F480127

General Info

Members Datasets Scaffolds Average Seq Length
772 421 1544 252

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0189792|Ga0466966_0189792_329_1198
Length 289
Sequence MVLSKLAPHAYNQALVLRGRSAAFDRMALMSHINLMYSASGLGVGFLVGLTGVGGGSLMTPLLVLLFGVHPTTAVGTDLLYAAVTKAAGTLVHGMKGSIDWRVTGRLACGSVPAAAVTLWLLQRYGMHSQATTSVIQHVLGVALLITSISLVFRPKLAALATRMPRQAGPGHTIVLTIATGAVLGALVSLTSVGAGAIGVTVLLLLYPALAIPRIVGSDIAHAVPLTLVAGMGHWLLGSVDVAMLLSLLIGSLPGIVLGSHLSARAPEAVLRNLLAAVLVLVGARLVWA

Samples

Sample ID Description Type Environment
1 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
13 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
120 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
121 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
122 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
130 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
131 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
181 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
189 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
198 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
199 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
200 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
201 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
202 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
203 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
204 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
207 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
210 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
211 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
212 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
215 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
219 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
220 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
221 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
222 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
223 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
224 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
225 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
226 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
227 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
228 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
231 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
232 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
233 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
236 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
237 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
238 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
239 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
242 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
243 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
244 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
245 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
246 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
247 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
248 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
249 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
250 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
251 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
252 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
253 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
254 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
255 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
256 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
257 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
258 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
259 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
260 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
261 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
262 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
263 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
264 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
265 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
266 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
267 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
268 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
269 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
270 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
271 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
272 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
273 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
274 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
275 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
276 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
277 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
278 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
279 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
280 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
281 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
282 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
283 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
284 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
285 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
290 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
291 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
292 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
296 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
297 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
298 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
299 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
300 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
301 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
302 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
303 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
304 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
305 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
306 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
307 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
308 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
309 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
310 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
325 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
326 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
327 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
328 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
329 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
330 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
331 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
332 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
333 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
334 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
335 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
336 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
337 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
338 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
339 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
340 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
341 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
342 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
345 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
346 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
349 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
350 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
351 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
352 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
353 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
354 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
355 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
356 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
357 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
358 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
359 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
360 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
361 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
362 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
363 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
364 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
365 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
366 2519103095 Burkholderia sp. KJ006 Isolate Nodule
367 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
368 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
369 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
370 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
371 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
372 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
373 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
374 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
375 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
376 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
377 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
378 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
379 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
380 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
381 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
382 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
383 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
384 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
385 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
386 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
387 2818991450 Burkholderia sp. 604 Isolate Unclassified
388 2818991452 Burkholderia cepacia 561 Isolate Unclassified
389 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
390 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
391 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
392 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
393 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
394 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
395 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
396 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
397 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
398 2904564687 Burkholderia sp. 571 Isolate Unclassified
399 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
400 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
401 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
402 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
403 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
404 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
405 2928163908 Burkholderia sp. 567 Isolate Unclassified
406 2928170801 Burkholderia sp. 572 Isolate Unclassified
407 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
408 2928536128 Burkholderia sola 565 Isolate Unclassified
409 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
410 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
411 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
412 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
413 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
414 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
415 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
416 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
417 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
418 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
419 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
420 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
421 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.45
Metatranscriptomes 0.39
Isolates 8.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.66
Nodule 1.3
Rhizoplane 6.35
Rhizosphere 79.15
Stem 0
Stem Tuber 0
Unclassified 1.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466966_0189792 3300044684 Bacteria 1245
2 JGI24736J21556_1001619 3300001904 Bacteria 4084
3 JGI24741J21665_1000001 3300001915 Bacteria 68427
4 JGI24740J21852_10001522 3300001979 Bacteria 10655
5 JGI24739J22299_10000851 3300001989 Bacteria 11234
6 JGI24737J22298_10000719 3300001990 Bacteria 11649
7 JGI24735J21928_10005935 3300002067 Bacteria 4034
8 JGI24738J21930_10000353 3300002075 Bacteria 12719
9 JGI24738J21930_10005832 3300002075 Bacteria 2926
10 JGI24738J21930_10013660 3300002075 Bacteria 1752
11 JGI24738J21930_10016440 3300002075 Bacteria 1563
12 JGI25156J39149_1005205 3300002705 Bacteria 3808
13 JGI25165J46597_1003179 3300003214 Bacteria 4325
14 Ga0055533_1000126 3300003756 Bacteria 86699
15 Ga0055532_1000001 3300003758 Bacteria 1119836
16 Ga0055532_1001081 3300003758 Bacteria 8415
17 Ga0055532_1001497 3300003758 Bacteria 6444
18 Ga0055527_1000014 3300003760 Bacteria 289449
19 Ga0055527_1001041 3300003760 Bacteria 6612
20 Ga0055527_1001260 3300003760 Bacteria 5566
21 Ga0055535_1000001 3300003761 Bacteria 1119836
22 Ga0055535_1002088 3300003761 Bacteria 7956
23 Ga0055535_1002386 3300003761 Bacteria 6702
24 Ga0055542_1000001 3300003762 Bacteria 1119836
25 Ga0055542_1001974 3300003762 Bacteria 7956
26 Ga0055542_1004727 3300003762 Bacteria 3216
27 Ga0055529_1000001 3300003763 Bacteria 826680
28 Ga0055529_1000855 3300003763 Bacteria 17669
29 Ga0055528_1009368 3300003790 Bacteria 4096
30 Ga0058692_1012896 3300003856 Bacteria 1963
31 Ga0065704_10001961 3300005289 Bacteria 10690
32 Ga0065704_10003935 3300005289 Bacteria 8288
33 Ga0070658_10390002 3300005327 Bacteria 1195
34 Ga0070676_10060860 3300005328 Bacteria 2243
35 Ga0070676_10128735 3300005328 Unclassified 1598
36 Ga0070683_100004018 3300005329 Bacteria 12044
37 Ga0070690_100000711 3300005330 Bacteria 17097
38 Ga0070690_100230655 3300005330 Bacteria 1302
39 Ga0068869_100530513 3300005334 Bacteria 986
40 Ga0070666_10002619 3300005335 Bacteria 10869
41 Ga0070680_100004920 3300005336 Bacteria 10056
42 Ga0070682_100006499 3300005337 Bacteria 6567
43 Ga0070682_100008725 3300005337 Bacteria 5718
44 Ga0068868_100030963 3300005338 Bacteria 4106
45 Ga0070660_100000008 3300005339 Bacteria 155650
46 Ga0070660_100014500 3300005339 Bacteria 5679
47 Ga0070660_100024729 3300005339 Bacteria 4458
48 Ga0070660_100199907 3300005339 Bacteria 1621
49 Ga0070689_100008324 3300005340 Bacteria 7301
50 Ga0070691_10000261 3300005341 Bacteria 18280
51 Ga0070691_10081220 3300005341 Bacteria 1588
52 Ga0070661_100001075 3300005344 Bacteria 19337
53 Ga0070661_100106145 3300005344 Bacteria 2094
54 Ga0070661_100253700 3300005344 Bacteria 1358
55 Ga0070668_100004917 3300005347 Bacteria 9902
56 Ga0070668_100066673 3300005347 Bacteria 2794
57 Ga0070669_100001535 3300005353 Bacteria 16686
58 Ga0070675_100002766 3300005354 Bacteria 13188
59 Ga0070671_100001728 3300005355 Bacteria 16594
60 Ga0070674_100003316 3300005356 Bacteria 9013
61 Ga0070674_100106253 3300005356 Bacteria 2054
62 Ga0070688_100000482 3300005365 Bacteria 20225
63 Ga0070659_100000087 3300005366 Bacteria 69724
64 Ga0070659_100002108 3300005366 Bacteria 14176
65 Ga0070659_100006403 3300005366 Bacteria 8501
66 Ga0070659_100008653 3300005366 Bacteria 7445
67 Ga0070659_100010648 3300005366 Bacteria 6772
68 Ga0070667_100008966 3300005367 Bacteria 8280
69 Ga0070667_100061611 3300005367 Bacteria 3177
70 Ga0070667_100123053 3300005367 Bacteria 2258
71 Ga0070709_10004470 3300005434 Bacteria 7542
72 Ga0070701_10023156 3300005438 Bacteria 2987
73 Ga0070711_100001125 3300005439 Bacteria 14288
74 Ga0070700_100121479 3300005441 Bacteria 1751
75 Ga0070700_100691787 3300005441 Bacteria 810
76 Ga0070694_100003547 3300005444 Bacteria 9330
77 Ga0070694_100123465 3300005444 Bacteria 1861
78 Ga0070663_100001008 3300005455 Bacteria 15350
79 Ga0070663_100007773 3300005455 Bacteria 6550
80 Ga0070663_100025549 3300005455 Bacteria 3989
81 Ga0070663_100116313 3300005455 Bacteria 2015
82 Ga0070663_100158981 3300005455 Bacteria 1738
83 Ga0070663_100207983 3300005455 Bacteria 1531
84 Ga0070678_100001148 3300005456 Bacteria 13994
85 Ga0070678_100112098 3300005456 Bacteria 2135
86 Ga0070681_10001288 3300005458 Bacteria 21876
87 Ga0070681_10067699 3300005458 Bacteria 3539
88 Ga0068867_100052362 3300005459 Bacteria 3012
89 Ga0070699_100195435 3300005518 Bacteria 1798
90 Ga0070679_100020073 3300005530 Bacteria 6513
91 Ga0070684_100007351 3300005535 Bacteria 8561
92 Ga0070697_100001668 3300005536 Bacteria 16946
93 Ga0068853_100003078 3300005539 Bacteria 12743
94 Ga0068853_100438771 3300005539 Bacteria 1227
95 Ga0070672_100001558 3300005543 Bacteria 14199
96 Ga0070686_100050346 3300005544 Bacteria 2647
97 Ga0070695_100000585 3300005545 Bacteria 19232
98 Ga0070695_100129182 3300005545 Bacteria 1740
99 Ga0070696_100007146 3300005546 Bacteria 7455
100 Ga0070696_100026406 3300005546 Bacteria 3951
101 Ga0070693_100014809 3300005547 Bacteria 4006
102 Ga0070665_100007746 3300005548 Bacteria 10902
103 Ga0070665_100028448 3300005548 Bacteria 5628
104 Ga0070704_100001906 3300005549 Bacteria 11514
105 Ga0070704_100186281 3300005549 Bacteria 1664
106 Ga0070704_100202901 3300005549 Bacteria 1602
107 Ga0068855_100020362 3300005563 Bacteria 7957
108 Ga0068855_100032937 3300005563 Bacteria 6186
109 Ga0068855_100075405 3300005563 Bacteria 3916
110 Ga0070664_100001931 3300005564 Bacteria 16658
111 Ga0070664_100028935 3300005564 Bacteria 4615
112 Ga0070664_100567261 3300005564 Bacteria 1051
113 Ga0068857_100006541 3300005577 Bacteria 10000
114 Ga0068857_100022981 3300005577 Bacteria 5484
115 Ga0068854_100000710 3300005578 Bacteria 19714
116 Ga0068856_100072555 3300005614 Bacteria 3408
117 Ga0070702_100036734 3300005615 Bacteria 2716
118 Ga0068852_100001287 3300005616 Bacteria 16743
119 Ga0068852_100033433 3300005616 Bacteria 4269
120 Ga0068852_100334464 3300005616 Bacteria 1474
121 Ga0068859_100159156 3300005617 Bacteria 2337
122 Ga0068864_100001896 3300005618 Bacteria 17160
123 Ga0068861_100000060 3300005719 Bacteria 51677
124 Ga0068861_100001108 3300005719 Bacteria 16695
125 Ga0068861_100382832 3300005719 Bacteria 1243
126 Ga0068870_10071372 3300005840 Bacteria 1895
127 Ga0068863_100011149 3300005841 Bacteria 8712
128 Ga0068858_100008947 3300005842 Bacteria 9597
129 Ga0068858_100038022 3300005842 Bacteria 4463
130 Ga0068858_100039232 3300005842 Bacteria 4393
131 Ga0068858_100405364 3300005842 Bacteria 1310
132 Ga0068860_100002998 3300005843 Bacteria 17444
133 Ga0068862_100171363 3300005844 Bacteria 1943
134 Ga0081455_10027622 3300005937 Bacteria 5199
135 Ga0070715_10021590 3300006163 Bacteria 2499
136 Ga0070716_100028158 3300006173 Bacteria 3025
137 Ga0070712_100001037 3300006175 Bacteria 16760
138 Ga0070712_100076006 3300006175 Bacteria 2417
139 Ga0097621_100040402 3300006237 Bacteria 3751
140 Ga0068871_100372447 3300006358 Bacteria 1267
141 Ga0075433_10187968 3300006852 Bacteria 1837
142 Ga0068865_100073849 3300006881 Bacteria 2427
143 Ga0068865_100275410 3300006881 Bacteria 1338
144 Ga0097620_100159150 3300006931 Bacteria 2337
145 Ga0079104_1012574 3300006946 Bacteria 2651
146 Ga0105251_10000947 3300009011 Bacteria 25899
147 Ga0105251_10012849 3300009011 Bacteria 4714
148 Ga0105251_10072915 3300009011 Bacteria 1596
149 Ga0105240_10004113 3300009093 Bacteria 22329
150 Ga0105240_10240361 3300009093 Bacteria 2100
151 Ga0111539_10352576 3300009094 Bacteria 1712
152 Ga0105245_10001169 3300009098 Bacteria 23748
153 Ga0105245_10083135 3300009098 Bacteria 2930
154 Ga0105245_10212439 3300009098 Bacteria 1863
155 Ga0114129_10336979 3300009147 Bacteria 2001
156 Ga0105243_10056734 3300009148 Bacteria 3116
157 Ga0105243_10161850 3300009148 Bacteria 1930
158 Ga0105243_10162840 3300009148 Bacteria 1925
159 Ga0105243_10230213 3300009148 Bacteria 1644
160 Ga0105241_10006190 3300009174 Bacteria 8828
161 Ga0105241_10181418 3300009174 Bacteria 1747
162 Ga0105248_10002101 3300009177 Bacteria 22070
163 Ga0105237_10007626 3300009545 Bacteria 11828
164 Ga0105237_10015961 3300009545 Bacteria 7808
165 Ga0105237_10041721 3300009545 Bacteria 4627
166 Ga0105237_10764439 3300009545 Bacteria 973
167 Ga0105238_10010909 3300009551 Bacteria 9134
168 Ga0105238_10212788 3300009551 Bacteria 1909
169 Ga0105238_10226329 3300009551 Bacteria 1847
170 Ga0105238_10273247 3300009551 Bacteria 1670
171 Ga0105249_10036973 3300009553 Bacteria 4430
172 Ga0105249_10062078 3300009553 Bacteria 3430
173 Ga0105249_10184122 3300009553 Bacteria 2034
174 Ga0105249_10385661 3300009553 Bacteria 1428
175 Ga0105148_100146 3300009978 Bacteria 10542
176 Ga0105239_10035506 3300010375 Bacteria 5474
177 Ga0105239_10335491 3300010375 Bacteria 1706
178 Ga0105246_10235580 3300011119 Bacteria 1444
179 Ga0157373_10045347 3300013100 Bacteria 3138
180 Ga0157373_10238121 3300013100 Bacteria 1286
181 Ga0157370_10079333 3300013104 Bacteria 3091
182 Ga0157370_10096868 3300013104 Bacteria 2767
183 Ga0157369_10000138 3300013105 Bacteria 102776
184 Ga0157369_10101799 3300013105 Bacteria 3061
185 Ga0157369_10187251 3300013105 Bacteria 2176
186 Ga0157369_10235257 3300013105 Bacteria 1914
187 Ga0157374_10016966 3300013296 Bacteria 6410
188 Ga0157378_10038242 3300013297 Bacteria 4251
189 Ga0163162_10186856 3300013306 Bacteria 2199
190 Ga0163162_10224430 3300013306 Bacteria 2008
191 Ga0157372_10012193 3300013307 Bacteria 9155
192 Ga0157372_10034184 3300013307 Bacteria 5588
193 Ga0157372_10061123 3300013307 Bacteria 4217
194 Ga0157372_10182913 3300013307 Bacteria 2426
195 Ga0157372_10326750 3300013307 Bacteria 1786
196 Ga0157372_10942987 3300013307 Bacteria 1000
197 Ga0157375_10003280 3300013308 Bacteria 14031
198 Ga0157375_10062294 3300013308 Bacteria 3706
199 Ga0157375_10127702 3300013308 Unclassified 2659
200 Ga0163163_10073399 3300014325 Bacteria 3412
201 Ga0157380_10001936 3300014326 Bacteria 13761
202 Ga0157377_10010742 3300014745 Bacteria 4542
203 Ga0157379_10326365 3300014968 Bacteria 1402
204 Ga0157376_10004614 3300014969 Bacteria 9595
205 Ga0182007_10000155 3300015262 Bacteria 46603
206 Ga0182007_10022765 3300015262 Bacteria 2209
207 Ga0182005_1048540 3300015265 Bacteria 1153
208 Ga0163161_10001240 3300017792 Bacteria 19106
209 Ga0163161_10002898 3300017792 Bacteria 12137
210 Ga0163161_10046884 3300017792 Bacteria 3119
211 Ga0206356_10075526 3300020070 Bacteria 3105
212 Ga0206353_10003921 3300020082 Bacteria 2737
213 Ga0213872_10002394 3300021361 Bacteria 11079
214 Ga0213874_10016789 3300021377 Bacteria 1954
215 Ga0213871_10081483 3300021441 Bacteria 927
216 Ga0224712_10000194 3300022467 Bacteria 10810
217 Ga0209566_103618 3300025225 Bacteria 2305
218 Ga0209674_100005 3300025226 Bacteria 1708125
219 Ga0209674_100092 3300025226 Bacteria 172272
220 Ga0209672_100001 3300025228 Bacteria 2828210
221 Ga0209672_100038 3300025228 Bacteria 286731
222 Ga0209147_100001 3300025229 Bacteria 2384371
223 Ga0209147_100112 3300025229 Bacteria 145046
224 Ga0209258_100001 3300025242 Bacteria 2384269
225 Ga0209258_100109 3300025242 Bacteria 203881
226 Ga0209148_1000003 3300025254 Bacteria 2384288
227 Ga0209148_1001747 3300025254 Bacteria 9423
228 Ga0209759_1000053 3300025256 Bacteria 212789
229 Ga0209759_1000120 3300025256 Bacteria 138967
230 Ga0209759_1000172 3300025256 Bacteria 107949
231 Ga0209233_1000016 3300025261 Bacteria 907830
232 Ga0209455_1000001 3300025272 Bacteria 2384278
233 Ga0207656_10030365 3300025321 Bacteria 2232
234 Ga0207656_10190313 3300025321 Bacteria 988
235 Ga0207713_1000855 3300025735 Bacteria 27925
236 Ga0207713_1029090 3300025735 Bacteria 2481
237 Ga0207642_10006996 3300025899 Bacteria 3783
238 Ga0207710_10003550 3300025900 Bacteria 6930
239 Ga0207688_10002808 3300025901 Bacteria 9455
240 Ga0207647_10020602 3300025904 Bacteria 4419
241 Ga0207647_10022613 3300025904 Bacteria 4173
242 Ga0207647_10023177 3300025904 Bacteria 4111
243 Ga0207647_10031545 3300025904 Bacteria 3409
244 Ga0207645_10073196 3300025907 Bacteria 2193
245 Ga0207645_10154015 3300025907 Bacteria 1501
246 Ga0207705_10001428 3300025909 Bacteria 19037
247 Ga0207654_10009397 3300025911 Bacteria 4964
248 Ga0207654_10088850 3300025911 Bacteria 1879
249 Ga0207654_10220401 3300025911 Bacteria 1258
250 Ga0207707_10146061 3300025912 Bacteria 2067
251 Ga0207695_10015304 3300025913 Bacteria 9039
252 Ga0207695_10130858 3300025913 Bacteria 2467
253 Ga0207695_10193788 3300025913 Bacteria 1949
254 Ga0207695_10332126 3300025913 Bacteria 1409
255 Ga0207671_10014180 3300025914 Bacteria 6309
256 Ga0207671_10034018 3300025914 Bacteria 3789
257 Ga0207671_10237007 3300025914 Bacteria 1433
258 Ga0207693_10002168 3300025915 Bacteria 17110
259 Ga0207693_10026355 3300025915 Bacteria 4600
260 Ga0207663_10016827 3300025916 Bacteria 4065
261 Ga0207657_10003315 3300025919 Bacteria 17221
262 Ga0207657_10106232 3300025919 Bacteria 2323
263 Ga0207657_10503735 3300025919 Bacteria 948
264 Ga0207649_10015928 3300025920 Bacteria 4230
265 Ga0207681_10409320 3300025923 Bacteria 1097
266 Ga0207694_10209716 3300025924 Bacteria 1587
267 Ga0207694_10529731 3300025924 Bacteria 988
268 Ga0207687_10001754 3300025927 Bacteria 14917
269 Ga0207664_10442482 3300025929 Bacteria 1159
270 Ga0207690_10018989 3300025932 Bacteria 4222
271 Ga0207690_10056278 3300025932 Bacteria 2652
272 Ga0207690_10085501 3300025932 Bacteria 2214
273 Ga0207690_10313968 3300025932 Bacteria 1230
274 Ga0207706_10002755 3300025933 Bacteria 17095
275 Ga0207686_10015950 3300025934 Bacteria 4210
276 Ga0207709_10005957 3300025935 Bacteria 6874
277 Ga0207669_10002640 3300025937 Bacteria 7680
278 Ga0207669_10517619 3300025937 Bacteria 957
279 Ga0207691_10008138 3300025940 Bacteria 10066
280 Ga0207711_10039207 3300025941 Bacteria 4029
281 Ga0207711_10085132 3300025941 Bacteria 2769
282 Ga0207711_10115968 3300025941 Bacteria 2387
283 Ga0207689_10016283 3300025942 Bacteria 6298
284 Ga0207689_10096647 3300025942 Bacteria 2426
285 Ga0207679_10184285 3300025945 Bacteria 1729
286 Ga0207667_10001951 3300025949 Bacteria 25840
287 Ga0207667_10369701 3300025949 Bacteria 1461
288 Ga0207667_10610570 3300025949 Bacteria 1099
289 Ga0207651_10008567 3300025960 Bacteria 5532
290 Ga0207712_10328066 3300025961 Bacteria 1265
291 Ga0207640_10082163 3300025981 Bacteria 2205
292 Ga0207658_10216612 3300025986 Bacteria 1608
293 Ga0207658_10293893 3300025986 Bacteria 1397
294 Ga0207703_10000467 3300026035 Bacteria 42324
295 Ga0207639_10027770 3300026041 Bacteria 4126
296 Ga0207639_10053933 3300026041 Bacteria 3070
297 Ga0207639_10057513 3300026041 Bacteria 2986
298 Ga0207678_10000460 3300026067 Bacteria 36933
299 Ga0207678_10002388 3300026067 Bacteria 17042
300 Ga0207678_10036634 3300026067 Bacteria 4270
301 Ga0207678_10127103 3300026067 Bacteria 2174
302 Ga0207708_10015012 3300026075 Bacteria 5805
303 Ga0207708_10102056 3300026075 Bacteria 2221
304 Ga0207702_10018661 3300026078 Bacteria 5738
305 Ga0207702_10338262 3300026078 Bacteria 1437
306 Ga0207641_10019759 3300026088 Bacteria 5530
307 Ga0207641_10059573 3300026088 Bacteria 3251
308 Ga0207648_10030875 3300026089 Bacteria 4741
309 Ga0207648_10311445 3300026089 Bacteria 1413
310 Ga0207648_10515118 3300026089 Unclassified 1096
311 Ga0207676_10122111 3300026095 Bacteria 2199
312 Ga0207674_10009318 3300026116 Bacteria 11242
313 Ga0207674_10159353 3300026116 Bacteria 2211
314 Ga0207675_100000062 3300026118 Bacteria 80665
315 Ga0207675_100002836 3300026118 Bacteria 17054
316 Ga0207675_100102213 3300026118 Bacteria 2701
317 Ga0207675_100167650 3300026118 Bacteria 2098
318 Ga0207683_10001948 3300026121 Bacteria 18274
319 Ga0207683_10129560 3300026121 Bacteria 2268
320 Ga0207698_10010421 3300026142 Bacteria 5971
321 Ga0268265_10056896 3300028380 Bacteria 2978
322 Ga0268265_10228191 3300028380 Bacteria 1634
323 Ga0268264_10004130 3300028381 Bacteria 12423
324 Ga0265340_10040020 3300031247 Bacteria 2310
325 Ga0265339_10026820 3300031249 Bacteria 3297
326 Ga0307408_100001730 3300031548 Bacteria 15975
327 Ga0307407_10255967 3300031903 Bacteria 1202
328 Ga0307412_10000051 3300031911 Bacteria 150433
329 Ga0307412_10005643 3300031911 Bacteria 7028
330 Ga0307416_100029858 3300032002 Bacteria 4080
331 Ga0307414_10079396 3300032004 Bacteria 2395
332 Ga0307411_10078930 3300032005 Bacteria 2258
333 Ga0373939_0224754 3300035114 Unclassified 720
334 Ga0373955_0022673 3300035172 Bacteria 3188
335 Ga0373931_0115718 3300035691 Unclassified 1527
336 Ga0373935_0257969 3300035692 Bacteria 1222
337 Ga0373937_0013167 3300036401 Bacteria 7285
338 Ga0395899_0011621 3300037312 Bacteria 6739
339 Ga0395900_0000099 3300037418 Bacteria 154573
340 Ga0395900_0235760 3300037418 Bacteria 1838
341 Ga0395900_0264832 3300037418 Bacteria 1715
342 Ga0395900_0363996 3300037418 Bacteria 1417
343 Ga0395898_0053053 3300037466 Bacteria 3960
344 Ga0395898_0204763 3300037466 Bacteria 1883
345 Ga0395901_0000576 3300038443 Bacteria 42723
346 Ga0395901_0003976 3300038443 Bacteria 14870
347 Ga0395901_0071144 3300038443 Bacteria 3625
348 Ga0400484_36491 3300038725 Unclassified 1046
349 Ga0400488_04984 3300038741 Unclassified 1139
350 Ga0400483_134009 3300039062 Bacteria 204879
351 Ga0400483_277394 3300039062 Bacteria 10471
352 Ga0436360_1108419 3300039438 Bacteria 4084
353 Ga0436361_0867198 3300039447 Bacteria 16499
354 Ga0436361_1182382 3300039447 Bacteria 1275
355 Ga0436363_1496855 3300039450 Bacteria 9915
356 Ga0436362_1083763 3300039453 Bacteria 947
357 Ga0466965_0006127 3300044683 Bacteria 5438
358 Ga0466961_0025919 3300044693 Bacteria 3768
359 Ga0466971_0111112 3300044719 Bacteria 1265
360 Ga0466959_0065870 3300045049 Bacteria 2628
361 Ga0466958_0029636 3300045836 Bacteria 3247
362 Ga0466958_0045423 3300045836 Bacteria 2649
363 Ga0495592_0007576 3300046454 Bacteria 8128
364 Ga0495592_0011091 3300046454 Bacteria 6803
365 Ga0495592_0071280 3300046454 Bacteria 2529
366 Ga0495603_0016566 3300046455 Bacteria 4459
367 Ga0495603_0262876 3300046455 Bacteria 993
368 Ga0495590_0056263 3300046457 Bacteria 1374
369 Ga0495591_003620 3300046458 Bacteria 7866
370 Ga0495629_0000015 3300046459 Bacteria 182026
371 Ga0495629_0002264 3300046459 Bacteria 14835
372 Ga0495629_0017477 3300046459 Bacteria 5139
373 Ga0495638_0000014 3300046460 Bacteria 417060
374 Ga0495638_0003655 3300046460 Bacteria 11997
375 Ga0495641_0015817 3300046461 Bacteria 4001
376 Ga0495651_0026941 3300046462 Bacteria 4475
377 Ga0495651_0035436 3300046462 Bacteria 3884
378 Ga0495653_0016009 3300046463 Bacteria 6112
379 Ga0495653_0017142 3300046463 Bacteria 5891
380 Ga0495653_0018145 3300046463 Bacteria 5719
381 Ga0495653_0020908 3300046463 Bacteria 5302
382 Ga0495653_0086152 3300046463 Bacteria 2309
383 Ga0495650_0003236 3300046471 Bacteria 12076
384 Ga0495650_0011060 3300046471 Bacteria 4981
385 Ga0495580_0000106 3300046472 Bacteria 56140
386 Ga0495580_0006643 3300046472 Bacteria 9397
387 Ga0495580_0022078 3300046472 Bacteria 4690
388 Ga0495580_0025735 3300046472 Bacteria 4298
389 Ga0495580_0048876 3300046472 Bacteria 2992
390 Ga0495582_0013599 3300046473 Bacteria 4481
391 Ga0495582_0014302 3300046473 Bacteria 4364
392 Ga0495582_0023281 3300046473 Bacteria 3389
393 Ga0495605_0004203 3300046474 Bacteria 8481
394 Ga0495605_0009713 3300046474 Bacteria 5406
395 Ga0495662_0065969 3300046476 Bacteria 1750
396 Ga0495664_0027680 3300046477 Bacteria 3306
397 Ga0495664_0142553 3300046477 Bacteria 1453
398 Ga0495584_0214933 3300046491 Bacteria 977
399 Ga0495594_0158949 3300046499 Bacteria 1284
400 Ga0495596_0004954 3300046500 Bacteria 6385
401 Ga0495596_0040352 3300046500 Bacteria 1843
402 Ga0495596_0046221 3300046500 Bacteria 1710
403 Ga0495583_0000072 3300046506 Bacteria 182057
404 Ga0495583_0001695 3300046506 Bacteria 21274
405 Ga0495606_0017997 3300046507 Bacteria 5315
406 Ga0495606_0035087 3300046507 Bacteria 3433
407 Ga0495606_0043187 3300046507 Bacteria 3008
408 Ga0495608_0028118 3300046511 Bacteria 3822
409 Ga0495610_0016348 3300046512 Bacteria 4277
410 Ga0495618_0002628 3300046514 Bacteria 11491
411 Ga0495618_0045287 3300046514 Bacteria 2775
412 Ga0495620_0009172 3300046515 Bacteria 5275
413 Ga0495628_0028048 3300046516 Bacteria 4578
414 Ga0495628_0039438 3300046516 Bacteria 3778
415 Ga0495628_0043839 3300046516 Bacteria 3561
416 Ga0495628_0047665 3300046516 Bacteria 3398
417 Ga0495628_0074080 3300046516 Bacteria 2653
418 Ga0495630_0015237 3300046517 Bacteria 5608
419 Ga0495630_0038382 3300046517 Bacteria 3582
420 Ga0495630_0068770 3300046517 Bacteria 2663
421 Ga0495630_0241420 3300046517 Bacteria 1380
422 Ga0495632_0000171 3300046519 Bacteria 66639
423 Ga0495637_0129459 3300046520 Bacteria 965
424 Ga0495644_0096064 3300046523 Bacteria 1120
425 Ga0495648_0000021 3300046524 Bacteria 246945
426 Ga0495648_0022062 3300046524 Bacteria 4393
427 Ga0495648_0029553 3300046524 Bacteria 3636
428 Ga0495648_0071994 3300046524 Bacteria 2002
429 Ga0495648_0077971 3300046524 Bacteria 1896
430 Ga0495666_0001418 3300046526 Bacteria 11624
431 Ga0495666_0006152 3300046526 Bacteria 6039
432 Ga0495666_0011284 3300046526 Bacteria 4456
433 Ga0495666_0027353 3300046526 Bacteria 2807
434 Ga0495652_0017464 3300046529 Bacteria 6401
435 Ga0495652_0037945 3300046529 Bacteria 4177
436 Ga0495652_0067180 3300046529 Bacteria 3006
437 Ga0495665_0004941 3300046531 Bacteria 7184
438 Ga0495665_0028337 3300046531 Bacteria 3002
439 Ga0495665_0045453 3300046531 Bacteria 2332
440 Ga0495640_0016371 3300046533 Bacteria 5547
441 Ga0495640_0046861 3300046533 Bacteria 2993
442 Ga0495640_0055399 3300046533 Bacteria 2712
443 Ga0495586_0055531 3300046535 Bacteria 2146
444 Ga0495587_0004844 3300046536 Bacteria 8832
445 Ga0495587_0028190 3300046536 Bacteria 3416
446 Ga0495587_0040107 3300046536 Bacteria 2800
447 Ga0495609_0074383 3300046538 Bacteria 1490
448 Ga0495597_0094999 3300046542 Bacteria 1262
449 Ga0495645_0003648 3300046543 Bacteria 10458
450 Ga0495645_0031774 3300046543 Bacteria 3847
451 Ga0495622_0000486 3300046557 Bacteria 25017
452 Ga0495633_0015770 3300046558 Bacteria 3914
453 Ga0495667_0130213 3300046559 Bacteria 1623
454 Ga0495667_0322043 3300046559 Bacteria 978
455 Ga0495634_0007419 3300046642 Bacteria 8243
456 Ga0495634_0194350 3300046642 Bacteria 1263
457 Ga0495611_0007538 3300046648 Bacteria 4616
458 Ga0495635_0007045 3300046663 Bacteria 7857
459 Ga0495635_0047238 3300046663 Bacteria 2970
460 Ga0495635_0199948 3300046663 Bacteria 1355
461 Ga0495661_0011298 3300046665 Bacteria 6060
462 Ga0495661_0047657 3300046665 Bacteria 2608
463 Ga0495661_0054436 3300046665 Bacteria 2402
464 Ga0495657_0010382 3300046675 Bacteria 7011
465 Ga0495599_0061604 3300046678 Bacteria 2344
466 Ga0495599_0067781 3300046678 Bacteria 2228
467 Ga0495623_0008645 3300046679 Bacteria 6612
468 Ga0495623_0027244 3300046679 Bacteria 3675
469 Ga0495646_0018165 3300046680 Bacteria 4454
470 Ga0495646_0036834 3300046680 Bacteria 3028
471 Ga0495646_0064765 3300046680 Bacteria 2165
472 Ga0495646_0094305 3300046680 Bacteria 1723
473 Ga0495669_0026864 3300046684 Bacteria 2516
474 Ga0495613_0004833 3300046689 Bacteria 10105
475 Ga0495613_0062637 3300046689 Bacteria 2721
476 Ga0495624_0000132 3300046690 Bacteria 52886
477 Ga0495624_0000448 3300046690 Bacteria 32392
478 Ga0495624_0070238 3300046690 Bacteria 2180
479 Ga0495671_0000028 3300046692 Bacteria 234938
480 Ga0495649_0001070 3300046694 Bacteria 21370
481 Ga0495649_0058766 3300046694 Bacteria 2071
482 Ga0495649_0090023 3300046694 Bacteria 1636
483 Ga0495589_0019322 3300046794 Bacteria 3495
484 Ga0495589_0034382 3300046794 Bacteria 2545
485 Ga0495600_0015179 3300046809 Bacteria 4866
486 Ga0495600_0362205 3300046809 Bacteria 907
487 Ga0495660_0089265 3300046810 Bacteria 1605
488 Ga0495581_0003098 3300047315 Bacteria 9517
489 Ga0495604_0051274 3300047317 Bacteria 3199
490 Ga0495674_0026087 3300047319 Bacteria 5348
491 Ga0495674_0051065 3300047319 Bacteria 3646
492 Ga0495674_0062481 3300047319 Bacteria 3242
493 Ga0495674_0074683 3300047319 Bacteria 2918
494 Ga0495674_0088657 3300047319 Bacteria 2645
495 Ga0495674_0091161 3300047319 Bacteria 2603
496 Ga0495672_0013806 3300047320 Bacteria 5555
497 Ga0495676_0011631 3300047321 Bacteria 7941
498 Ga0495676_0032488 3300047321 Bacteria 4404
499 Ga0495676_0091773 3300047321 Bacteria 2268
500 Ga0495680_0117353 3300047322 Bacteria 1967
501 Ga0495680_0381770 3300047322 Bacteria 976
502 Ga0495683_0002664 3300047323 Bacteria 10649
503 Ga0495683_0009774 3300047323 Bacteria 5099
504 Ga0495683_0034003 3300047323 Bacteria 2593
505 Ga0495683_0063131 3300047323 Bacteria 1830
506 Ga0495683_0072830 3300047323 Bacteria 1685
507 Ga0495687_014958 3300047443 Bacteria 3966
508 Ga0495687_061006 3300047443 Bacteria 1553
509 Ga0495687_085296 3300047443 Bacteria 1225
510 Ga0495675_0012606 3300047444 Bacteria 5320
511 Ga0495675_0013422 3300047444 Bacteria 5171
512 Ga0495679_000045 3300047446 Bacteria 133780
513 Ga0495679_005897 3300047446 Bacteria 5370
514 Ga0495679_007344 3300047446 Bacteria 4605
515 Ga0495673_0000058 3300047469 Bacteria 235044
516 Ga0495673_0027656 3300047469 Bacteria 2695
517 Ga0495684_0060481 3300047471 Bacteria 2884
518 Ga0495684_0069574 3300047471 Bacteria 2676
519 Ga0495686_0027985 3300047472 Bacteria 3675
520 Ga0495686_0058146 3300047472 Bacteria 2411
521 Ga0495593_0002775 3300047673 Bacteria 10545
522 Ga0495593_0013630 3300047673 Bacteria 4632
523 Ga0495593_0024980 3300047673 Bacteria 3305
524 Ga0495602_0008004 3300048088 Bacteria 11050
525 Ga0495602_0013837 3300048088 Bacteria 8225
526 Ga0495602_0052971 3300048088 Bacteria 3598
527 Ga0495602_0057586 3300048088 Bacteria 3407
528 Ga0495602_0062666 3300048088 Bacteria 3225
529 Ga0495602_0135651 3300048088 Bacteria 1955
530 Ga0495602_0204768 3300048088 Bacteria 1502
531 Ga0495602_0455408 3300048088 Bacteria 902
532 Ga0495602_0508413 3300048088 Bacteria 841
533 Ga0495614_0004276 3300048089 Bacteria 6431
534 Ga0495626_0019377 3300048091 Bacteria 3405
535 Ga0495626_0020391 3300048091 Bacteria 3304
536 Ga0495626_0050524 3300048091 Bacteria 1921
537 Ga0496100_0007989 3300048903 Bacteria 5877
538 Ga0496100_0012985 3300048903 Bacteria 4792
539 Ga0496101_0025834 3300048904 Bacteria 4077
540 Ga0496101_0219429 3300048904 Unclassified 1475
541 Ga0496102_0027692 3300048905 Bacteria 5061
542 Ga0496102_0029481 3300048905 Bacteria 4909
543 Ga0496102_0287221 3300048905 Bacteria 1550
544 Ga0496102_0822420 3300048905 Bacteria 851
545 Ga0496103_0008021 3300048906 Bacteria 6269
546 Ga0496103_0019170 3300048906 Bacteria 4108
547 Ga0496103_0030602 3300048906 Bacteria 3276
548 Ga0496103_0043133 3300048906 Bacteria 2777
549 Ga0496104_0000564 3300048907 Bacteria 31627
550 Ga0496104_0031060 3300048907 Bacteria 4966
551 Ga0496104_0037907 3300048907 Bacteria 4508
552 Ga0496104_0070870 3300048907 Bacteria 3314
553 Ga0496105_0000342 3300048908 Bacteria 30591
554 Ga0496105_0006786 3300048908 Bacteria 8801
555 Ga0496105_0019248 3300048908 Bacteria 5505
556 Ga0496105_0046062 3300048908 Bacteria 3600
557 Ga0496105_0069860 3300048908 Bacteria 2903
558 Ga0496105_0082827 3300048908 Bacteria 2650
559 Ga0496105_0150984 3300048908 Bacteria 1909
560 Ga0496105_0514503 3300048908 Bacteria 938
561 Ga0496106_0000067 3300048909 Bacteria 83475
562 Ga0496106_0018704 3300048909 Bacteria 5130
563 Ga0496106_0088112 3300048909 Bacteria 2392
564 Ga0496106_0280712 3300048909 Bacteria 1334
565 Ga0496107_0026562 3300048910 Bacteria 4105
566 Ga0496108_0000875 3300048911 Bacteria 23492
567 Ga0496108_0125687 3300048911 Bacteria 2201
568 Ga0496108_0179973 3300048911 Bacteria 1831
569 Ga0496109_0011207 3300048912 Bacteria 7695
570 Ga0496109_0504322 3300048912 Bacteria 1142
571 Ga0496110_0042254 3300048913 Bacteria 3979
572 Ga0496110_0044772 3300048913 Bacteria 3865
573 Ga0496111_0087162 3300048914 Bacteria 2285
574 Ga0496112_0180533 3300048915 Bacteria 2074
575 Ga0496113_0047881 3300048916 Bacteria 3178
576 Ga0496114_0011096 3300048917 Bacteria 7192
577 Ga0496114_0097415 3300048917 Bacteria 2505
578 Ga0496114_0224173 3300048917 Bacteria 1651
579 Ga0496115_0029925 3300048918 Bacteria 4281
580 Ga0496115_0053593 3300048918 Bacteria 3237
581 Ga0496115_0075848 3300048918 Bacteria 2732
582 Ga0496115_0505577 3300048918 Bacteria 971
583 Ga0496116_0029599 3300048919 Bacteria 3945
584 Ga0496116_0046923 3300048919 Bacteria 2912
585 Ga0496116_0092510 3300048919 Bacteria 1834
586 Ga0496117_0013602 3300048920 Bacteria 7088
587 Ga0496117_0029381 3300048920 Bacteria 4240
588 Ga0496118_0000248 3300048921 Bacteria 95533
589 Ga0496118_0002597 3300048921 Bacteria 24049
590 Ga0496118_0036724 3300048921 Bacteria 3955
591 Ga0496118_0077070 3300048921 Bacteria 2366
592 Ga0496118_0135059 3300048921 Bacteria 1576
593 Ga0496121_0000454 3300048924 Bacteria 80561
594 Ga0496121_0004632 3300048924 Bacteria 18293
595 Ga0496121_0009028 3300048924 Bacteria 11552
596 Ga0496121_0032034 3300048924 Bacteria 4787
597 Ga0496122_0093525 3300048925 Bacteria 2039
598 Ga0496123_0045638 3300048926 Bacteria 2983
599 Ga0496124_0106034 3300048927 Bacteria 2269
600 Ga0496125_0024468 3300048928 Bacteria 5552
601 Ga0496125_0076136 3300048928 Bacteria 2592
602 Ga0496126_0000705 3300048929 Bacteria 61002
603 Ga0496126_0000900 3300048929 Bacteria 51728
604 Ga0496126_0030460 3300048929 Bacteria 5111
605 Ga0496126_0093505 3300048929 Bacteria 2640
606 Ga0496126_0302509 3300048929 Bacteria 1319
607 Ga0495678_006149 3300049459 Bacteria 6442
608 Ga0501031_0033181 3300049568 Bacteria 3366
609 Ga0501032_0111928 3300049569 Bacteria 1806
610 Ga0501032_0252481 3300049569 Bacteria 1145
611 Ga0501033_0330597 3300049570 Bacteria 1069
612 Ga0501034_0000208 3300049571 Bacteria 111739
613 Ga0501034_0037806 3300049571 Bacteria 4889
614 Ga0501034_0165429 3300049571 Bacteria 2181
615 Ga0501034_0403094 3300049571 Bacteria 1290
616 Ga0501034_0621808 3300049571 Bacteria 984
617 Ga0501036_0023166 3300049572 Bacteria 5228
618 Ga0501036_0043468 3300049572 Bacteria 3805
619 Ga0501036_0492685 3300049572 Bacteria 1020
620 Ga0501038_0025818 3300049574 Bacteria 5234
621 Ga0501038_0030734 3300049574 Bacteria 4749
622 Ga0501038_0284459 3300049574 Bacteria 1301
623 Ga0501038_0400245 3300049574 Bacteria 1062
624 Ga0501039_0000072 3300049575 Bacteria 76673
625 Ga0501039_0140867 3300049575 Bacteria 1894
626 Ga0501040_0039424 3300049576 Bacteria 3212
627 Ga0501040_0094023 3300049576 Bacteria 2085
628 Ga0501040_0539852 3300049576 Bacteria 841
629 Ga0501041_0025169 3300049577 Bacteria 3577
630 Ga0501041_0116385 3300049577 Bacteria 1660
631 Ga0501042_0029317 3300049578 Bacteria 3880
632 Ga0501043_0057371 3300049579 Bacteria 3058
633 Ga0501043_0105173 3300049579 Bacteria 2218
634 Ga0501043_0135565 3300049579 Bacteria 1928
635 Ga0501046_0003737 3300049580 Bacteria 13932
636 Ga0501046_0005533 3300049580 Bacteria 11283
637 Ga0501046_0029760 3300049580 Bacteria 4438
638 Ga0501046_0065067 3300049580 Bacteria 2845
639 Ga0501047_0001212 3300049581 Bacteria 25586
640 Ga0501047_0046316 3300049581 Bacteria 4203
641 Ga0501047_0145654 3300049581 Bacteria 2246
642 Ga0501048_0000149 3300049582 Bacteria 42834
643 Ga0501048_0014798 3300049582 Bacteria 5770
644 Ga0501048_0047349 3300049582 Bacteria 3068
645 Ga0501048_0060608 3300049582 Bacteria 2681
646 Ga0501067_0001102 3300049583 Bacteria 14576
647 Ga0501068_0039338 3300049584 Bacteria 2835
648 Ga0501068_0112146 3300049584 Bacteria 1696
649 Ga0501069_0067955 3300049585 Bacteria 1994
650 Ga0501070_0010407 3300049586 Bacteria 7864
651 Ga0501070_0170134 3300049586 Bacteria 1795
652 Ga0501070_0390294 3300049586 Bacteria 1127
653 Ga0501071_0025813 3300049587 Bacteria 4118
654 Ga0501072_0005196 3300049588 Bacteria 9906
655 Ga0501072_0063712 3300049588 Bacteria 2908
656 Ga0501072_0294352 3300049588 Bacteria 1290
657 Ga0501073_0006515 3300049589 Bacteria 8686
658 Ga0501073_0143975 3300049589 Bacteria 1652
659 Ga0501073_0202976 3300049589 Bacteria 1371
660 Ga0501073_0257934 3300049589 Bacteria 1203
661 Ga0501074_0043081 3300049590 Bacteria 3266
662 Ga0501075_0017136 3300049591 Bacteria 5229
663 Ga0501076_0055975 3300049592 Bacteria 3129
664 Ga0501076_0078769 3300049592 Bacteria 2644
665 Ga0501077_0033072 3300049593 Bacteria 3292
666 Ga0501077_0042910 3300049593 Bacteria 2874
667 Ga0501211_002602 3300049658 Bacteria 1901
668 Ga0501223_000021 3300049663 Bacteria 66697
669 Ga0501235_000949 3300049669 Bacteria 5976
670 Ga0501225_0000011 3300049705 Bacteria 74084
671 Ga0501079_0083539 3300049741 Bacteria 2470
672 Ga0501079_0255621 3300049741 Bacteria 1369
673 Ga0501080_0000005 3300049742 Bacteria 176271
674 Ga0501080_0090973 3300049742 Bacteria 2834
675 Ga0501080_0345368 3300049742 Bacteria 1344
676 Ga0501081_0036258 3300049743 Bacteria 3362
677 Ga0501081_0412563 3300049743 Bacteria 1000
678 Ga0501035_0000049 3300049822 Bacteria 145684
679 Ga0501035_0109005 3300049822 Bacteria 2427
680 Ga0501035_0241788 3300049822 Bacteria 1535
681 Ga0501044_0000030 3300049823 Bacteria 173442
682 Ga0501044_0063345 3300049823 Bacteria 3778
683 Ga0501044_0332736 3300049823 Bacteria 1441
684 Ga0501044_0395567 3300049823 Bacteria 1295
685 Ga0501045_0016662 3300049824 Bacteria 5220
686 Ga0501045_0042693 3300049824 Bacteria 3301
687 Ga0501045_0107598 3300049824 Bacteria 2066
688 nmdc:mga03683_93049_c1 3300050489 Bacteria 1316
689 nmdc:mga0k408_2565_c1 3300050493 Bacteria 9650
690 nmdc:mga0n895_188122_c1 3300050512 Bacteria 2096
691 nmdc:mga0a205_118065_c1 3300050515 Bacteria 2551
692 Ga0495601_0003321 3300053077 Bacteria 9205
693 Ga0495655_0002676 3300053083 Bacteria 2861
694 Ga0495595_0036684 3300053084 Bacteria 2225
695 Ga0495595_0083829 3300053084 Bacteria 1522
696 Ga0500644_0039740 3300053088 Bacteria 1553
697 Ga0500556_0007242 3300053104 Bacteria 3168
698 Ga0500642_0086370 3300053130 Bacteria 1446
699 Ga0500616_0001251 3300053153 Bacteria 25463
700 Ga0501084_0024111 3300054114 Bacteria 5074
701 Ga0501084_0560376 3300054114 Bacteria 965
702 Ga0501082_0011460 3300060353 Bacteria 7632
703 Ga0501082_0198690 3300060353 Bacteria 1744
704 Ga0501082_0204198 3300060353 Bacteria 1719
705 Ga0501082_0278331 3300060353 Bacteria 1456
706 Ga0501082_0430533 3300060353 Bacteria 1152
707 Ga0530510_0009166 3300061734 Bacteria 6934
708 Ga0530510_0099143 3300061734 Bacteria 2130
709 Ga0530510_0261170 3300061734 Bacteria 1291
710 2501413952 2501025504 Bacteria 8008976
711 2509129459 2508501125 Bacteria 7208311
712 2511089377 2510917013 Bacteria 9951648
713 2511094784 2510917014 Bacteria 8296963
714 2511104483 2510917015 Bacteria 7950052
715 2513551667 2513237082 Bacteria 8640282
716 2513962060 2513237151 Bacteria 6309801
717 2519457972 2519103095 Bacteria 6629912
718 2527080516 2526164713 Bacteria 6780608
719 2585295267 2582581311 Bacteria 6763856
720 2600204898 2599185355 Bacteria 7968906
721 2600810621 2600255067 Bacteria 6795583
722 2676741887 2675903129 Bacteria 7964495
723 2738820042 2738541296 Bacteria 7285013
724 2738832522 2738541298 Bacteria 7286732
725 2738874049 2738541306 Bacteria 7284992
726 2739185679 2738543002 Bacteria 7284546
727 2739220647 2738543008 Bacteria 7282815
728 2746092148 2744054900 Bacteria 8399525
729 2746093741 2744054901 Bacteria 8397047
730 2753568901 2751185846 Bacteria 7242164
731 2778124762 2775507255 Bacteria 3945731
732 2808972217 2808606384 Bacteria 8474373
733 2809006865 2808606390 Bacteria 8476311
734 2809014003 2808606391 Bacteria 8308166
735 2817260144 2816332253 Bacteria 6764532
736 2817277807 2816332256 Bacteria 6891714
737 2817455852 2816332286 Bacteria 6853759
738 2819620937 2818991450 Bacteria 6962147
739 2819632636 2818991452 Bacteria 8442785
740 2842331267 2842324504 Bacteria 9364110
741 2842355606 2842348783 Bacteria 9002918
742 2842457991 2842454564 Bacteria 8730687
743 2856290284 2856287931 Bacteria 7223934
744 2863421667 2863421361 Bacteria 7300805
745 2870072387 2870068957 Bacteria 8925310
746 2885277228 2885270888 Bacteria 9831543
747 2900636175 2900634093 Bacteria 10263517
748 2904484049 2904483920 Bacteria 7545285
749 2904565829 2904564687 Bacteria 7609577
750 2904572872 2904571731 Bacteria 7608790
751 2919529979 2919527303 Bacteria 7718827
752 2919705519 2919704043 Bacteria 5560311
753 2919712793 2919709256 Bacteria 4318106
754 2928109739 2928108538 Bacteria 7360024
755 2928136807 2928135762 Bacteria 7259641
756 2928164188 2928163908 Bacteria 7561269
757 2928173256 2928170801 Bacteria 8785406
758 2928506335 2928503688 Bacteria 7268108
759 2928538604 2928536128 Bacteria 7657547
760 2945935489 2945934425 Bacteria 7444609
761 2981994199 2981990288 Bacteria 7590678
762 2990703961 2990703756 Bacteria 7715990
763 642422118 641736151 Bacteria 7477263
764 642418692 641736154 Bacteria 7689995
765 642620366 642555113 Bacteria 8214658
766 8018853285 8018845410 Bacteria 8933938
767 8020810444 8020807995 Bacteria 6801506
768 8021126618 8021120328 Bacteria 8782274
769 8039099283 8039098773 Bacteria 6602928
770 8040176258 8040173305 Bacteria 6827067
771 8055266641 8055266321 Bacteria 7999742
772 8055435211 8055431914 Bacteria 4551896
773 Ga0466966_0189792
774 JGI24736J21556_1001619
775 JGI24741J21665_1000001
776 JGI24740J21852_10001522
777 JGI24739J22299_10000851
778 JGI24737J22298_10000719
779 JGI24735J21928_10005935
780 JGI24738J21930_10000353
781 JGI24738J21930_10005832
782 JGI24738J21930_10013660
783 JGI24738J21930_10016440
784 JGI25156J39149_1005205
785 JGI25165J46597_1003179
786 Ga0055533_1000126
787 Ga0055532_1000001
788 Ga0055532_1001081
789 Ga0055532_1001497
790 Ga0055527_1000014
791 Ga0055527_1001041
792 Ga0055527_1001260
793 Ga0055535_1000001
794 Ga0055535_1002088
795 Ga0055535_1002386
796 Ga0055542_1000001
797 Ga0055542_1001974
798 Ga0055542_1004727
799 Ga0055529_1000001
800 Ga0055529_1000855
801 Ga0055528_1009368
802 Ga0058692_1012896
803 Ga0065704_10001961
804 Ga0065704_10003935
805 Ga0070658_10390002
806 Ga0070676_10060860
807 Ga0070676_10128735
808 Ga0070683_100004018
809 Ga0070690_100000711
810 Ga0070690_100230655
811 Ga0068869_100530513
812 Ga0070666_10002619
813 Ga0070680_100004920
814 Ga0070682_100006499
815 Ga0070682_100008725
816 Ga0068868_100030963
817 Ga0070660_100000008
818 Ga0070660_100014500
819 Ga0070660_100024729
820 Ga0070660_100199907
821 Ga0070689_100008324
822 Ga0070691_10000261
823 Ga0070691_10081220
824 Ga0070661_100001075
825 Ga0070661_100106145
826 Ga0070661_100253700
827 Ga0070668_100004917
828 Ga0070668_100066673
829 Ga0070669_100001535
830 Ga0070675_100002766
831 Ga0070671_100001728
832 Ga0070674_100003316
833 Ga0070674_100106253
834 Ga0070688_100000482
835 Ga0070659_100000087
836 Ga0070659_100002108
837 Ga0070659_100006403
838 Ga0070659_100008653
839 Ga0070659_100010648
840 Ga0070667_100008966
841 Ga0070667_100061611
842 Ga0070667_100123053
843 Ga0070709_10004470
844 Ga0070701_10023156
845 Ga0070711_100001125
846 Ga0070700_100121479
847 Ga0070700_100691787
848 Ga0070694_100003547
849 Ga0070694_100123465
850 Ga0070663_100001008
851 Ga0070663_100007773
852 Ga0070663_100025549
853 Ga0070663_100116313
854 Ga0070663_100158981
855 Ga0070663_100207983
856 Ga0070678_100001148
857 Ga0070678_100112098
858 Ga0070681_10001288
859 Ga0070681_10067699
860 Ga0068867_100052362
861 Ga0070699_100195435
862 Ga0070679_100020073
863 Ga0070684_100007351
864 Ga0070697_100001668
865 Ga0068853_100003078
866 Ga0068853_100438771
867 Ga0070672_100001558
868 Ga0070686_100050346
869 Ga0070695_100000585
870 Ga0070695_100129182
871 Ga0070696_100007146
872 Ga0070696_100026406
873 Ga0070693_100014809
874 Ga0070665_100007746
875 Ga0070665_100028448
876 Ga0070704_100001906
877 Ga0070704_100186281
878 Ga0070704_100202901
879 Ga0068855_100020362
880 Ga0068855_100032937
881 Ga0068855_100075405
882 Ga0070664_100001931
883 Ga0070664_100028935
884 Ga0070664_100567261
885 Ga0068857_100006541
886 Ga0068857_100022981
887 Ga0068854_100000710
888 Ga0068856_100072555
889 Ga0070702_100036734
890 Ga0068852_100001287
891 Ga0068852_100033433
892 Ga0068852_100334464
893 Ga0068859_100159156
894 Ga0068864_100001896
895 Ga0068861_100000060
896 Ga0068861_100001108
897 Ga0068861_100382832
898 Ga0068870_10071372
899 Ga0068863_100011149
900 Ga0068858_100008947
901 Ga0068858_100038022
902 Ga0068858_100039232
903 Ga0068858_100405364
904 Ga0068860_100002998
905 Ga0068862_100171363
906 Ga0081455_10027622
907 Ga0070715_10021590
908 Ga0070716_100028158
909 Ga0070712_100001037
910 Ga0070712_100076006
911 Ga0097621_100040402
912 Ga0068871_100372447
913 Ga0075433_10187968
914 Ga0068865_100073849
915 Ga0068865_100275410
916 Ga0097620_100159150
917 Ga0079104_1012574
918 Ga0105251_10000947
919 Ga0105251_10012849
920 Ga0105251_10072915
921 Ga0105240_10004113
922 Ga0105240_10240361
923 Ga0111539_10352576
924 Ga0105245_10001169
925 Ga0105245_10083135
926 Ga0105245_10212439
927 Ga0114129_10336979
928 Ga0105243_10056734
929 Ga0105243_10161850
930 Ga0105243_10162840
931 Ga0105243_10230213
932 Ga0105241_10006190
933 Ga0105241_10181418
934 Ga0105248_10002101
935 Ga0105237_10007626
936 Ga0105237_10015961
937 Ga0105237_10041721
938 Ga0105237_10764439
939 Ga0105238_10010909
940 Ga0105238_10212788
941 Ga0105238_10226329
942 Ga0105238_10273247
943 Ga0105249_10036973
944 Ga0105249_10062078
945 Ga0105249_10184122
946 Ga0105249_10385661
947 Ga0105148_100146
948 Ga0105239_10035506
949 Ga0105239_10335491
950 Ga0105246_10235580
951 Ga0157373_10045347
952 Ga0157373_10238121
953 Ga0157370_10079333
954 Ga0157370_10096868
955 Ga0157369_10000138
956 Ga0157369_10101799
957 Ga0157369_10187251
958 Ga0157369_10235257
959 Ga0157374_10016966
960 Ga0157378_10038242
961 Ga0163162_10186856
962 Ga0163162_10224430
963 Ga0157372_10012193
964 Ga0157372_10034184
965 Ga0157372_10061123
966 Ga0157372_10182913
967 Ga0157372_10326750
968 Ga0157372_10942987
969 Ga0157375_10003280
970 Ga0157375_10062294
971 Ga0157375_10127702
972 Ga0163163_10073399
973 Ga0157380_10001936
974 Ga0157377_10010742
975 Ga0157379_10326365
976 Ga0157376_10004614
977 Ga0182007_10000155
978 Ga0182007_10022765
979 Ga0182005_1048540
980 Ga0163161_10001240
981 Ga0163161_10002898
982 Ga0163161_10046884
983 Ga0206356_10075526
984 Ga0206353_10003921
985 Ga0213872_10002394
986 Ga0213874_10016789
987 Ga0213871_10081483
988 Ga0224712_10000194
989 Ga0209566_103618
990 Ga0209674_100005
991 Ga0209674_100092
992 Ga0209672_100001
993 Ga0209672_100038
994 Ga0209147_100001
995 Ga0209147_100112
996 Ga0209258_100001
997 Ga0209258_100109
998 Ga0209148_1000003
999 Ga0209148_1001747
1000 Ga0209759_1000053
1001 Ga0209759_1000120
1002 Ga0209759_1000172
1003 Ga0209233_1000016
1004 Ga0209455_1000001
1005 Ga0207656_10030365
1006 Ga0207656_10190313
1007 Ga0207713_1000855
1008 Ga0207713_1029090
1009 Ga0207642_10006996
1010 Ga0207710_10003550
1011 Ga0207688_10002808
1012 Ga0207647_10020602
1013 Ga0207647_10022613
1014 Ga0207647_10023177
1015 Ga0207647_10031545
1016 Ga0207645_10073196
1017 Ga0207645_10154015
1018 Ga0207705_10001428
1019 Ga0207654_10009397
1020 Ga0207654_10088850
1021 Ga0207654_10220401
1022 Ga0207707_10146061
1023 Ga0207695_10015304
1024 Ga0207695_10130858
1025 Ga0207695_10193788
1026 Ga0207695_10332126
1027 Ga0207671_10014180
1028 Ga0207671_10034018
1029 Ga0207671_10237007
1030 Ga0207693_10002168
1031 Ga0207693_10026355
1032 Ga0207663_10016827
1033 Ga0207657_10003315
1034 Ga0207657_10106232
1035 Ga0207657_10503735
1036 Ga0207649_10015928
1037 Ga0207681_10409320
1038 Ga0207694_10209716
1039 Ga0207694_10529731
1040 Ga0207687_10001754
1041 Ga0207664_10442482
1042 Ga0207690_10018989
1043 Ga0207690_10056278
1044 Ga0207690_10085501
1045 Ga0207690_10313968
1046 Ga0207706_10002755
1047 Ga0207686_10015950
1048 Ga0207709_10005957
1049 Ga0207669_10002640
1050 Ga0207669_10517619
1051 Ga0207691_10008138
1052 Ga0207711_10039207
1053 Ga0207711_10085132
1054 Ga0207711_10115968
1055 Ga0207689_10016283
1056 Ga0207689_10096647
1057 Ga0207679_10184285
1058 Ga0207667_10001951
1059 Ga0207667_10369701
1060 Ga0207667_10610570
1061 Ga0207651_10008567
1062 Ga0207712_10328066
1063 Ga0207640_10082163
1064 Ga0207658_10216612
1065 Ga0207658_10293893
1066 Ga0207703_10000467
1067 Ga0207639_10027770
1068 Ga0207639_10053933
1069 Ga0207639_10057513
1070 Ga0207678_10000460
1071 Ga0207678_10002388
1072 Ga0207678_10036634
1073 Ga0207678_10127103
1074 Ga0207708_10015012
1075 Ga0207708_10102056
1076 Ga0207702_10018661
1077 Ga0207702_10338262
1078 Ga0207641_10019759
1079 Ga0207641_10059573
1080 Ga0207648_10030875
1081 Ga0207648_10311445
1082 Ga0207648_10515118
1083 Ga0207676_10122111
1084 Ga0207674_10009318
1085 Ga0207674_10159353
1086 Ga0207675_100000062
1087 Ga0207675_100002836
1088 Ga0207675_100102213
1089 Ga0207675_100167650
1090 Ga0207683_10001948
1091 Ga0207683_10129560
1092 Ga0207698_10010421
1093 Ga0268265_10056896
1094 Ga0268265_10228191
1095 Ga0268264_10004130
1096 Ga0265340_10040020
1097 Ga0265339_10026820
1098 Ga0307408_100001730
1099 Ga0307407_10255967
1100 Ga0307412_10000051
1101 Ga0307412_10005643
1102 Ga0307416_100029858
1103 Ga0307414_10079396
1104 Ga0307411_10078930
1105 Ga0373939_0224754
1106 Ga0373955_0022673
1107 Ga0373931_0115718
1108 Ga0373935_0257969
1109 Ga0373937_0013167
1110 Ga0395899_0011621
1111 Ga0395900_0000099
1112 Ga0395900_0235760
1113 Ga0395900_0264832
1114 Ga0395900_0363996
1115 Ga0395898_0053053
1116 Ga0395898_0204763
1117 Ga0395901_0000576
1118 Ga0395901_0003976
1119 Ga0395901_0071144
1120 Ga0400484_36491
1121 Ga0400488_04984
1122 Ga0400483_134009
1123 Ga0400483_277394
1124 Ga0436360_1108419
1125 Ga0436361_0867198
1126 Ga0436361_1182382
1127 Ga0436363_1496855
1128 Ga0436362_1083763
1129 Ga0466965_0006127
1130 Ga0466961_0025919
1131 Ga0466971_0111112
1132 Ga0466959_0065870
1133 Ga0466958_0029636
1134 Ga0466958_0045423
1135 Ga0495592_0007576
1136 Ga0495592_0011091
1137 Ga0495592_0071280
1138 Ga0495603_0016566
1139 Ga0495603_0262876
1140 Ga0495590_0056263
1141 Ga0495591_003620
1142 Ga0495629_0000015
1143 Ga0495629_0002264
1144 Ga0495629_0017477
1145 Ga0495638_0000014
1146 Ga0495638_0003655
1147 Ga0495641_0015817
1148 Ga0495651_0026941
1149 Ga0495651_0035436
1150 Ga0495653_0016009
1151 Ga0495653_0017142
1152 Ga0495653_0018145
1153 Ga0495653_0020908
1154 Ga0495653_0086152
1155 Ga0495650_0003236
1156 Ga0495650_0011060
1157 Ga0495580_0000106
1158 Ga0495580_0006643
1159 Ga0495580_0022078
1160 Ga0495580_0025735
1161 Ga0495580_0048876
1162 Ga0495582_0013599
1163 Ga0495582_0014302
1164 Ga0495582_0023281
1165 Ga0495605_0004203
1166 Ga0495605_0009713
1167 Ga0495662_0065969
1168 Ga0495664_0027680
1169 Ga0495664_0142553
1170 Ga0495584_0214933
1171 Ga0495594_0158949
1172 Ga0495596_0004954
1173 Ga0495596_0040352
1174 Ga0495596_0046221
1175 Ga0495583_0000072
1176 Ga0495583_0001695
1177 Ga0495606_0017997
1178 Ga0495606_0035087
1179 Ga0495606_0043187
1180 Ga0495608_0028118
1181 Ga0495610_0016348
1182 Ga0495618_0002628
1183 Ga0495618_0045287
1184 Ga0495620_0009172
1185 Ga0495628_0028048
1186 Ga0495628_0039438
1187 Ga0495628_0043839
1188 Ga0495628_0047665
1189 Ga0495628_0074080
1190 Ga0495630_0015237
1191 Ga0495630_0038382
1192 Ga0495630_0068770
1193 Ga0495630_0241420
1194 Ga0495632_0000171
1195 Ga0495637_0129459
1196 Ga0495644_0096064
1197 Ga0495648_0000021
1198 Ga0495648_0022062
1199 Ga0495648_0029553
1200 Ga0495648_0071994
1201 Ga0495648_0077971
1202 Ga0495666_0001418
1203 Ga0495666_0006152
1204 Ga0495666_0011284
1205 Ga0495666_0027353
1206 Ga0495652_0017464
1207 Ga0495652_0037945
1208 Ga0495652_0067180
1209 Ga0495665_0004941
1210 Ga0495665_0028337
1211 Ga0495665_0045453
1212 Ga0495640_0016371
1213 Ga0495640_0046861
1214 Ga0495640_0055399
1215 Ga0495586_0055531
1216 Ga0495587_0004844
1217 Ga0495587_0028190
1218 Ga0495587_0040107
1219 Ga0495609_0074383
1220 Ga0495597_0094999
1221 Ga0495645_0003648
1222 Ga0495645_0031774
1223 Ga0495622_0000486
1224 Ga0495633_0015770
1225 Ga0495667_0130213
1226 Ga0495667_0322043
1227 Ga0495634_0007419
1228 Ga0495634_0194350
1229 Ga0495611_0007538
1230 Ga0495635_0007045
1231 Ga0495635_0047238
1232 Ga0495635_0199948
1233 Ga0495661_0011298
1234 Ga0495661_0047657
1235 Ga0495661_0054436
1236 Ga0495657_0010382
1237 Ga0495599_0061604
1238 Ga0495599_0067781
1239 Ga0495623_0008645
1240 Ga0495623_0027244
1241 Ga0495646_0018165
1242 Ga0495646_0036834
1243 Ga0495646_0064765
1244 Ga0495646_0094305
1245 Ga0495669_0026864
1246 Ga0495613_0004833
1247 Ga0495613_0062637
1248 Ga0495624_0000132
1249 Ga0495624_0000448
1250 Ga0495624_0070238
1251 Ga0495671_0000028
1252 Ga0495649_0001070
1253 Ga0495649_0058766
1254 Ga0495649_0090023
1255 Ga0495589_0019322
1256 Ga0495589_0034382
1257 Ga0495600_0015179
1258 Ga0495600_0362205
1259 Ga0495660_0089265
1260 Ga0495581_0003098
1261 Ga0495604_0051274
1262 Ga0495674_0026087
1263 Ga0495674_0051065
1264 Ga0495674_0062481
1265 Ga0495674_0074683
1266 Ga0495674_0088657
1267 Ga0495674_0091161
1268 Ga0495672_0013806
1269 Ga0495676_0011631
1270 Ga0495676_0032488
1271 Ga0495676_0091773
1272 Ga0495680_0117353
1273 Ga0495680_0381770
1274 Ga0495683_0002664
1275 Ga0495683_0009774
1276 Ga0495683_0034003
1277 Ga0495683_0063131
1278 Ga0495683_0072830
1279 Ga0495687_014958
1280 Ga0495687_061006
1281 Ga0495687_085296
1282 Ga0495675_0012606
1283 Ga0495675_0013422
1284 Ga0495679_000045
1285 Ga0495679_005897
1286 Ga0495679_007344
1287 Ga0495673_0000058
1288 Ga0495673_0027656
1289 Ga0495684_0060481
1290 Ga0495684_0069574
1291 Ga0495686_0027985
1292 Ga0495686_0058146
1293 Ga0495593_0002775
1294 Ga0495593_0013630
1295 Ga0495593_0024980
1296 Ga0495602_0008004
1297 Ga0495602_0013837
1298 Ga0495602_0052971
1299 Ga0495602_0057586
1300 Ga0495602_0062666
1301 Ga0495602_0135651
1302 Ga0495602_0204768
1303 Ga0495602_0455408
1304 Ga0495602_0508413
1305 Ga0495614_0004276
1306 Ga0495626_0019377
1307 Ga0495626_0020391
1308 Ga0495626_0050524
1309 Ga0496100_0007989
1310 Ga0496100_0012985
1311 Ga0496101_0025834
1312 Ga0496101_0219429
1313 Ga0496102_0027692
1314 Ga0496102_0029481
1315 Ga0496102_0287221
1316 Ga0496102_0822420
1317 Ga0496103_0008021
1318 Ga0496103_0019170
1319 Ga0496103_0030602
1320 Ga0496103_0043133
1321 Ga0496104_0000564
1322 Ga0496104_0031060
1323 Ga0496104_0037907
1324 Ga0496104_0070870
1325 Ga0496105_0000342
1326 Ga0496105_0006786
1327 Ga0496105_0019248
1328 Ga0496105_0046062
1329 Ga0496105_0069860
1330 Ga0496105_0082827
1331 Ga0496105_0150984
1332 Ga0496105_0514503
1333 Ga0496106_0000067
1334 Ga0496106_0018704
1335 Ga0496106_0088112
1336 Ga0496106_0280712
1337 Ga0496107_0026562
1338 Ga0496108_0000875
1339 Ga0496108_0125687
1340 Ga0496108_0179973
1341 Ga0496109_0011207
1342 Ga0496109_0504322
1343 Ga0496110_0042254
1344 Ga0496110_0044772
1345 Ga0496111_0087162
1346 Ga0496112_0180533
1347 Ga0496113_0047881
1348 Ga0496114_0011096
1349 Ga0496114_0097415
1350 Ga0496114_0224173
1351 Ga0496115_0029925
1352 Ga0496115_0053593
1353 Ga0496115_0075848
1354 Ga0496115_0505577
1355 Ga0496116_0029599
1356 Ga0496116_0046923
1357 Ga0496116_0092510
1358 Ga0496117_0013602
1359 Ga0496117_0029381
1360 Ga0496118_0000248
1361 Ga0496118_0002597
1362 Ga0496118_0036724
1363 Ga0496118_0077070
1364 Ga0496118_0135059
1365 Ga0496121_0000454
1366 Ga0496121_0004632
1367 Ga0496121_0009028
1368 Ga0496121_0032034
1369 Ga0496122_0093525
1370 Ga0496123_0045638
1371 Ga0496124_0106034
1372 Ga0496125_0024468
1373 Ga0496125_0076136
1374 Ga0496126_0000705
1375 Ga0496126_0000900
1376 Ga0496126_0030460
1377 Ga0496126_0093505
1378 Ga0496126_0302509
1379 Ga0495678_006149
1380 Ga0501031_0033181
1381 Ga0501032_0111928
1382 Ga0501032_0252481
1383 Ga0501033_0330597
1384 Ga0501034_0000208
1385 Ga0501034_0037806
1386 Ga0501034_0165429
1387 Ga0501034_0403094
1388 Ga0501034_0621808
1389 Ga0501036_0023166
1390 Ga0501036_0043468
1391 Ga0501036_0492685
1392 Ga0501038_0025818
1393 Ga0501038_0030734
1394 Ga0501038_0284459
1395 Ga0501038_0400245
1396 Ga0501039_0000072
1397 Ga0501039_0140867
1398 Ga0501040_0039424
1399 Ga0501040_0094023
1400 Ga0501040_0539852
1401 Ga0501041_0025169
1402 Ga0501041_0116385
1403 Ga0501042_0029317
1404 Ga0501043_0057371
1405 Ga0501043_0105173
1406 Ga0501043_0135565
1407 Ga0501046_0003737
1408 Ga0501046_0005533
1409 Ga0501046_0029760
1410 Ga0501046_0065067
1411 Ga0501047_0001212
1412 Ga0501047_0046316
1413 Ga0501047_0145654
1414 Ga0501048_0000149
1415 Ga0501048_0014798
1416 Ga0501048_0047349
1417 Ga0501048_0060608
1418 Ga0501067_0001102
1419 Ga0501068_0039338
1420 Ga0501068_0112146
1421 Ga0501069_0067955
1422 Ga0501070_0010407
1423 Ga0501070_0170134
1424 Ga0501070_0390294
1425 Ga0501071_0025813
1426 Ga0501072_0005196
1427 Ga0501072_0063712
1428 Ga0501072_0294352
1429 Ga0501073_0006515
1430 Ga0501073_0143975
1431 Ga0501073_0202976
1432 Ga0501073_0257934
1433 Ga0501074_0043081
1434 Ga0501075_0017136
1435 Ga0501076_0055975
1436 Ga0501076_0078769
1437 Ga0501077_0033072
1438 Ga0501077_0042910
1439 Ga0501211_002602
1440 Ga0501223_000021
1441 Ga0501235_000949
1442 Ga0501225_0000011
1443 Ga0501079_0083539
1444 Ga0501079_0255621
1445 Ga0501080_0000005
1446 Ga0501080_0090973
1447 Ga0501080_0345368
1448 Ga0501081_0036258
1449 Ga0501081_0412563
1450 Ga0501035_0000049
1451 Ga0501035_0109005
1452 Ga0501035_0241788
1453 Ga0501044_0000030
1454 Ga0501044_0063345
1455 Ga0501044_0332736
1456 Ga0501044_0395567
1457 Ga0501045_0016662
1458 Ga0501045_0042693
1459 Ga0501045_0107598
1460 nmdc:mga03683_93049_c1
1461 nmdc:mga0k408_2565_c1
1462 nmdc:mga0n895_188122_c1
1463 nmdc:mga0a205_118065_c1
1464 Ga0495601_0003321
1465 Ga0495655_0002676
1466 Ga0495595_0036684
1467 Ga0495595_0083829
1468 Ga0500644_0039740
1469 Ga0500556_0007242
1470 Ga0500642_0086370
1471 Ga0500616_0001251
1472 Ga0501084_0024111
1473 Ga0501084_0560376
1474 Ga0501082_0011460
1475 Ga0501082_0198690
1476 Ga0501082_0204198
1477 Ga0501082_0278331
1478 Ga0501082_0430533
1479 Ga0530510_0009166
1480 Ga0530510_0099143
1481 Ga0530510_0261170
1482 2501413952
1483 2509129459
1484 2511089377
1485 2511094784
1486 2511104483
1487 2513551667
1488 2513962060
1489 2519457972
1490 2527080516
1491 2585295267
1492 2600204898
1493 2600810621
1494 2676741887
1495 2738820042
1496 2738832522
1497 2738874049
1498 2739185679
1499 2739220647
1500 2746092148
1501 2746093741
1502 2753568901
1503 2778124762
1504 2808972217
1505 2809006865
1506 2809014003
1507 2817260144
1508 2817277807
1509 2817455852
1510 2819620937
1511 2819632636
1512 2842331267
1513 2842355606
1514 2842457991
1515 2856290284
1516 2863421667
1517 2870072387
1518 2885277228
1519 2900636175
1520 2904484049
1521 2904565829
1522 2904572872
1523 2919529979
1524 2919705519
1525 2919712793
1526 2928109739
1527 2928136807
1528 2928164188
1529 2928173256
1530 2928506335
1531 2928538604
1532 2945935489
1533 2981994199
1534 2990703961
1535 642422118
1536 642418692
1537 642620366
1538 8018853285
1539 8020810444
1540 8021126618
1541 8039099283
1542 8040176258
1543 8055266641
1544 8055435211

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01925

TauE

Sulfite exporter TauE/SafE

37

286

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.5088 3 257
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.5042 3 257
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.4898 3 261
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.4828 3 261
6kki-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward-occluded conformation 0.4077 39 261
ID Description Score Start End Superfamily
af_D3ZUN1_35_222_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4289 38 260 1.20.1250.20
af_P0AA76_9_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.409 25 262 1.20.1250.20
af_D3ZUN1_35_222_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4066 38 260 1.20.1250.20
af_Q9CAT6_64_523_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4001 7 261 1.20.1250.20
af_Q9VWJ0_419_609_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3968 2 261 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1G3JJS5-F1-model_v4 Probable membrane transporter protein 0.9775 1 263 GO:0005886
AF-I8T6P9-F1-model_v4 Probable membrane transporter protein 0.9563 1 261 GO:0005886
AF-A0A6P1YNJ3-F1-model_v4 Probable membrane transporter protein 0.9562 2 262 GO:0005886
AF-A0A2V5B9J7-F1-model_v4 deleted 0.956 2 262
AF-A0A257G1K6-F1-model_v4 deleted 0.9534 1 261

Map