 286
463 3300050491 nmdc:mga00v17_8528_c1 nmdc:mga00v17_8528_c1_3899_4786 286
464 3300050492 nmdc:mga0yw44_300239_c1 nmdc:mga0yw44_300239_c1_41_928 286
465 3300050493 nmdc:mga0k408_13795_c1 nmdc:mga0k408_13795_c1_1519_2406 286
466 3300050493 nmdc:mga0k408_1405_c1 nmdc:mga0k408_1405_c1_11456_12343 286
467 3300050493 nmdc:mga0k408_40965_c1 nmdc:mga0k408_40965_c1_1056_1943 286
468 3300050493 nmdc:mga0k408_4980_c1 nmdc:mga0k408_4980_c1_3518_4405 286
469 3300050493 nmdc:mga0k408_5321_c1 nmdc:mga0k408_5321_c1_1443_2330 286
470 3300050493 nmdc:mga0k408_5383_c1 nmdc:mga0k408_5383_c1_2486_3373 286
471 3300050493 nmdc:mga0k408_92577_c1 nmdc:mga0k408_92577_c1_683_1570 286
472 3300050494 nmdc:mga06z11_10035_c1 nmdc:mga06z11_10035_c1_335_1222 286
473 3300050494 nmdc:mga06z11_105112_c1 nmdc:mga06z11_105112_c1_455_1342 286
474 3300050494 nmdc:mga06z11_13948_c1 nmdc:mga06z11_13948_c1_113_1000 286
475 3300050494 nmdc:mga06z11_3034_c1 nmdc:mga06z11_3034_c1_4490_5377 286
476 3300050495 nmdc:mga04h51_5190_c1 nmdc:mga04h51_5190_c1_1179_2066 286
477 3300050496 nmdc:mga07m45_1136_c1 nmdc:mga07m45_1136_c1_9019_9906 286
478 3300050496 nmdc:mga07m45_162486_c1 nmdc:mga07m45_162486_c1_201_1088 286
479 3300050496 nmdc:mga07m45_172704_c1 nmdc:mga07m45_172704_c1_46_933 286
480 3300050496 nmdc:mga07m45_1876_c1 nmdc:mga07m45_1876_c1_4418_5305 286
481 3300050496 nmdc:mga07m45_65850_c1 nmdc:mga07m45_65850_c1_1050_1937 286
482 3300053086 Ga0500578_0050971 Ga0500578_0050971_1084_1977 286
483 3300053086 Ga0500578_0205033 Ga0500578_0205033_29_916 286
484 3300053093 Ga0500651_0188997 Ga0500651_0188997_171_1058 286
485 3300053131 Ga0500652_006725 Ga0500652_006725_2253_3140 286
486 3300053134 Ga0500658_0006265 Ga0500658_0006265_3191_4078 286
487 3300053136 Ga0500559_0000265 Ga0500559_0000265_27056_27943 286
488 3300053139 Ga0500568_0011911 Ga0500568_0011911_705_1592 286
489 3300053156 Ga0500622_0002039 Ga0500622_0002039_3114_4001 286
490 3300053177 Ga0500636_0109930 Ga0500636_0109930_209_1096 286
491 3300053730 Ga0500645_003124 Ga0500645_003124_1286_2179 286
492 iso_pu_bacteria 2643221660 2644339834 286
493 3300005328 Ga0070676_10002478 Ga0070676_100024786 287
494 3300005329 Ga0070683_100009017 Ga0070683_1000090179 287
495 3300005329 Ga0070683_100234578 Ga0070683_1002345782 287
496 3300005329 Ga0070683_100312746 Ga0070683_1003127462 287
497 3300005330 Ga0070690_100185470 Ga0070690_1001854702 287
498 3300005331 Ga0070670_100004150 Ga0070670_1000041509 287
499 3300005331 Ga0070670_100068564 Ga0070670_1000685643 287
500 3300005331 Ga0070670_100171586 Ga0070670_1001715862 287
501 3300005334 Ga0068869_100001648 Ga0068869_10000164812 287
502 3300005334 Ga0068869_100002505 Ga0068869_10000250512 287
503 3300005335 Ga0070666_10002795 Ga0070666_100027958 287
504 3300005335 Ga0070666_10069547 Ga0070666_100695474 287
505 3300005336 Ga0070680_100163072 Ga0070680_1001630722 287
506 3300005339 Ga0070660_100056956 Ga0070660_1000569564 287
507 3300005347 Ga0070668_100337928 Ga0070668_1003379282 287
508 3300005353 Ga0070669_100005859 Ga0070669_1000058596 287
509 3300005353 Ga0070669_100012845 Ga0070669_1000128458 287
510 3300005354 Ga0070675_100020379 Ga0070675_1000203796 287
511 3300005354 Ga0070675_100035035 Ga0070675_1000350354 287
512 3300005354 Ga0070675_100092730 Ga0070675_1000927304 287
513 3300005355 Ga0070671_100039517 Ga0070671_1000395173 287
514 3300005355 Ga0070671_100042863 Ga0070671_1000428632 287
515 3300005356 Ga0070674_100040038 Ga0070674_1000400384 287
516 3300005364 Ga0070673_100215499 Ga0070673_1002154992 287
517 3300005364 Ga0070673_100252437 Ga0070673_1002524372 287
518 3300005367 Ga0070667_100001504 Ga0070667_10000150415 287
519 3300005367 Ga0070667_100006001 Ga0070667_10000600112 287
520 3300005367 Ga0070667_100082325 Ga0070667_1000823251 287
521 3300005438 Ga0070701_10173876 Ga0070701_101738762 287
522 3300005441 Ga0070700_100210142 Ga0070700_1002101421 287
523 3300005455 Ga0070663_100020206 Ga0070663_1000202064 287
524 3300005456 Ga0070678_100060580 Ga0070678_1000605802 287
525 3300005457 Ga0070662_100007654 Ga0070662_1000076548 287
526 3300005457 Ga0070662_100013829 Ga0070662_1000138296 287
527 3300005457 Ga0070662_100045971 Ga0070662_1000459714 287
528 3300005459 Ga0068867_100167322 Ga0068867_1001673222 287
529 3300005535 Ga0070684_100166425 Ga0070684_1001664253 287
530 3300005539 Ga0068853_100039755 Ga0068853_1000397555 287
531 3300005539 Ga0068853_100293718 Ga0068853_1002937183 287
532 3300005543 Ga0070672_100003226 Ga0070672_1000032266 287
533 3300005543 Ga0070672_100079414 Ga0070672_1000794142 287
534 3300005543 Ga0070672_100166826 Ga0070672_1001668262 287
535 3300005577 Ga0068857_100289944 Ga0068857_1002899442 287
536 3300005578 Ga0068854_100039816 Ga0068854_1000398164 287
537 3300005578 Ga0068854_100042167 Ga0068854_1000421675 287
538 3300005614 Ga0068856_100097818 Ga0068856_1000978183 287
539 3300005614 Ga0068856_100432177 Ga0068856_1004321772 287
540 3300005616 Ga0068852_100001454 Ga0068852_1000014548 287
541 3300005616 Ga0068852_100007209 Ga0068852_1000072096 287
542 3300005616 Ga0068852_100082732 Ga0068852_1000827324 287
543 3300005617 Ga0068859_100274935 Ga0068859_1002749352 287
544 3300005618 Ga0068864_100008292 Ga0068864_1000082924 287
545 3300005618 Ga0068864_100012300 Ga0068864_1000123006 287
546 3300005718 Ga0068866_10005941 Ga0068866_100059414 287
547 3300005719 Ga0068861_100002678 Ga0068861_1000026782 287
548 3300005834 Ga0068851_10028063 Ga0068851_100280632 287
549 3300005834 Ga0068851_10083848 Ga0068851_100838482 287
550 3300005842 Ga0068858_100004441 Ga0068858_1000044414 287
551 3300005843 Ga0068860_100006168 Ga0068860_1000061689 287
552 3300005843 Ga0068860_100013982 Ga0068860_1000139823 287
553 3300005844 Ga0068862_100081824 Ga0068862_1000818242 287
554 3300006237 Ga0097621_100025465 Ga0097621_1000254651 287
555 3300006237 Ga0097621_100025620 Ga0097621_1000256206 287
556 3300006237 Ga0097621_100055415 Ga0097621_1000554154 287
557 3300006358 Ga0068871_100007855 Ga0068871_1000078554 287
558 3300006358 Ga0068871_100050810 Ga0068871_1000508103 287
559 3300006881 Ga0068865_100122943 Ga0068865_1001229432 287
560 3300006881 Ga0068865_100297440 Ga0068865_1002974402 287
561 3300006931 Ga0097620_100274948 Ga0097620_1002749482 287
562 3300009093 Ga0105240_10476165 Ga0105240_104761651 287
563 3300009098 Ga0105245_10039692 Ga0105245_100396924 287
564 3300009177 Ga0105248_10033310 Ga0105248_100333104 287
565 3300009177 Ga0105248_10144405 Ga0105248_101444052 287
566 3300009177 Ga0105248_10157950 Ga0105248_101579503 287
567 3300009551 Ga0105238_10286934 Ga0105238_102869341 287
568 3300009551 Ga0105238_10299583 Ga0105238_102995832 287
569 3300009553 Ga0105249_10009613 Ga0105249_100096134 287
570 3300009553 Ga0105249_10403396 Ga0105249_104033962 287
571 3300013100 Ga0157373_10056772 Ga0157373_100567722 287
572 3300013102 Ga0157371_10122165 Ga0157371_101221653 287
573 3300013306 Ga0163162_10011522 Ga0163162_100115228 287
574 3300013306 Ga0163162_10011677 Ga0163162_1001167710 287
575 3300013307 Ga0157372_10011373 Ga0157372_1001137310 287
576 3300013307 Ga0157372_10017578 Ga0157372_100175787 287
577 3300013308 Ga0157375_10005345 Ga0157375_100053453 287
578 3300013308 Ga0157375_10069609 Ga0157375_100696092 287
579 3300014325 Ga0163163_10296297 Ga0163163_102962973 287
580 3300014326 Ga0157380_10006323 Ga0157380_100063235 287
581 3300014968 Ga0157379_10003479 Ga0157379_1000347914 287
582 3300014969 Ga0157376_10023415 Ga0157376_100234156 287
583 3300017792 Ga0163161_10009633 Ga0163161_100096334 287
584 3300017792 Ga0163161_10025036 Ga0163161_100250363 287
585 3300020082 Ga0206353_11878195 Ga0206353_118781951 287
586 3300025321 Ga0207656_10003851 Ga0207656_100038516 287
587 3300025893 Ga0207682_10013701 Ga0207682_100137013 287
588 3300025899 Ga0207642_10009093 Ga0207642_100090932 287
589 3300025903 Ga0207680_10109929 Ga0207680_101099293 287
590 3300025917 Ga0207660_10025648 Ga0207660_100256486 287
591 3300025918 Ga0207662_10020118 Ga0207662_100201185 287
592 3300025920 Ga0207649_10159182 Ga0207649_101591822 287
593 3300025921 Ga0207652_10008831 Ga0207652_100088317 287
594 3300025923 Ga0207681_10001432 Ga0207681_100014328 287
595 3300025924 Ga0207694_10356368 Ga0207694_103563682 287
596 3300025925 Ga0207650_10003009 Ga0207650_100030093 287
597 3300025925 Ga0207650_10013330 Ga0207650_100133306 287
598 3300025926 Ga0207659_10019588 Ga0207659_100195883 287
599 3300025926 Ga0207659_10039814 Ga0207659_100398144 287
600 3300025931 Ga0207644_10126323 Ga0207644_101263232 287
601 3300025932 Ga0207690_10267286 Ga0207690_102672862 287
602 3300025933 Ga0207706_10002925 Ga0207706_1000292513 287
603 3300025933 Ga0207706_10100784 Ga0207706_101007843 287
604 3300025933 Ga0207706_10227080 Ga0207706_102270802 287
605 3300025935 Ga0207709_10170600 Ga0207709_101706003 287
606 3300025937 Ga0207669_10001953 Ga0207669_1000195310 287
607 3300025938 Ga0207704_10157907 Ga0207704_101579073 287
608 3300025940 Ga0207691_10003672 Ga0207691_1000367212 287
609 3300025940 Ga0207691_10007054 Ga0207691_100070548 287
610 3300025940 Ga0207691_10095462 Ga0207691_100954623 287
611 3300025940 Ga0207691_10170069 Ga0207691_101700691 287
612 3300025940 Ga0207691_10182758 Ga0207691_101827583 287
613 3300025941 Ga0207711_10009412 Ga0207711_100094129 287
614 3300025941 Ga0207711_10033637 Ga0207711_100336375 287
615 3300025941 Ga0207711_10079455 Ga0207711_100794552 287
616 3300025941 Ga0207711_10132439 Ga0207711_101324392 287
617 3300025942 Ga0207689_10001138 Ga0207689_1000113815 287
618 3300025942 Ga0207689_10013440 Ga0207689_100134408 287
619 3300025944 Ga0207661_10102125 Ga0207661_101021252 287
620 3300025944 Ga0207661_10133640 Ga0207661_101336403 287
621 3300025945 Ga0207679_10016675 Ga0207679_100166753 287
622 3300025949 Ga0207667_10018841 Ga0207667_100188418 287
623 3300025960 Ga0207651_10034820 Ga0207651_100348202 287
624 3300025960 Ga0207651_10451241 Ga0207651_104512412 287
625 3300025961 Ga0207712_10020151 Ga0207712_100201513 287
626 3300025972 Ga0207668_10152178 Ga0207668_101521783 287
627 3300025981 Ga0207640_10379215 Ga0207640_103792152 287
628 3300025986 Ga0207658_10007334 Ga0207658_100073345 287
629 3300025986 Ga0207658_10106977 Ga0207658_101069773 287
630 3300026023 Ga0207677_10084498 Ga0207677_100844984 287
631 3300026023 Ga0207677_10131825 Ga0207677_101318253 287
632 3300026035 Ga0207703_10009043 Ga0207703_1000904310 287
633 3300026035 Ga0207703_10026809 Ga0207703_100268095 287
634 3300026041 Ga0207639_10015322 Ga0207639_100153227 287
635 3300026067 Ga0207678_10021701 Ga0207678_100217014 287
636 3300026075 Ga0207708_10117053 Ga0207708_101170532 287
637 3300026088 Ga0207641_10003042 Ga0207641_1000304213 287
638 3300026088 Ga0207641_10016486 Ga0207641_100164866 287
639 3300026089 Ga0207648_10026116 Ga0207648_100261162 287
640 3300026095 Ga0207676_10037501 Ga0207676_100375012 287
641 3300026095 Ga0207676_10063117 Ga0207676_100631173 287
642 3300026095 Ga0207676_10465127 Ga0207676_104651271 287
643 3300026116 Ga0207674_10065213 Ga0207674_100652132 287
644 3300026118 Ga0207675_100002557 Ga0207675_1000025578 287
645 3300026118 Ga0207675_100012087 Ga0207675_1000120874 287
646 3300026121 Ga0207683_10055802 Ga0207683_100558024 287
647 3300026121 Ga0207683_10307523 Ga0207683_103075232 287
648 3300026142 Ga0207698_10004407 Ga0207698_100044077 287
649 3300026142 Ga0207698_10008959 Ga0207698_100089594 287
650 3300026142 Ga0207698_10092623 Ga0207698_100926232 287
651 3300026142 Ga0207698_10647761 Ga0207698_106477612 287
652 3300028380 Ga0268265_10009051 Ga0268265_100090515 287
653 3300031852 Ga0307410_10378109 Ga0307410_103781091 287
654 3300032002 Ga0307416_100356078 Ga0307416_1003560781 287
655 3300032126 Ga0307415_100032311 Ga0307415_1000323112 287
656 3300035410 Ga0373924_0145528 Ga0373924_0145528_28_1002 287
657 3300035691 Ga0373931_0004344 Ga0373931_0004344_4418_5308 287
658 3300035724 Ga0373933_0145398 Ga0373933_0145398_417_1391 287
659 3300036401 Ga0373937_0108263 Ga0373937_0108263_275_1165 287
660 3300037068 Ga0373925_0024575 Ga0373925_0024575_79_969 287
661 3300037068 Ga0373925_0107796 Ga0373925_0107796_386_1360 287
662 3300039437 Ga0436365_1295259 Ga0436365_1295259_7305_8195 287
663 3300041512 Ga0451853_0888552 Ga0451853_0888552_149_1039 287
664 3300045051 Ga0451576_0126117 Ga0451576_0126117_1263_2153 287
665 3300046472 Ga0495580_0077961 Ga0495580_0077961_1196_2086 287
666 3300046516 Ga0495628_0224975 Ga0495628_0224975_57_1031 287
667 3300046681 Ga0495647_0009287 Ga0495647_0009287_2309_3283 287
668 3300046683 Ga0495658_0033364 Ga0495658_0033364_799_1689 287
669 3300048904 Ga0496101_0051814 Ga0496101_0051814_1396_2286 287
670 3300048906 Ga0496103_0098087 Ga0496103_0098087_631_1521 287
671 3300048907 Ga0496104_0018943 Ga0496104_0018943_4524_5414 287
672 3300048909 Ga0496106_0306686 Ga0496106_0306686_94_984 287
673 3300048910 Ga0496107_0211422 Ga0496107_0211422_335_1225 287
674 3300048911 Ga0496108_0009600 Ga0496108_0009600_5537_6427 287
675 3300048912 Ga0496109_0043536 Ga0496109_0043536_2826_3716 287
676 3300048913 Ga0496110_0200555 Ga0496110_0200555_759_1649 287
677 3300048914 Ga0496111_0013244 Ga0496111_0013244_308_1198 287
678 3300048915 Ga0496112_0220849 Ga0496112_0220849_293_1183 287
679 3300048916 Ga0496113_0126219 Ga0496113_0126219_406_1296 287
680 3300048918 Ga0496115_0148915 Ga0496115_0148915_729_1619 287
681 3300053077 Ga0495601_0235306 Ga0495601_0235306_288_1178 287
682 3300053084 Ga0495595_0083762 Ga0495595_0083762_358_1332 287
683 3300053085 Ga0495619_0276097 Ga0495619_0276097_230_1117 287
684 3300005618 Ga0068864_100018209 Ga0068864_1000182095 288
685 3300005841 Ga0068863_100582935 Ga0068863_1005829351 288
686 3300009177 Ga0105248_10112249 Ga0105248_101122494 288
687 3300026088 Ga0207641_10568486 Ga0207641_105684861 288
688 3300026095 Ga0207676_10019987 Ga0207676_100199872 288
689 3300031548 Ga0307408_100220807 Ga0307408_1002208072 288
690 3300045051 Ga0451576_0170695 Ga0451576_0170695_1046_1948 288
691 3300048911 Ga0496108_0150854 Ga0496108_0150854_909_1829 288
692 3300048915 Ga0496112_0109655 Ga0496112_0109655_1605_2525 288
693 iso_pu_bacteria 2904541872 2904549131 288
694 3300005334 Ga0068869_100186912 Ga0068869_1001869122 290
695 3300005456 Ga0070678_100150380 Ga0070678_1001503803 290
696 3300005548 Ga0070665_100432345 Ga0070665_1004323451 290
697 3300026121 Ga0207683_10312163 Ga0207683_103121632 290
698 3300046530 Ga0495654_0005635 Ga0495654_0005635_5137_6057 291
699 3300005459 Ga0068867_100142473 Ga0068867_1001424731 292
700 iso_pu_bacteria 2808606384 2808968388 298
701 iso_pu_bacteria 2808606390 2809003219 298
702 iso_pu_bacteria 2808606391 2809010496 298
703 iso_pu_bacteria 2519103095 2519459931 304
704 iso_pu_bacteria 2582581311 2585290557 304
705 iso_pu_bacteria 2599185239 2599740156 304
706 iso_pu_bacteria 2599185240 2599744175 304
707 iso_pu_bacteria 2599185355 2600206212 304
708 iso_pu_bacteria 2675903129 2676743474 304
709 iso_pu_bacteria 2816332253 2817262212 304
710 iso_pu_bacteria 2816332256 2817279930 304
711 iso_pu_bacteria 2816332286 2817455482 304
712 iso_pu_bacteria 2818991452 2819633617 304
713 iso_pu_bacteria 2863421361 2863427222 304
714 iso_pu_bacteria 2870068957 2870070019 304
715 iso_pu_bacteria 2904564687 2904567750 304
716 iso_pu_bacteria 2904571731 2904574848 304
717 iso_pu_bacteria 2928157003 2928161954 304
718 iso_pu_bacteria 2928163908 2928169214 304
719 iso_pu_bacteria 2928170801 2928178634 304
720 iso_pu_bacteria 2928536128 2928539061 304
721 iso_pu_bacteria 2981990288 2981992876 304
722 iso_pu_bacteria 641736154 642420682 304
723 iso_pu_bacteria 8018845410 8018846348 304
724 iso_pu_bacteria 8020807995 8020814181 304
725 iso_pu_bacteria 8020938398 8020939936 304
726 iso_pu_bacteria 8020945358 8020951566 304
727 iso_pu_bacteria 8020953355 8020954785 304
728 iso_pu_bacteria 8021120328 8021128284 304
729 iso_pu_bacteria 8039098773 8039104592 304
730 iso_pu_bacteria 8040167225 8040170183 304
731 iso_pu_bacteria 8040173305 8040174055 304
732 3300001979 JGI24740J21852_10011450 JGI24740J21852_100114503 308
733 3300001989 JGI24739J22299_10020291 JGI24739J22299_100202912 308
734 3300003758 Ga0055532_1002575 Ga0055532_10025755 308
735 3300003758 Ga0055532_1005497 Ga0055532_10054972 308
736 3300003760 Ga0055527_1001292 Ga0055527_10012925 308
737 3300003761 Ga0055535_1002850 Ga0055535_10028505 308
738 3300003762 Ga0055542_1004152 Ga0055542_10041522 308
739 3300005339 Ga0070660_100000001 Ga0070660_100000001103 308
740 3300005366 Ga0070659_100000189 Ga0070659_10000018932 308
741 3300005455 Ga0070663_100012207 Ga0070663_1000122076 308
742 3300005563 Ga0068855_100221846 Ga0068855_1002218463 308
743 3300005564 Ga0070664_100077229 Ga0070664_1000772292 308
744 3300005616 Ga0068852_100011335 Ga0068852_1000113354 308
745 3300005842 Ga0068858_100093635 Ga0068858_1000936352 308
746 3300009092 Ga0105250_10003919 Ga0105250_100039197 308
747 3300009093 Ga0105240_10016993 Ga0105240_100169939 308
748 3300009093 Ga0105240_10068369 Ga0105240_100683692 308
749 3300009545 Ga0105237_10074686 Ga0105237_100746863 308
750 3300009551 Ga0105238_10006005 Ga0105238_1000600510 308
751 3300010375 Ga0105239_10005722 Ga0105239_1000572211 308
752 3300013307 Ga0157372_10948110 Ga0157372_109481101 308
753 3300015262 Ga0182007_10086821 Ga0182007_100868211 308
754 3300025225 Ga0209566_100878 Ga0209566_1008786 308
755 3300025226 Ga0209674_104904 Ga0209674_1049042 308
756 3300025228 Ga0209672_100041 Ga0209672_1000415 308
757 3300025229 Ga0209147_102422 Ga0209147_1024226 308
758 3300025242 Ga0209258_100822 Ga0209258_10082216 308
759 3300025254 Ga0209148_1001387 Ga0209148_10013875 308
760 3300025904 Ga0207647_10012826 Ga0207647_100128263 308
761 3300025913 Ga0207695_10001714 Ga0207695_1000171431 308
762 3300025913 Ga0207695_10030498 Ga0207695_100304985 308
763 3300025919 Ga0207657_10000022 Ga0207657_1000002290 308
764 3300025924 Ga0207694_10002756 Ga0207694_1000275611 308
765 3300025932 Ga0207690_10000010 Ga0207690_10000010221 308
766 3300025945 Ga0207679_10143970 Ga0207679_101439702 308
767 3300025949 Ga0207667_10328645 Ga0207667_103286452 308
768 3300026035 Ga0207703_10072967 Ga0207703_100729672 308
769 3300026041 Ga0207639_10033735 Ga0207639_100337352 308
770 3300026067 Ga0207678_10000013 Ga0207678_10000013102 308
771 3300026142 Ga0207698_10004420 Ga0207698_100044206 308
772 3300039437 Ga0436365_0972532 Ga0436365_0972532_840_1766 308

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01063

Aminotran_4

Amino-transferase class IV

64

290

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tm5-assembly1.cif.gz_A-2 x-ray crystal structure of a d-amino acid aminotransferase from burkholderia thailandensis e264 bound to the co-factor pyridoxal phosphate 0.9926 7 298
4m0j-assembly1.cif.gz_B crystal structure of a d-amino acid aminotransferase from burkholderia thailandensis e264 0.9853 7 298
4tm5-assembly1.cif.gz_A-2 x-ray crystal structure of a d-amino acid aminotransferase from burkholderia thailandensis e264 bound to the co-factor pyridoxal phosphate 0.976 7 298
4m0j-assembly1.cif.gz_B crystal structure of a d-amino acid aminotransferase from burkholderia thailandensis e264 0.9749 7 298
4m0j-assembly1.cif.gz_A crystal structure of a d-amino acid aminotransferase from burkholderia thailandensis e264 0.9713 7 298
ID Description Score Start End Superfamily
4pbcA01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9996 7 136 3.30.470.10
4pbcA01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.992 7 136 3.30.470.10
4m0jB02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9872 137 298 3.20.10.10
4pbcB02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9857 167 305 3.20.10.10
4m0jB02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9741 137 298 3.20.10.10
ID Description Score Start End GO Terms
AF-A0A660NIT6-F1-model_v4 D-amino acid aminotransferase 0.999 164 301 GO:0005829
GO:0008483
GO:0046394
AF-A0A1J5BHS3-F1-model_v4 D-amino acid aminotransferase 0.9936 104 296 GO:0005829
GO:0008483
GO:0046394
AF-A0A4Y1Z9P1-F1-model_v4 D-alanine aminotransferase (EC 2.6.1.21) 0.9905 152 297 GO:0005829
GO:0046394
GO:0047810
AF-A0A534E1N1-F1-model_v4 D-amino acid aminotransferase 0.9878 111 272 GO:0005829
GO:0008483
GO:0046394
AF-A0A1B4JSP2-F1-model_v4 deleted 0.9848 1 301

Feature Viewer

pLDDT pTM Quality
93.83 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map