F480129
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 772 | 329 | 1544 | 263 |
Family's Representative Sequence
| Representative Sequence | 3300046542|Ga0495597_0076063|Ga0495597_0076063_115_1002 |
| Length | 295 |
| Sequence | VTQPNDFLTRPCDRYDQIFPAHPVGAGRTMISPLMLRGVWAYRGFVLGSVKREFQARYANAVLGALWSLLSPLAMILVYTVIFSEVMQSRLPGAESRFAYSIYLCAGILTWGLFAEIVGRAQGMFIEQANLIKKISFPRICLPLIVVLNALVNFAIIFGLFTLFLLATDSFPGWTYFAILPVLVLQVLLAIGVGMIAGVLNVFFRDVGQLVTIALQFWFWFTPIVYPPTILPDNVRPLLAFNPMAQVVGAYQAVLVRGATPHWPSLAPVLALALLLCLFGLRLFRKRSAELVDEL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 3 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 4 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 6 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 32 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 33 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 35 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 36 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 37 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 38 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 55 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 56 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 57 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 63 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 64 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 66 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 68 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 97 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 98 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 99 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 100 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 101 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 102 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 103 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 104 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 105 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 106 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 107 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 108 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 109 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 110 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 111 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 112 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 113 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 114 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 115 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 116 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 117 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 118 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 119 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 120 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 121 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 122 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 123 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 124 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 125 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 126 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 127 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 128 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 129 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 130 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 131 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 132 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 133 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 134 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 135 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 218 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 219 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 220 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 221 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 222 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 224 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 225 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 226 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 227 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 228 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 229 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 230 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 231 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 232 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 233 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 234 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 235 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 236 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 237 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 247 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 253 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 256 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 257 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 258 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 259 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 260 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 261 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 262 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 263 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 264 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 265 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 266 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 267 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 268 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 269 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 270 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 271 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 272 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 273 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 274 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 275 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 276 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 277 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 278 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 279 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 280 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 281 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 282 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 283 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 284 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 285 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 286 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 287 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 288 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 289 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 290 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 291 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 292 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 293 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 294 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 295 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 296 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 297 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 298 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 299 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 300 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 301 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 302 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 303 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 304 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 305 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 306 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 307 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 308 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 309 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 310 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 311 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 312 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 313 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 314 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 315 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 316 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 317 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 318 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 319 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 320 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 321 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 322 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 323 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 324 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 325 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 326 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 327 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 328 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 329 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.03 |
| Metatranscriptomes | 0.26 |
| Isolates | 9.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.26 |
| Bulb | 0 |
| Endosphere | 4.66 |
| Nodule | 0.65 |
| Rhizoplane | 7.25 |
| Rhizosphere | 78.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495597_0076063 | 3300046542 | Bacteria | 1440 |
| 2 | JGI25154J39366_1002119 | 3300002738 | Bacteria | 5560 |
| 3 | JGI25163J39215_1000028 | 3300002771 | Bacteria | 67700 |
| 4 | JGI25164J39214_1000107 | 3300002772 | Bacteria | 80489 |
| 5 | JGI25152J39213_1014295 | 3300002773 | Bacteria | 1615 |
| 6 | JGI25159J45721_1000601 | 3300002987 | Bacteria | 16095 |
| 7 | JGI25165J46597_1000218 | 3300003214 | Bacteria | 80489 |
| 8 | rootH1_10043487 | 3300003316 | Bacteria | 1582 |
| 9 | Ga0055525_1000135 | 3300003759 | Bacteria | 108217 |
| 10 | Ga0055526_1000110 | 3300003771 | Bacteria | 72034 |
| 11 | Ga0055537_1000284 | 3300003773 | Bacteria | 36171 |
| 12 | Ga0055524_1006844 | 3300003775 | Bacteria | 4916 |
| 13 | Ga0055534_1000059 | 3300003784 | Bacteria | 84386 |
| 14 | Ga0055528_1000124 | 3300003790 | Bacteria | 61627 |
| 15 | Ga0055543_1007100 | 3300004625 | Bacteria | 2623 |
| 16 | Ga0065165_1000050 | 3300005262 | Bacteria | 195237 |
| 17 | Ga0065165_1010202 | 3300005262 | Bacteria | 4096 |
| 18 | Ga0070658_10001501 | 3300005327 | Bacteria | 19811 |
| 19 | Ga0070680_100043772 | 3300005336 | Bacteria | 3636 |
| 20 | Ga0070682_100052125 | 3300005337 | Bacteria | 2560 |
| 21 | Ga0070660_100051350 | 3300005339 | Bacteria | 3175 |
| 22 | Ga0070660_100077774 | 3300005339 | Bacteria | 2601 |
| 23 | Ga0070661_100227593 | 3300005344 | Bacteria | 1432 |
| 24 | Ga0070669_100290047 | 3300005353 | Bacteria | 1313 |
| 25 | Ga0070714_100169783 | 3300005435 | Bacteria | 1979 |
| 26 | Ga0070679_100026869 | 3300005530 | Bacteria | 5661 |
| 27 | Ga0070684_100033946 | 3300005535 | Bacteria | 4360 |
| 28 | Ga0068853_100016929 | 3300005539 | Bacteria | 6009 |
| 29 | Ga0068853_100741298 | 3300005539 | Bacteria | 938 |
| 30 | Ga0068855_100006913 | 3300005563 | Bacteria | 13759 |
| 31 | Ga0068855_100134421 | 3300005563 | Bacteria | 2822 |
| 32 | Ga0070664_100044370 | 3300005564 | Bacteria | 3754 |
| 33 | Ga0070664_100213336 | 3300005564 | Bacteria | 1725 |
| 34 | Ga0068854_100140395 | 3300005578 | Bacteria | 1853 |
| 35 | Ga0068852_100106833 | 3300005616 | Bacteria | 2538 |
| 36 | Ga0068861_100031002 | 3300005719 | Bacteria | 3923 |
| 37 | Ga0068851_10009237 | 3300005834 | Bacteria | 4578 |
| 38 | Ga0070717_10094997 | 3300006028 | Bacteria | 2523 |
| 39 | Ga0075362_10030522 | 3300006177 | Bacteria | 2328 |
| 40 | Ga0068871_100610880 | 3300006358 | Bacteria | 992 |
| 41 | Ga0075436_100262641 | 3300006914 | Bacteria | 1231 |
| 42 | Ga0099826_10000003 | 3300006948 | Bacteria | 1067817 |
| 43 | Ga0105251_10001634 | 3300009011 | Bacteria | 18983 |
| 44 | Ga0105251_10042925 | 3300009011 | Bacteria | 2192 |
| 45 | Ga0105251_10076207 | 3300009011 | Bacteria | 1556 |
| 46 | Ga0105244_10004218 | 3300009036 | Bacteria | 9992 |
| 47 | Ga0105244_10006422 | 3300009036 | Bacteria | 7611 |
| 48 | Ga0105244_10007894 | 3300009036 | Bacteria | 6709 |
| 49 | Ga0105244_10009942 | 3300009036 | Bacteria | 5800 |
| 50 | Ga0105250_10001524 | 3300009092 | Bacteria | 12492 |
| 51 | Ga0105250_10002509 | 3300009092 | Bacteria | 9199 |
| 52 | Ga0105240_10089222 | 3300009093 | Bacteria | 3771 |
| 53 | Ga0105240_10393415 | 3300009093 | Bacteria | 1563 |
| 54 | Ga0105245_10052912 | 3300009098 | Bacteria | 3643 |
| 55 | Ga0105243_10001703 | 3300009148 | Bacteria | 18949 |
| 56 | Ga0105241_10009038 | 3300009174 | Bacteria | 7329 |
| 57 | Ga0105241_10343692 | 3300009174 | Bacteria | 1294 |
| 58 | Ga0105238_10055978 | 3300009551 | Bacteria | 3957 |
| 59 | Ga0105239_10071052 | 3300010375 | Bacteria | 3824 |
| 60 | Ga0157373_10005862 | 3300013100 | Bacteria | 9191 |
| 61 | Ga0157371_10000001 | 3300013102 | Bacteria | 1162285 |
| 62 | Ga0157371_10007873 | 3300013102 | Bacteria | 8555 |
| 63 | Ga0157371_10020003 | 3300013102 | Bacteria | 4929 |
| 64 | Ga0157370_10004280 | 3300013104 | Bacteria | 16440 |
| 65 | Ga0157370_10074910 | 3300013104 | Bacteria | 3192 |
| 66 | Ga0157370_10158140 | 3300013104 | Bacteria | 2108 |
| 67 | Ga0157370_10191145 | 3300013104 | Unclassified | 1900 |
| 68 | Ga0157369_10004954 | 3300013105 | Bacteria | 15599 |
| 69 | Ga0157369_10013873 | 3300013105 | Bacteria | 9102 |
| 70 | Ga0157369_10675990 | 3300013105 | Bacteria | 1064 |
| 71 | Ga0163162_10263821 | 3300013306 | Bacteria | 1854 |
| 72 | Ga0157372_10043201 | 3300013307 | Bacteria | 4989 |
| 73 | Ga0157372_10055155 | 3300013307 | Bacteria | 4437 |
| 74 | Ga0157372_10094965 | 3300013307 | Bacteria | 3397 |
| 75 | Ga0157372_10751311 | 3300013307 | Bacteria | 1134 |
| 76 | Ga0157375_10800698 | 3300013308 | Unclassified | 1091 |
| 77 | Ga0182008_10101808 | 3300014497 | Bacteria | 1420 |
| 78 | Ga0182005_1002413 | 3300015265 | Bacteria | 6688 |
| 79 | Ga0182005_1005606 | 3300015265 | Bacteria | 3908 |
| 80 | Ga0213872_10000002 | 3300021361 | Bacteria | 554092 |
| 81 | Ga0213872_10005552 | 3300021361 | Bacteria | 6459 |
| 82 | Ga0213872_10011940 | 3300021361 | Bacteria | 4100 |
| 83 | Ga0209760_100020 | 3300025207 | Bacteria | 169879 |
| 84 | Ga0209436_104856 | 3300025208 | Bacteria | 3221 |
| 85 | Ga0209563_100036 | 3300025230 | Bacteria | 448275 |
| 86 | Ga0207427_100006 | 3300025231 | Bacteria | 785415 |
| 87 | Ga0209437_100013 | 3300025233 | Bacteria | 785457 |
| 88 | Ga0209437_106803 | 3300025233 | Bacteria | 1889 |
| 89 | Ga0209646_1000117 | 3300025246 | Bacteria | 150025 |
| 90 | Ga0209026_1009208 | 3300025250 | Bacteria | 1964 |
| 91 | Ga0209148_1000298 | 3300025254 | Bacteria | 72028 |
| 92 | Ga0209129_1002747 | 3300025258 | Bacteria | 8232 |
| 93 | Ga0209233_1000022 | 3300025261 | Bacteria | 785415 |
| 94 | Ga0209565_1000006 | 3300025263 | Bacteria | 897294 |
| 95 | Ga0209673_1000004 | 3300025273 | Bacteria | 896155 |
| 96 | Ga0209130_1000065 | 3300025284 | Bacteria | 195251 |
| 97 | Ga0209675_1000006 | 3300025291 | Bacteria | 732267 |
| 98 | Ga0209025_1004912 | 3300025294 | Bacteria | 11250 |
| 99 | Ga0209564_1000038 | 3300025295 | Bacteria | 414357 |
| 100 | Ga0209564_1000064 | 3300025295 | Bacteria | 316431 |
| 101 | Ga0209564_1041708 | 3300025295 | Bacteria | 1228 |
| 102 | Ga0209758_1000803 | 3300025297 | Bacteria | 44495 |
| 103 | Ga0209256_1000013 | 3300025299 | Bacteria | 689442 |
| 104 | Ga0209256_1000365 | 3300025299 | Bacteria | 72787 |
| 105 | Ga0207656_10027760 | 3300025321 | Bacteria | 2318 |
| 106 | Ga0207696_1001500 | 3300025711 | Bacteria | 12536 |
| 107 | Ga0207696_1002414 | 3300025711 | Bacteria | 9174 |
| 108 | Ga0207655_1002995 | 3300025728 | Bacteria | 12938 |
| 109 | Ga0207655_1017635 | 3300025728 | Bacteria | 3839 |
| 110 | Ga0207655_1019803 | 3300025728 | Bacteria | 3495 |
| 111 | Ga0207713_1000024 | 3300025735 | Bacteria | 339156 |
| 112 | Ga0207713_1055231 | 3300025735 | Bacteria | 1551 |
| 113 | Ga0207654_10080902 | 3300025911 | Bacteria | 1955 |
| 114 | Ga0207695_10294291 | 3300025913 | Bacteria | 1515 |
| 115 | Ga0207660_10012052 | 3300025917 | Bacteria | 5650 |
| 116 | Ga0207657_10001327 | 3300025919 | Bacteria | 26265 |
| 117 | Ga0207657_10014755 | 3300025919 | Bacteria | 7608 |
| 118 | Ga0207649_10111432 | 3300025920 | Bacteria | 1829 |
| 119 | Ga0207664_10142949 | 3300025929 | Bacteria | 2026 |
| 120 | Ga0207709_10000117 | 3300025935 | Bacteria | 122667 |
| 121 | Ga0207661_10024149 | 3300025944 | Bacteria | 4603 |
| 122 | Ga0207679_10295864 | 3300025945 | Bacteria | 1393 |
| 123 | Ga0207667_10006285 | 3300025949 | Bacteria | 14410 |
| 124 | Ga0207667_10402715 | 3300025949 | Bacteria | 1393 |
| 125 | Ga0207667_10421009 | 3300025949 | Bacteria | 1359 |
| 126 | Ga0207640_10124573 | 3300025981 | Bacteria | 1853 |
| 127 | Ga0207703_10454247 | 3300026035 | Bacteria | 1197 |
| 128 | Ga0207639_10567145 | 3300026041 | Bacteria | 1044 |
| 129 | Ga0207678_10178285 | 3300026067 | Bacteria | 1814 |
| 130 | Ga0207702_10129161 | 3300026078 | Bacteria | 2272 |
| 131 | Ga0207674_10359504 | 3300026116 | Bacteria | 1407 |
| 132 | Ga0207675_100097998 | 3300026118 | Bacteria | 2761 |
| 133 | Ga0209282_1000002 | 3300027666 | Bacteria | 1067825 |
| 134 | Ga0316181_1077120 | 3300030744 | Bacteria | 3705 |
| 135 | Ga0265332_10044632 | 3300031238 | Bacteria | 1911 |
| 136 | Ga0265331_10090732 | 3300031250 | Bacteria | 1412 |
| 137 | Ga0265327_10059110 | 3300031251 | Bacteria | 1965 |
| 138 | Ga0265316_10321435 | 3300031344 | Bacteria | 1124 |
| 139 | Ga0307408_100000461 | 3300031548 | Bacteria | 35591 |
| 140 | Ga0265314_10001032 | 3300031711 | Bacteria | 32416 |
| 141 | Ga0265342_10141992 | 3300031712 | Bacteria | 1339 |
| 142 | Ga0307411_10104209 | 3300032005 | Bacteria | 2014 |
| 143 | Ga0395899_0000141 | 3300037312 | Bacteria | 109773 |
| 144 | Ga0395899_0000962 | 3300037312 | Bacteria | 26757 |
| 145 | Ga0395899_0048791 | 3300037312 | Bacteria | 3149 |
| 146 | Ga0395899_0235813 | 3300037312 | Bacteria | 1261 |
| 147 | Ga0395899_0358560 | 3300037312 | Bacteria | 973 |
| 148 | Ga0395900_0000550 | 3300037418 | Bacteria | 52140 |
| 149 | Ga0395900_0271209 | 3300037418 | Bacteria | 1691 |
| 150 | Ga0395905_0025457 | 3300037471 | Bacteria | 5580 |
| 151 | Ga0395905_0173557 | 3300037471 | Bacteria | 2024 |
| 152 | Ga0395901_0000073 | 3300038443 | Bacteria | 139769 |
| 153 | Ga0400486_23214 | 3300038742 | Bacteria | 2857 |
| 154 | Ga0400489_53656 | 3300039093 | Bacteria | 48451 |
| 155 | Ga0436361_0154055 | 3300039447 | Bacteria | 57887 |
| 156 | Ga0436361_0584108 | 3300039447 | Bacteria | 4087 |
| 157 | Ga0436361_1009709 | 3300039447 | Bacteria | 25382 |
| 158 | Ga0436361_1165509 | 3300039447 | Bacteria | 12217 |
| 159 | Ga0439438_000002 | 3300041405 | Bacteria | 618223 |
| 160 | Ga0439438_001771 | 3300041405 | Bacteria | 9486 |
| 161 | Ga0439447_000704 | 3300041407 | Bacteria | 12370 |
| 162 | Ga0439466_0000001 | 3300041411 | Bacteria | 647258 |
| 163 | Ga0439466_0000913 | 3300041411 | Bacteria | 11266 |
| 164 | Ga0439432_000295 | 3300042006 | Bacteria | 17930 |
| 165 | Ga0439451_002484 | 3300042009 | Bacteria | 3738 |
| 166 | Ga0439452_001060 | 3300042010 | Bacteria | 12146 |
| 167 | Ga0439452_009893 | 3300042010 | Bacteria | 2794 |
| 168 | Ga0439456_000306 | 3300042013 | Bacteria | 11480 |
| 169 | Ga0439456_012038 | 3300042013 | Bacteria | 1793 |
| 170 | Ga0450907_021497 | 3300042146 | Bacteria | 1085 |
| 171 | Ga0439434_0000037 | 3300042435 | Bacteria | 32174 |
| 172 | Ga0439460_0001533 | 3300042461 | Bacteria | 5432 |
| 173 | Ga0466972_0000029 | 3300044658 | Bacteria | 165236 |
| 174 | Ga0466972_0007618 | 3300044658 | Bacteria | 5433 |
| 175 | Ga0453683_0001365 | 3300044673 | Bacteria | 21310 |
| 176 | Ga0453683_0014203 | 3300044673 | Bacteria | 5176 |
| 177 | Ga0466965_0000599 | 3300044683 | Bacteria | 13144 |
| 178 | Ga0466965_0037202 | 3300044683 | Bacteria | 2389 |
| 179 | Ga0466966_0001041 | 3300044684 | Bacteria | 17743 |
| 180 | Ga0466966_0011708 | 3300044684 | Bacteria | 5815 |
| 181 | Ga0466961_0003208 | 3300044693 | Bacteria | 10177 |
| 182 | Ga0466961_0048871 | 3300044693 | Bacteria | 2704 |
| 183 | Ga0466961_0181121 | 3300044693 | Bacteria | 1308 |
| 184 | Ga0466964_0003420 | 3300044706 | Bacteria | 5789 |
| 185 | Ga0466964_0009814 | 3300044706 | Bacteria | 3607 |
| 186 | Ga0466964_0046403 | 3300044706 | Bacteria | 1771 |
| 187 | Ga0466971_0005347 | 3300044719 | Bacteria | 5567 |
| 188 | Ga0466968_0002143 | 3300044735 | Bacteria | 7194 |
| 189 | Ga0466970_0000701 | 3300044765 | Bacteria | 16371 |
| 190 | Ga0466970_0004144 | 3300044765 | Bacteria | 7131 |
| 191 | Ga0466970_0217674 | 3300044765 | Bacteria | 1065 |
| 192 | Ga0466970_0313579 | 3300044765 | Bacteria | 886 |
| 193 | Ga0466957_0000386 | 3300044842 | Bacteria | 21569 |
| 194 | Ga0466957_0007223 | 3300044842 | Bacteria | 6277 |
| 195 | Ga0466957_0300242 | 3300044842 | Bacteria | 1079 |
| 196 | Ga0466959_0002124 | 3300045049 | Bacteria | 12544 |
| 197 | Ga0466959_0021570 | 3300045049 | Bacteria | 4753 |
| 198 | Ga0466959_0063627 | 3300045049 | Bacteria | 2678 |
| 199 | Ga0466959_0076389 | 3300045049 | Bacteria | 2418 |
| 200 | Ga0451576_0003730 | 3300045051 | Bacteria | 20605 |
| 201 | Ga0451576_0081461 | 3300045051 | Bacteria | 3366 |
| 202 | Ga0495617_000007 | 3300046452 | Bacteria | 369986 |
| 203 | Ga0495617_000138 | 3300046452 | Bacteria | 48070 |
| 204 | Ga0495617_000433 | 3300046452 | Bacteria | 22580 |
| 205 | Ga0495617_105191 | 3300046452 | Bacteria | 915 |
| 206 | Ga0495627_000174 | 3300046453 | Bacteria | 72709 |
| 207 | Ga0495627_001312 | 3300046453 | Bacteria | 15164 |
| 208 | Ga0495627_011935 | 3300046453 | Bacteria | 3096 |
| 209 | Ga0495603_0012022 | 3300046455 | Bacteria | 5240 |
| 210 | Ga0495590_0000004 | 3300046457 | Bacteria | 402091 |
| 211 | Ga0495590_0000007 | 3300046457 | Bacteria | 331108 |
| 212 | Ga0495590_0000287 | 3300046457 | Bacteria | 27199 |
| 213 | Ga0495590_0004196 | 3300046457 | Bacteria | 5828 |
| 214 | Ga0495591_000039 | 3300046458 | Bacteria | 156460 |
| 215 | Ga0495591_000310 | 3300046458 | Bacteria | 44305 |
| 216 | Ga0495629_0004670 | 3300046459 | Bacteria | 10260 |
| 217 | Ga0495629_0017142 | 3300046459 | Bacteria | 5195 |
| 218 | Ga0495638_0000023 | 3300046460 | Bacteria | 363063 |
| 219 | Ga0495638_0010460 | 3300046460 | Bacteria | 6436 |
| 220 | Ga0495638_0045065 | 3300046460 | Bacteria | 2776 |
| 221 | Ga0495638_0048659 | 3300046460 | Bacteria | 2653 |
| 222 | Ga0495638_0066732 | 3300046460 | Bacteria | 2211 |
| 223 | Ga0495653_0008794 | 3300046463 | Bacteria | 8271 |
| 224 | Ga0495653_0085772 | 3300046463 | Bacteria | 2315 |
| 225 | Ga0495653_0159421 | 3300046463 | Bacteria | 1567 |
| 226 | Ga0495650_0000154 | 3300046471 | Bacteria | 156130 |
| 227 | Ga0495650_0000320 | 3300046471 | Bacteria | 85951 |
| 228 | Ga0495650_0001964 | 3300046471 | Bacteria | 18158 |
| 229 | Ga0495650_0077965 | 3300046471 | Bacteria | 1284 |
| 230 | Ga0495580_0183491 | 3300046472 | Bacteria | 1444 |
| 231 | Ga0495580_0192523 | 3300046472 | Bacteria | 1406 |
| 232 | Ga0495582_0003493 | 3300046473 | Bacteria | 8853 |
| 233 | Ga0495582_0025219 | 3300046473 | Bacteria | 3257 |
| 234 | Ga0495582_0117379 | 3300046473 | Bacteria | 1497 |
| 235 | Ga0495605_0000133 | 3300046474 | Bacteria | 97036 |
| 236 | Ga0495605_0000169 | 3300046474 | Bacteria | 82458 |
| 237 | Ga0495605_0020011 | 3300046474 | Bacteria | 3561 |
| 238 | Ga0495605_0046434 | 3300046474 | Bacteria | 2135 |
| 239 | Ga0495605_0055141 | 3300046474 | Bacteria | 1921 |
| 240 | Ga0495639_0087431 | 3300046475 | Bacteria | 1459 |
| 241 | Ga0495584_0000010 | 3300046491 | Bacteria | 225095 |
| 242 | Ga0495584_0000678 | 3300046491 | Bacteria | 22636 |
| 243 | Ga0495584_0001011 | 3300046491 | Bacteria | 17554 |
| 244 | Ga0495584_0001901 | 3300046491 | Bacteria | 12038 |
| 245 | Ga0495584_0009175 | 3300046491 | Bacteria | 5100 |
| 246 | Ga0495584_0044712 | 3300046491 | Bacteria | 2234 |
| 247 | Ga0495584_0062617 | 3300046491 | Bacteria | 1869 |
| 248 | Ga0495584_0075250 | 3300046491 | Bacteria | 1697 |
| 249 | Ga0495584_0138493 | 3300046491 | Bacteria | 1235 |
| 250 | Ga0495584_0212819 | 3300046491 | Bacteria | 982 |
| 251 | Ga0495585_0000004 | 3300046492 | Bacteria | 348260 |
| 252 | Ga0495585_0000451 | 3300046492 | Bacteria | 39252 |
| 253 | Ga0495585_0000935 | 3300046492 | Bacteria | 24635 |
| 254 | Ga0495585_0001097 | 3300046492 | Bacteria | 22286 |
| 255 | Ga0495585_0001154 | 3300046492 | Bacteria | 21551 |
| 256 | Ga0495585_0001166 | 3300046492 | Bacteria | 21382 |
| 257 | Ga0495585_0001278 | 3300046492 | Bacteria | 20114 |
| 258 | Ga0495585_0003335 | 3300046492 | Bacteria | 10895 |
| 259 | Ga0495585_0024506 | 3300046492 | Bacteria | 3459 |
| 260 | Ga0495585_0046425 | 3300046492 | Bacteria | 2422 |
| 261 | Ga0495585_0047395 | 3300046492 | Bacteria | 2393 |
| 262 | Ga0495585_0063889 | 3300046492 | Bacteria | 2019 |
| 263 | Ga0495585_0102595 | 3300046492 | Bacteria | 1528 |
| 264 | Ga0495585_0130479 | 3300046492 | Bacteria | 1323 |
| 265 | Ga0495585_0283387 | 3300046492 | Bacteria | 818 |
| 266 | Ga0495594_0007839 | 3300046499 | Bacteria | 5491 |
| 267 | Ga0495594_0020081 | 3300046499 | Bacteria | 3557 |
| 268 | Ga0495596_0000608 | 3300046500 | Bacteria | 22479 |
| 269 | Ga0495596_0000617 | 3300046500 | Bacteria | 22347 |
| 270 | Ga0495596_0001806 | 3300046500 | Bacteria | 11900 |
| 271 | Ga0495596_0004514 | 3300046500 | Bacteria | 6766 |
| 272 | Ga0495596_0006947 | 3300046500 | Bacteria | 5153 |
| 273 | Ga0495596_0010807 | 3300046500 | Bacteria | 3961 |
| 274 | Ga0495596_0011029 | 3300046500 | Bacteria | 3912 |
| 275 | Ga0495596_0060511 | 3300046500 | Bacteria | 1475 |
| 276 | Ga0495607_0000261 | 3300046501 | Bacteria | 56378 |
| 277 | Ga0495607_0001157 | 3300046501 | Bacteria | 23898 |
| 278 | Ga0495607_0002475 | 3300046501 | Bacteria | 14990 |
| 279 | Ga0495607_0007573 | 3300046501 | Bacteria | 7493 |
| 280 | Ga0495607_0018160 | 3300046501 | Bacteria | 4490 |
| 281 | Ga0495607_0032895 | 3300046501 | Bacteria | 3159 |
| 282 | Ga0495607_0033200 | 3300046501 | Bacteria | 3141 |
| 283 | Ga0495607_0179741 | 3300046501 | Bacteria | 1061 |
| 284 | Ga0495583_0000084 | 3300046506 | Bacteria | 165375 |
| 285 | Ga0495583_0001335 | 3300046506 | Bacteria | 25594 |
| 286 | Ga0495583_0001776 | 3300046506 | Bacteria | 20548 |
| 287 | Ga0495583_0002955 | 3300046506 | Bacteria | 13660 |
| 288 | Ga0495583_0003212 | 3300046506 | Bacteria | 12790 |
| 289 | Ga0495583_0005922 | 3300046506 | Bacteria | 8122 |
| 290 | Ga0495583_0031730 | 3300046506 | Bacteria | 2557 |
| 291 | Ga0495583_0045571 | 3300046506 | Bacteria | 2027 |
| 292 | Ga0495583_0051211 | 3300046506 | Bacteria | 1883 |
| 293 | Ga0495583_0115797 | 3300046506 | Bacteria | 1132 |
| 294 | Ga0495583_0124301 | 3300046506 | Bacteria | 1083 |
| 295 | Ga0495606_0000037 | 3300046507 | Bacteria | 231282 |
| 296 | Ga0495606_0000402 | 3300046507 | Bacteria | 73035 |
| 297 | Ga0495606_0000533 | 3300046507 | Bacteria | 61375 |
| 298 | Ga0495606_0000576 | 3300046507 | Bacteria | 58266 |
| 299 | Ga0495606_0000982 | 3300046507 | Bacteria | 41525 |
| 300 | Ga0495606_0002384 | 3300046507 | Bacteria | 22041 |
| 301 | Ga0495606_0002810 | 3300046507 | Bacteria | 19380 |
| 302 | Ga0495606_0003445 | 3300046507 | Bacteria | 16787 |
| 303 | Ga0495606_0009074 | 3300046507 | Bacteria | 8480 |
| 304 | Ga0495606_0012562 | 3300046507 | Bacteria | 6780 |
| 305 | Ga0495606_0019010 | 3300046507 | Bacteria | 5131 |
| 306 | Ga0495606_0039354 | 3300046507 | Bacteria | 3188 |
| 307 | Ga0495606_0050693 | 3300046507 | Bacteria | 2713 |
| 308 | Ga0495606_0052508 | 3300046507 | Bacteria | 2650 |
| 309 | Ga0495606_0055725 | 3300046507 | Bacteria | 2555 |
| 310 | Ga0495606_0128971 | 3300046507 | Bacteria | 1505 |
| 311 | Ga0495606_0148232 | 3300046507 | Bacteria | 1379 |
| 312 | Ga0495606_0216569 | 3300046507 | Bacteria | 1081 |
| 313 | Ga0495606_0224489 | 3300046507 | Bacteria | 1056 |
| 314 | Ga0495610_0000004 | 3300046512 | Bacteria | 1006135 |
| 315 | Ga0495610_0000128 | 3300046512 | Bacteria | 83166 |
| 316 | Ga0495610_0000428 | 3300046512 | Bacteria | 43253 |
| 317 | Ga0495610_0001171 | 3300046512 | Bacteria | 23803 |
| 318 | Ga0495610_0005473 | 3300046512 | Bacteria | 9016 |
| 319 | Ga0495610_0021762 | 3300046512 | Bacteria | 3520 |
| 320 | Ga0495610_0024589 | 3300046512 | Bacteria | 3247 |
| 321 | Ga0495616_0000269 | 3300046513 | Bacteria | 42108 |
| 322 | Ga0495616_0000344 | 3300046513 | Bacteria | 36907 |
| 323 | Ga0495616_0001060 | 3300046513 | Bacteria | 19653 |
| 324 | Ga0495616_0001272 | 3300046513 | Bacteria | 17715 |
| 325 | Ga0495616_0001627 | 3300046513 | Bacteria | 15387 |
| 326 | Ga0495616_0002122 | 3300046513 | Bacteria | 13291 |
| 327 | Ga0495616_0012422 | 3300046513 | Bacteria | 4836 |
| 328 | Ga0495616_0014231 | 3300046513 | Bacteria | 4462 |
| 329 | Ga0495616_0019934 | 3300046513 | Bacteria | 3653 |
| 330 | Ga0495616_0028294 | 3300046513 | Bacteria | 2968 |
| 331 | Ga0495616_0034553 | 3300046513 | Bacteria | 2625 |
| 332 | Ga0495616_0048310 | 3300046513 | Bacteria | 2139 |
| 333 | Ga0495616_0069156 | 3300046513 | Bacteria | 1713 |
| 334 | Ga0495616_0079823 | 3300046513 | Bacteria | 1567 |
| 335 | Ga0495620_0025247 | 3300046515 | Bacteria | 2814 |
| 336 | Ga0495630_0258890 | 3300046517 | Bacteria | 1329 |
| 337 | Ga0495631_0000886 | 3300046518 | Bacteria | 18737 |
| 338 | Ga0495631_0003700 | 3300046518 | Bacteria | 8341 |
| 339 | Ga0495631_0021272 | 3300046518 | Bacteria | 3021 |
| 340 | Ga0495631_0024386 | 3300046518 | Bacteria | 2792 |
| 341 | Ga0495631_0027447 | 3300046518 | Bacteria | 2605 |
| 342 | Ga0495631_0042274 | 3300046518 | Bacteria | 2014 |
| 343 | Ga0495632_0000504 | 3300046519 | Bacteria | 36804 |
| 344 | Ga0495632_0001557 | 3300046519 | Bacteria | 18923 |
| 345 | Ga0495632_0006690 | 3300046519 | Bacteria | 7369 |
| 346 | Ga0495632_0009303 | 3300046519 | Bacteria | 5932 |
| 347 | Ga0495632_0032005 | 3300046519 | Bacteria | 2713 |
| 348 | Ga0495637_0000006 | 3300046520 | Bacteria | 435763 |
| 349 | Ga0495637_0000223 | 3300046520 | Bacteria | 43805 |
| 350 | Ga0495637_0024391 | 3300046520 | Bacteria | 2737 |
| 351 | Ga0495643_0000196 | 3300046522 | Bacteria | 95989 |
| 352 | Ga0495643_0000239 | 3300046522 | Bacteria | 82416 |
| 353 | Ga0495643_0003999 | 3300046522 | Bacteria | 10530 |
| 354 | Ga0495643_0130596 | 3300046522 | Bacteria | 1261 |
| 355 | Ga0495643_0219819 | 3300046522 | Bacteria | 902 |
| 356 | Ga0495644_0012766 | 3300046523 | Bacteria | 3229 |
| 357 | Ga0495644_0037310 | 3300046523 | Bacteria | 1833 |
| 358 | Ga0495644_0051309 | 3300046523 | Bacteria | 1549 |
| 359 | Ga0495648_0000007 | 3300046524 | Bacteria | 347305 |
| 360 | Ga0495648_0001034 | 3300046524 | Bacteria | 28205 |
| 361 | Ga0495648_0002116 | 3300046524 | Bacteria | 18701 |
| 362 | Ga0495648_0005003 | 3300046524 | Bacteria | 11135 |
| 363 | Ga0495648_0009830 | 3300046524 | Bacteria | 7352 |
| 364 | Ga0495648_0018262 | 3300046524 | Bacteria | 4976 |
| 365 | Ga0495648_0029372 | 3300046524 | Bacteria | 3649 |
| 366 | Ga0495648_0029956 | 3300046524 | Bacteria | 3605 |
| 367 | Ga0495648_0088687 | 3300046524 | Bacteria | 1738 |
| 368 | Ga0495648_0149311 | 3300046524 | Bacteria | 1221 |
| 369 | Ga0495648_0162848 | 3300046524 | Bacteria | 1151 |
| 370 | Ga0495663_0073619 | 3300046525 | Bacteria | 1091 |
| 371 | Ga0495663_0074604 | 3300046525 | Bacteria | 1084 |
| 372 | Ga0495666_0047360 | 3300046526 | Bacteria | 2070 |
| 373 | Ga0495666_0075095 | 3300046526 | Bacteria | 1603 |
| 374 | Ga0495642_0000383 | 3300046528 | Bacteria | 23859 |
| 375 | Ga0495642_0000499 | 3300046528 | Bacteria | 20174 |
| 376 | Ga0495642_0001165 | 3300046528 | Bacteria | 12065 |
| 377 | Ga0495642_0001497 | 3300046528 | Bacteria | 10432 |
| 378 | Ga0495642_0001671 | 3300046528 | Bacteria | 9619 |
| 379 | Ga0495642_0019207 | 3300046528 | Bacteria | 2678 |
| 380 | Ga0495642_0053029 | 3300046528 | Bacteria | 1670 |
| 381 | Ga0495642_0072656 | 3300046528 | Bacteria | 1440 |
| 382 | Ga0495642_0102339 | 3300046528 | Bacteria | 1220 |
| 383 | Ga0495642_0120098 | 3300046528 | Bacteria | 1127 |
| 384 | Ga0495652_0024781 | 3300046529 | Bacteria | 5309 |
| 385 | Ga0495652_0086848 | 3300046529 | Bacteria | 2567 |
| 386 | Ga0495654_0000004 | 3300046530 | Bacteria | 515304 |
| 387 | Ga0495654_0001755 | 3300046530 | Bacteria | 14525 |
| 388 | Ga0495654_0001896 | 3300046530 | Bacteria | 13905 |
| 389 | Ga0495654_0003847 | 3300046530 | Bacteria | 9067 |
| 390 | Ga0495654_0006878 | 3300046530 | Bacteria | 6415 |
| 391 | Ga0495654_0010948 | 3300046530 | Bacteria | 4927 |
| 392 | Ga0495665_0053775 | 3300046531 | Bacteria | 2128 |
| 393 | Ga0495665_0082749 | 3300046531 | Bacteria | 1687 |
| 394 | Ga0495586_0005660 | 3300046535 | Bacteria | 6681 |
| 395 | Ga0495587_0009893 | 3300046536 | Bacteria | 6085 |
| 396 | Ga0495587_0303542 | 3300046536 | Bacteria | 892 |
| 397 | Ga0495609_0000545 | 3300046538 | Bacteria | 29804 |
| 398 | Ga0495609_0000732 | 3300046538 | Bacteria | 24952 |
| 399 | Ga0495609_0000832 | 3300046538 | Bacteria | 22914 |
| 400 | Ga0495609_0000847 | 3300046538 | Bacteria | 22600 |
| 401 | Ga0495609_0000856 | 3300046538 | Bacteria | 22445 |
| 402 | Ga0495609_0004528 | 3300046538 | Bacteria | 7562 |
| 403 | Ga0495609_0009843 | 3300046538 | Bacteria | 4609 |
| 404 | Ga0495609_0021589 | 3300046538 | Bacteria | 2970 |
| 405 | Ga0495609_0038242 | 3300046538 | Bacteria | 2163 |
| 406 | Ga0495609_0059848 | 3300046538 | Bacteria | 1684 |
| 407 | Ga0495609_0138079 | 3300046538 | Bacteria | 1041 |
| 408 | Ga0495597_0000239 | 3300046542 | Bacteria | 49769 |
| 409 | Ga0495597_0000479 | 3300046542 | Bacteria | 33628 |
| 410 | Ga0495597_0000496 | 3300046542 | Bacteria | 32885 |
| 411 | Ga0495597_0000621 | 3300046542 | Bacteria | 28981 |
| 412 | Ga0495597_0001375 | 3300046542 | Bacteria | 17590 |
| 413 | Ga0495597_0136501 | 3300046542 | Bacteria | 1014 |
| 414 | Ga0495597_0136802 | 3300046542 | Bacteria | 1012 |
| 415 | Ga0495645_0211932 | 3300046543 | Bacteria | 1307 |
| 416 | Ga0495622_0000003 | 3300046557 | Bacteria | 268681 |
| 417 | Ga0495622_0007635 | 3300046557 | Bacteria | 5023 |
| 418 | Ga0495622_0089412 | 3300046557 | Bacteria | 1415 |
| 419 | Ga0495633_0000541 | 3300046558 | Bacteria | 37760 |
| 420 | Ga0495633_0001029 | 3300046558 | Bacteria | 22793 |
| 421 | Ga0495633_0002925 | 3300046558 | Bacteria | 11708 |
| 422 | Ga0495633_0003831 | 3300046558 | Bacteria | 9838 |
| 423 | Ga0495633_0005412 | 3300046558 | Bacteria | 7818 |
| 424 | Ga0495633_0015370 | 3300046558 | Bacteria | 3972 |
| 425 | Ga0495633_0016694 | 3300046558 | Bacteria | 3778 |
| 426 | Ga0495633_0020676 | 3300046558 | Bacteria | 3306 |
| 427 | Ga0495633_0027375 | 3300046558 | Bacteria | 2787 |
| 428 | Ga0495633_0028557 | 3300046558 | Bacteria | 2717 |
| 429 | Ga0495633_0043503 | 3300046558 | Bacteria | 2131 |
| 430 | Ga0495633_0167059 | 3300046558 | Bacteria | 1014 |
| 431 | Ga0495656_0007063 | 3300046615 | Bacteria | 3958 |
| 432 | Ga0495656_0037398 | 3300046615 | Bacteria | 2005 |
| 433 | Ga0495656_0041726 | 3300046615 | Bacteria | 1918 |
| 434 | Ga0495656_0061928 | 3300046615 | Bacteria | 1636 |
| 435 | Ga0495668_0000049 | 3300046616 | Bacteria | 217657 |
| 436 | Ga0495668_0000051 | 3300046616 | Bacteria | 214532 |
| 437 | Ga0495668_0001802 | 3300046616 | Bacteria | 19550 |
| 438 | Ga0495668_0001821 | 3300046616 | Bacteria | 19337 |
| 439 | Ga0495668_0002559 | 3300046616 | Bacteria | 14773 |
| 440 | Ga0495668_0003825 | 3300046616 | Bacteria | 11023 |
| 441 | Ga0495668_0011300 | 3300046616 | Bacteria | 5356 |
| 442 | Ga0495668_0043218 | 3300046616 | Bacteria | 2507 |
| 443 | Ga0495668_0064421 | 3300046616 | Bacteria | 2017 |
| 444 | Ga0495668_0105447 | 3300046616 | Bacteria | 1542 |
| 445 | Ga0495668_0271193 | 3300046616 | Bacteria | 929 |
| 446 | Ga0495634_0058086 | 3300046642 | Bacteria | 2580 |
| 447 | Ga0495611_0000496 | 3300046648 | Bacteria | 23480 |
| 448 | Ga0495611_0054994 | 3300046648 | Bacteria | 1800 |
| 449 | Ga0495611_0061461 | 3300046648 | Bacteria | 1707 |
| 450 | Ga0495611_0243923 | 3300046648 | Bacteria | 833 |
| 451 | Ga0495625_0023566 | 3300046660 | Bacteria | 4700 |
| 452 | Ga0495625_0035638 | 3300046660 | Bacteria | 3666 |
| 453 | Ga0495625_0085276 | 3300046660 | Bacteria | 2192 |
| 454 | Ga0495625_0131054 | 3300046660 | Bacteria | 1698 |
| 455 | Ga0495625_0172548 | 3300046660 | Bacteria | 1443 |
| 456 | Ga0495625_0254275 | 3300046660 | Bacteria | 1139 |
| 457 | Ga0495625_0341234 | 3300046660 | Bacteria | 949 |
| 458 | Ga0495635_0020507 | 3300046663 | Bacteria | 4604 |
| 459 | Ga0495659_0018014 | 3300046664 | Bacteria | 2349 |
| 460 | Ga0495659_0034369 | 3300046664 | Bacteria | 1782 |
| 461 | Ga0495661_0000338 | 3300046665 | Bacteria | 51135 |
| 462 | Ga0495661_0000651 | 3300046665 | Bacteria | 35125 |
| 463 | Ga0495661_0000802 | 3300046665 | Bacteria | 29694 |
| 464 | Ga0495661_0012141 | 3300046665 | Bacteria | 5820 |
| 465 | Ga0495661_0012900 | 3300046665 | Bacteria | 5630 |
| 466 | Ga0495661_0020847 | 3300046665 | Bacteria | 4273 |
| 467 | Ga0495661_0023696 | 3300046665 | Bacteria | 3979 |
| 468 | Ga0495661_0057951 | 3300046665 | Bacteria | 2310 |
| 469 | Ga0495661_0088408 | 3300046665 | Bacteria | 1768 |
| 470 | Ga0495661_0121830 | 3300046665 | Bacteria | 1439 |
| 471 | Ga0495661_0126846 | 3300046665 | Bacteria | 1403 |
| 472 | Ga0495661_0134896 | 3300046665 | Bacteria | 1348 |
| 473 | Ga0495661_0198110 | 3300046665 | Bacteria | 1053 |
| 474 | Ga0495588_0000226 | 3300046674 | Bacteria | 51538 |
| 475 | Ga0495588_0000447 | 3300046674 | Bacteria | 20763 |
| 476 | Ga0495588_0017069 | 3300046674 | Bacteria | 3518 |
| 477 | Ga0495588_0017445 | 3300046674 | Bacteria | 3487 |
| 478 | Ga0495588_0031570 | 3300046674 | Bacteria | 2667 |
| 479 | Ga0495588_0032033 | 3300046674 | Bacteria | 2649 |
| 480 | Ga0495588_0111710 | 3300046674 | Bacteria | 1439 |
| 481 | Ga0495588_0247320 | 3300046674 | Bacteria | 940 |
| 482 | Ga0495623_0065228 | 3300046679 | Bacteria | 2277 |
| 483 | Ga0495669_0001886 | 3300046684 | Bacteria | 8601 |
| 484 | Ga0495669_0010859 | 3300046684 | Bacteria | 3855 |
| 485 | Ga0495669_0020156 | 3300046684 | Bacteria | 2883 |
| 486 | Ga0495669_0067605 | 3300046684 | Bacteria | 1624 |
| 487 | Ga0495613_0107974 | 3300046689 | Bacteria | 2007 |
| 488 | Ga0495624_0013524 | 3300046690 | Bacteria | 5564 |
| 489 | Ga0495670_0007797 | 3300046691 | Bacteria | 5265 |
| 490 | Ga0495670_0009193 | 3300046691 | Bacteria | 4859 |
| 491 | Ga0495670_0024751 | 3300046691 | Bacteria | 2967 |
| 492 | Ga0495670_0040525 | 3300046691 | Bacteria | 2322 |
| 493 | Ga0495670_0048885 | 3300046691 | Bacteria | 2115 |
| 494 | Ga0495671_0000070 | 3300046692 | Bacteria | 97889 |
| 495 | Ga0495671_0000192 | 3300046692 | Bacteria | 53483 |
| 496 | Ga0495671_0000422 | 3300046692 | Bacteria | 33738 |
| 497 | Ga0495671_0000483 | 3300046692 | Bacteria | 30968 |
| 498 | Ga0495671_0000602 | 3300046692 | Bacteria | 26521 |
| 499 | Ga0495671_0001766 | 3300046692 | Bacteria | 13995 |
| 500 | Ga0495671_0013388 | 3300046692 | Bacteria | 4445 |
| 501 | Ga0495671_0041693 | 3300046692 | Bacteria | 2310 |
| 502 | Ga0495671_0046098 | 3300046692 | Bacteria | 2180 |
| 503 | Ga0495671_0072158 | 3300046692 | Bacteria | 1695 |
| 504 | Ga0495671_0157021 | 3300046692 | Bacteria | 1107 |
| 505 | Ga0495649_0000184 | 3300046694 | Bacteria | 54636 |
| 506 | Ga0495649_0000424 | 3300046694 | Bacteria | 36607 |
| 507 | Ga0495649_0057588 | 3300046694 | Bacteria | 2095 |
| 508 | Ga0495649_0123385 | 3300046694 | Bacteria | 1369 |
| 509 | Ga0495649_0183789 | 3300046694 | Bacteria | 1090 |
| 510 | Ga0495589_0000188 | 3300046794 | Bacteria | 54693 |
| 511 | Ga0495589_0000921 | 3300046794 | Bacteria | 18055 |
| 512 | Ga0495589_0008404 | 3300046794 | Bacteria | 5396 |
| 513 | Ga0495589_0014417 | 3300046794 | Bacteria | 4070 |
| 514 | Ga0495589_0020128 | 3300046794 | Bacteria | 3413 |
| 515 | Ga0495600_0109674 | 3300046809 | Bacteria | 1797 |
| 516 | Ga0495660_0000394 | 3300046810 | Bacteria | 37748 |
| 517 | Ga0495660_0001755 | 3300046810 | Bacteria | 14449 |
| 518 | Ga0495660_0002473 | 3300046810 | Bacteria | 11777 |
| 519 | Ga0495660_0027715 | 3300046810 | Bacteria | 3203 |
| 520 | Ga0495660_0055373 | 3300046810 | Bacteria | 2147 |
| 521 | Ga0495660_0066006 | 3300046810 | Bacteria | 1930 |
| 522 | Ga0495660_0131388 | 3300046810 | Bacteria | 1256 |
| 523 | Ga0495660_0158241 | 3300046810 | Bacteria | 1113 |
| 524 | Ga0495581_0490654 | 3300047315 | Bacteria | 714 |
| 525 | Ga0495604_0007372 | 3300047317 | Bacteria | 8715 |
| 526 | Ga0495636_0017913 | 3300047318 | Bacteria | 2838 |
| 527 | Ga0495636_0074010 | 3300047318 | Bacteria | 1458 |
| 528 | Ga0495674_0003686 | 3300047319 | Bacteria | 14897 |
| 529 | Ga0495672_0000015 | 3300047320 | Bacteria | 502855 |
| 530 | Ga0495672_0000441 | 3300047320 | Bacteria | 49584 |
| 531 | Ga0495672_0000695 | 3300047320 | Bacteria | 37258 |
| 532 | Ga0495672_0001226 | 3300047320 | Bacteria | 25838 |
| 533 | Ga0495672_0046603 | 3300047320 | Bacteria | 2584 |
| 534 | Ga0495672_0100740 | 3300047320 | Bacteria | 1567 |
| 535 | Ga0495676_0000014 | 3300047321 | Bacteria | 203356 |
| 536 | Ga0495676_0005083 | 3300047321 | Bacteria | 12068 |
| 537 | Ga0495676_0056475 | 3300047321 | Bacteria | 3104 |
| 538 | Ga0495676_0112139 | 3300047321 | Bacteria | 1999 |
| 539 | Ga0495680_0013638 | 3300047322 | Bacteria | 7080 |
| 540 | Ga0495683_0000180 | 3300047323 | Bacteria | 62230 |
| 541 | Ga0495683_0000306 | 3300047323 | Bacteria | 41377 |
| 542 | Ga0495683_0002293 | 3300047323 | Bacteria | 11661 |
| 543 | Ga0495683_0007893 | 3300047323 | Bacteria | 5712 |
| 544 | Ga0495683_0034699 | 3300047323 | Bacteria | 2565 |
| 545 | Ga0495683_0060138 | 3300047323 | Bacteria | 1883 |
| 546 | Ga0495683_0070268 | 3300047323 | Bacteria | 1719 |
| 547 | Ga0495683_0080155 | 3300047323 | Bacteria | 1594 |
| 548 | Ga0495683_0118400 | 3300047323 | Bacteria | 1259 |
| 549 | Ga0495683_0135778 | 3300047323 | Bacteria | 1156 |
| 550 | Ga0495687_000049 | 3300047443 | Bacteria | 205432 |
| 551 | Ga0495687_000088 | 3300047443 | Bacteria | 142499 |
| 552 | Ga0495687_000533 | 3300047443 | Bacteria | 45573 |
| 553 | Ga0495687_000732 | 3300047443 | Bacteria | 36155 |
| 554 | Ga0495687_000848 | 3300047443 | Bacteria | 32587 |
| 555 | Ga0495687_000928 | 3300047443 | Bacteria | 30405 |
| 556 | Ga0495687_001000 | 3300047443 | Bacteria | 28318 |
| 557 | Ga0495687_026413 | 3300047443 | Bacteria | 2733 |
| 558 | Ga0495687_034718 | 3300047443 | Bacteria | 2275 |
| 559 | Ga0495675_0011916 | 3300047444 | Bacteria | 5463 |
| 560 | Ga0495677_0000286 | 3300047445 | Bacteria | 22170 |
| 561 | Ga0495677_0003083 | 3300047445 | Bacteria | 6484 |
| 562 | Ga0495677_0003494 | 3300047445 | Bacteria | 6097 |
| 563 | Ga0495677_0010972 | 3300047445 | Bacteria | 3319 |
| 564 | Ga0495677_0053896 | 3300047445 | Bacteria | 1483 |
| 565 | Ga0495677_0090213 | 3300047445 | Bacteria | 1154 |
| 566 | Ga0495679_000965 | 3300047446 | Bacteria | 17777 |
| 567 | Ga0495679_000979 | 3300047446 | Bacteria | 17640 |
| 568 | Ga0495679_004840 | 3300047446 | Bacteria | 6084 |
| 569 | Ga0495679_011850 | 3300047446 | Bacteria | 3348 |
| 570 | Ga0495679_015636 | 3300047446 | Bacteria | 2769 |
| 571 | Ga0495679_017285 | 3300047446 | Bacteria | 2585 |
| 572 | Ga0495685_008963 | 3300047447 | Bacteria | 3334 |
| 573 | Ga0495685_009579 | 3300047447 | Bacteria | 3240 |
| 574 | Ga0495673_0000017 | 3300047469 | Bacteria | 574970 |
| 575 | Ga0495673_0000027 | 3300047469 | Bacteria | 475440 |
| 576 | Ga0495673_0005555 | 3300047469 | Bacteria | 7596 |
| 577 | Ga0495673_0024772 | 3300047469 | Bacteria | 2892 |
| 578 | Ga0495681_0000073 | 3300047470 | Bacteria | 92561 |
| 579 | Ga0495681_0000127 | 3300047470 | Bacteria | 67389 |
| 580 | Ga0495681_0000168 | 3300047470 | Bacteria | 54934 |
| 581 | Ga0495681_0012405 | 3300047470 | Bacteria | 5007 |
| 582 | Ga0495681_0012756 | 3300047470 | Bacteria | 4918 |
| 583 | Ga0495681_0012820 | 3300047470 | Bacteria | 4902 |
| 584 | Ga0495681_0033177 | 3300047470 | Bacteria | 2590 |
| 585 | Ga0495681_0060135 | 3300047470 | Bacteria | 1754 |
| 586 | Ga0495681_0069432 | 3300047470 | Bacteria | 1600 |
| 587 | Ga0495686_0000696 | 3300047472 | Bacteria | 45475 |
| 588 | Ga0495686_0001565 | 3300047472 | Bacteria | 24374 |
| 589 | Ga0495686_0009279 | 3300047472 | Bacteria | 7104 |
| 590 | Ga0495686_0011457 | 3300047472 | Bacteria | 6244 |
| 591 | Ga0495686_0018422 | 3300047472 | Bacteria | 4687 |
| 592 | Ga0495686_0021104 | 3300047472 | Bacteria | 4332 |
| 593 | Ga0495686_0114693 | 3300047472 | Bacteria | 1612 |
| 594 | Ga0495602_0001704 | 3300048088 | Bacteria | 21874 |
| 595 | Ga0495602_0264797 | 3300048088 | Bacteria | 1273 |
| 596 | Ga0495614_0016008 | 3300048089 | Bacteria | 3265 |
| 597 | Ga0495614_0103412 | 3300048089 | Bacteria | 1247 |
| 598 | Ga0495626_0000677 | 3300048091 | Bacteria | 32591 |
| 599 | Ga0495626_0001122 | 3300048091 | Bacteria | 22502 |
| 600 | Ga0495626_0001575 | 3300048091 | Bacteria | 17878 |
| 601 | Ga0495626_0001656 | 3300048091 | Bacteria | 17198 |
| 602 | Ga0495626_0002929 | 3300048091 | Bacteria | 11365 |
| 603 | Ga0495626_0003190 | 3300048091 | Bacteria | 10672 |
| 604 | Ga0495626_0003269 | 3300048091 | Bacteria | 10478 |
| 605 | Ga0495626_0007954 | 3300048091 | Bacteria | 5863 |
| 606 | Ga0495626_0019732 | 3300048091 | Bacteria | 3367 |
| 607 | Ga0495626_0023535 | 3300048091 | Bacteria | 3032 |
| 608 | Ga0495626_0044686 | 3300048091 | Bacteria | 2071 |
| 609 | Ga0495626_0061379 | 3300048091 | Bacteria | 1709 |
| 610 | Ga0495626_0094654 | 3300048091 | Bacteria | 1309 |
| 611 | Ga0495626_0150249 | 3300048091 | Bacteria | 982 |
| 612 | Ga0495626_0150256 | 3300048091 | Bacteria | 982 |
| 613 | Ga0496100_0232150 | 3300048903 | Bacteria | 1358 |
| 614 | Ga0496101_0009552 | 3300048904 | Bacteria | 6377 |
| 615 | Ga0496102_0002678 | 3300048905 | Bacteria | 15150 |
| 616 | Ga0496102_0179889 | 3300048905 | Bacteria | 1992 |
| 617 | Ga0496102_0286742 | 3300048905 | Bacteria | 1552 |
| 618 | Ga0496103_0008794 | 3300048906 | Bacteria | 5992 |
| 619 | Ga0496103_0019302 | 3300048906 | Bacteria | 4094 |
| 620 | Ga0496103_0150959 | 3300048906 | Bacteria | 1488 |
| 621 | Ga0496104_0047423 | 3300048907 | Bacteria | 4049 |
| 622 | Ga0496105_0257209 | 3300048908 | Bacteria | 1413 |
| 623 | Ga0496106_0006898 | 3300048909 | Bacteria | 8403 |
| 624 | Ga0496106_0070812 | 3300048909 | Bacteria | 2664 |
| 625 | Ga0496109_0006624 | 3300048912 | Bacteria | 9754 |
| 626 | Ga0496110_0000065 | 3300048913 | Bacteria | 52525 |
| 627 | Ga0496110_0252368 | 3300048913 | Bacteria | 1605 |
| 628 | Ga0496111_0032691 | 3300048914 | Bacteria | 3710 |
| 629 | Ga0496111_0214931 | 3300048914 | Bacteria | 1428 |
| 630 | Ga0496115_0001661 | 3300048918 | Bacteria | 15999 |
| 631 | Ga0496115_0025058 | 3300048918 | Bacteria | 4641 |
| 632 | Ga0496116_0002320 | 3300048919 | Bacteria | 20148 |
| 633 | Ga0496116_0008949 | 3300048919 | Bacteria | 8610 |
| 634 | Ga0496116_0020781 | 3300048919 | Bacteria | 4973 |
| 635 | Ga0496117_0030586 | 3300048920 | Bacteria | 4128 |
| 636 | Ga0496117_0056551 | 3300048920 | Bacteria | 2731 |
| 637 | Ga0496118_0120057 | 3300048921 | Bacteria | 1716 |
| 638 | Ga0496118_0155211 | 3300048921 | Bacteria | 1425 |
| 639 | Ga0496118_0188913 | 3300048921 | Bacteria | 1234 |
| 640 | Ga0496119_0005089 | 3300048922 | Bacteria | 12762 |
| 641 | Ga0496119_0008370 | 3300048922 | Bacteria | 9100 |
| 642 | Ga0496119_0022762 | 3300048922 | Bacteria | 4473 |
| 643 | Ga0496119_0183336 | 3300048922 | Bacteria | 1096 |
| 644 | Ga0496120_0003966 | 3300048923 | Bacteria | 12866 |
| 645 | Ga0496120_0051956 | 3300048923 | Bacteria | 2337 |
| 646 | Ga0496121_0023379 | 3300048924 | Bacteria | 5955 |
| 647 | Ga0496122_0000169 | 3300048925 | Bacteria | 155380 |
| 648 | Ga0496122_0003279 | 3300048925 | Bacteria | 21451 |
| 649 | Ga0496122_0053369 | 3300048925 | Bacteria | 3048 |
| 650 | Ga0496123_0001393 | 3300048926 | Bacteria | 33882 |
| 651 | Ga0496123_0001911 | 3300048926 | Bacteria | 27177 |
| 652 | Ga0496123_0002716 | 3300048926 | Bacteria | 21264 |
| 653 | Ga0496123_0003363 | 3300048926 | Bacteria | 18084 |
| 654 | Ga0496124_0000484 | 3300048927 | Bacteria | 68281 |
| 655 | Ga0496124_0006649 | 3300048927 | Bacteria | 12541 |
| 656 | Ga0496124_0010167 | 3300048927 | Bacteria | 9568 |
| 657 | Ga0496124_0011735 | 3300048927 | Bacteria | 8738 |
| 658 | Ga0496124_0064232 | 3300048927 | Bacteria | 3065 |
| 659 | Ga0496124_0185603 | 3300048927 | Bacteria | 1596 |
| 660 | Ga0496124_0265532 | 3300048927 | Bacteria | 1260 |
| 661 | Ga0496124_0416224 | 3300048927 | Bacteria | 928 |
| 662 | Ga0496125_0000916 | 3300048928 | Bacteria | 46400 |
| 663 | Ga0496125_0004916 | 3300048928 | Bacteria | 15128 |
| 664 | Ga0496125_0051385 | 3300048928 | Bacteria | 3400 |
| 665 | Ga0496125_0127054 | 3300048928 | Bacteria | 1804 |
| 666 | Ga0496125_0131621 | 3300048928 | Bacteria | 1760 |
| 667 | Ga0496126_0001412 | 3300048929 | Bacteria | 38001 |
| 668 | Ga0496126_0104768 | 3300048929 | Bacteria | 2471 |
| 669 | Ga0495678_000056 | 3300049459 | Bacteria | 149598 |
| 670 | Ga0495678_000079 | 3300049459 | Bacteria | 122038 |
| 671 | Ga0495678_000449 | 3300049459 | Bacteria | 40814 |
| 672 | Ga0495678_000565 | 3300049459 | Bacteria | 35612 |
| 673 | Ga0495678_006643 | 3300049459 | Bacteria | 6121 |
| 674 | Ga0495682_0000095 | 3300049460 | Bacteria | 77918 |
| 675 | Ga0495682_0000378 | 3300049460 | Bacteria | 32210 |
| 676 | Ga0495682_0000610 | 3300049460 | Bacteria | 24098 |
| 677 | Ga0495682_0011263 | 3300049460 | Bacteria | 3442 |
| 678 | Ga0495682_0040989 | 3300049460 | Bacteria | 1697 |
| 679 | Ga0495682_0046845 | 3300049460 | Bacteria | 1577 |
| 680 | Ga0495682_0196966 | 3300049460 | Bacteria | 715 |
| 681 | Ga0501034_0387661 | 3300049571 | Bacteria | 1321 |
| 682 | Ga0501036_0115471 | 3300049572 | Bacteria | 2268 |
| 683 | Ga0501041_0194118 | 3300049577 | Bacteria | 1272 |
| 684 | Ga0501046_0073916 | 3300049580 | Bacteria | 2644 |
| 685 | Ga0501047_0092639 | 3300049581 | Bacteria | 2900 |
| 686 | Ga0501047_0274909 | 3300049581 | Bacteria | 1530 |
| 687 | Ga0501073_0225096 | 3300049589 | Bacteria | 1296 |
| 688 | Ga0501076_0244872 | 3300049592 | Bacteria | 1467 |
| 689 | Ga0501240_019454 | 3300049673 | Bacteria | 1009 |
| 690 | Ga0501080_0025339 | 3300049742 | Bacteria | 5503 |
| 691 | Ga0501083_0128850 | 3300049744 | Bacteria | 1659 |
| 692 | Ga0501035_0003724 | 3300049822 | Bacteria | 14537 |
| 693 | Ga0501044_0237922 | 3300049823 | Bacteria | 1766 |
| 694 | nmdc:mga08x19_211136_c1 | 3300050514 | Bacteria | 1332 |
| 695 | Ga0500618_000138 | 3300053125 | Bacteria | 61503 |
| 696 | Ga0587068_012394 | 3300059641 | Bacteria | 1300 |
| 697 | Ga0587107_007464 | 3300059652 | Bacteria | 1233 |
| 698 | 2511273008 | 2511231007 | Bacteria | 6306603 |
| 699 | 2513555954 | 2513237082 | Bacteria | 8640282 |
| 700 | 2516017127 | 2515154189 | Bacteria | 9629850 |
| 701 | 2554818575 | 2554235132 | Bacteria | 6772433 |
| 702 | 2599411448 | 2599185169 | Bacteria | 5441380 |
| 703 | 2601522956 | 2600255254 | Bacteria | 5281859 |
| 704 | 2601527983 | 2600255255 | Bacteria | 5282785 |
| 705 | 2601614817 | 2600255280 | Bacteria | 5292309 |
| 706 | 2601619534 | 2600255281 | Bacteria | 5288753 |
| 707 | 2601641871 | 2600255287 | Bacteria | 5210468 |
| 708 | 2601646708 | 2600255288 | Bacteria | 5282738 |
| 709 | 2601656347 | 2600255289 | Bacteria | 5281907 |
| 710 | 2601658287 | 2600255290 | Bacteria | 5282218 |
| 711 | 2601665911 | 2600255291 | Bacteria | 5217298 |
| 712 | 2601698768 | 2600255298 | Bacteria | 5215185 |
| 713 | 2601701614 | 2600255299 | Bacteria | 5218662 |
| 714 | 2601706808 | 2600255300 | Bacteria | 5287774 |
| 715 | 2601711112 | 2600255301 | Bacteria | 5280532 |
| 716 | 2601716126 | 2600255302 | Bacteria | 5288235 |
| 717 | 2601719678 | 2600255303 | Bacteria | 5219315 |
| 718 | 2601726532 | 2600255304 | Bacteria | 5283973 |
| 719 | 2601731073 | 2600255305 | Bacteria | 5282329 |
| 720 | 2601736088 | 2600255306 | Bacteria | 5281613 |
| 721 | 2601741498 | 2600255307 | Bacteria | 5439064 |
| 722 | 2601752248 | 2600255309 | Bacteria | 5431045 |
| 723 | 2602019089 | 2600255392 | Bacteria | 5437392 |
| 724 | 2603661372 | 2602042052 | Bacteria | 5215873 |
| 725 | 2603664326 | 2602042053 | Bacteria | 5214361 |
| 726 | 2603838468 | 2602042103 | Bacteria | 5284714 |
| 727 | 2603843545 | 2602042104 | Bacteria | 5281639 |
| 728 | 2603848619 | 2602042105 | Bacteria | 5282303 |
| 729 | 2603853692 | 2602042106 | Bacteria | 5282744 |
| 730 | 2603868779 | 2602042109 | Bacteria | 5152801 |
| 731 | 2603871746 | 2602042110 | Bacteria | 5283285 |
| 732 | 2603876648 | 2602042111 | Bacteria | 5212080 |
| 733 | 2606048936 | 2603880178 | Bacteria | 5283018 |
| 734 | 2606068756 | 2603880184 | Bacteria | 5217896 |
| 735 | 2606144549 | 2603880202 | Bacteria | 5284684 |
| 736 | 2606176339 | 2603880211 | Bacteria | 5284226 |
| 737 | 2608384239 | 2606217733 | Bacteria | 6360972 |
| 738 | 2637224272 | 2636415599 | Bacteria | 5718434 |
| 739 | 2643797905 | 2643221556 | Bacteria | 7251154 |
| 740 | 2643831111 | 2643221562 | Bacteria | 4048635 |
| 741 | 2644027402 | 2643221603 | Bacteria | 6147767 |
| 742 | 2644237287 | 2643221643 | Bacteria | 5749658 |
| 743 | 2644250951 | 2643221645 | Bacteria | 7207331 |
| 744 | 2644356366 | 2643221664 | Bacteria | 7272945 |
| 745 | 2644473084 | 2643221684 | Bacteria | 7145183 |
| 746 | 2676405674 | 2675903046 | Bacteria | 5451247 |
| 747 | 2729148711 | 2728369097 | Bacteria | 4333476 |
| 748 | 2738825393 | 2738541297 | Bacteria | 6549566 |
| 749 | 2738846226 | 2738541300 | Bacteria | 6675882 |
| 750 | 2739149190 | 2738541357 | Bacteria | 6549408 |
| 751 | 2739191109 | 2738543003 | Bacteria | 6549560 |
| 752 | 2739275125 | 2738543018 | Bacteria | 6718814 |
| 753 | 2739317586 | 2738543026 | Bacteria | 6549408 |
| 754 | 2739335827 | 2738543029 | Bacteria | 6549249 |
| 755 | 2739344169 | 2738543030 | Bacteria | 6719714 |
| 756 | 2777020756 | 2775507074 | Bacteria | 5532402 |
| 757 | 2809144391 | 2808606418 | Bacteria | 6724496 |
| 758 | 2821133991 | 2821131069 | Bacteria | 6108407 |
| 759 | 2857564547 | 2857558681 | Bacteria | 6617694 |
| 760 | 2894024100 | 2894023352 | Bacteria | 5167372 |
| 761 | 2904429204 | 2904424332 | Bacteria | 7633521 |
| 762 | 2904507960 | 2904504865 | Bacteria | 5152820 |
| 763 | 2928159725 | 2928157003 | Bacteria | 7522202 |
| 764 | 2932422618 | 2932422444 | Bacteria | 4678430 |
| 765 | 2939634816 | 2939631187 | Bacteria | 6118131 |
| 766 | 2969081312 | 2969079654 | Bacteria | 5439582 |
| 767 | 2984563775 | 2984559226 | Bacteria | 5683096 |
| 768 | 2984596507 | 2984595703 | Bacteria | 5682994 |
| 769 | 642415789 | 641736154 | Bacteria | 7689995 |
| 770 | 8015397726 | 8015394850 | Bacteria | 5064660 |
| 771 | 8047677907 | 8047673197 | Bacteria | 7395230 |
| 772 | 8055226199 | 8055225921 | Bacteria | 3341787 |
| 773 | Ga0495597_0076063 | |||
| 774 | JGI25154J39366_1002119 | |||
| 775 | JGI25163J39215_1000028 | |||
| 776 | JGI25164J39214_1000107 | |||
| 777 | JGI25152J39213_1014295 | |||
| 778 | JGI25159J45721_1000601 | |||
| 779 | JGI25165J46597_1000218 | |||
| 780 | rootH1_10043487 | |||
| 781 | Ga0055525_1000135 | |||
| 782 | Ga0055526_1000110 | |||
| 783 | Ga0055537_1000284 | |||
| 784 | Ga0055524_1006844 | |||
| 785 | Ga0055534_1000059 | |||
| 786 | Ga0055528_1000124 | |||
| 787 | Ga0055543_1007100 | |||
| 788 | Ga0065165_1000050 | |||
| 789 | Ga0065165_1010202 | |||
| 790 | Ga0070658_10001501 | |||
| 791 | Ga0070680_100043772 | |||
| 792 | Ga0070682_100052125 | |||
| 793 | Ga0070660_100051350 | |||
| 794 | Ga0070660_100077774 | |||
| 795 | Ga0070661_100227593 | |||
| 796 | Ga0070669_100290047 | |||
| 797 | Ga0070714_100169783 | |||
| 798 | Ga0070679_100026869 | |||
| 799 | Ga0070684_100033946 | |||
| 800 | Ga0068853_100016929 | |||
| 801 | Ga0068853_100741298 | |||
| 802 | Ga0068855_100006913 | |||
| 803 | Ga0068855_100134421 | |||
| 804 | Ga0070664_100044370 | |||
| 805 | Ga0070664_100213336 | |||
| 806 | Ga0068854_100140395 | |||
| 807 | Ga0068852_100106833 | |||
| 808 | Ga0068861_100031002 | |||
| 809 | Ga0068851_10009237 | |||
| 810 | Ga0070717_10094997 | |||
| 811 | Ga0075362_10030522 | |||
| 812 | Ga0068871_100610880 | |||
| 813 | Ga0075436_100262641 | |||
| 814 | Ga0099826_10000003 | |||
| 815 | Ga0105251_10001634 | |||
| 816 | Ga0105251_10042925 | |||
| 817 | Ga0105251_10076207 | |||
| 818 | Ga0105244_10004218 | |||
| 819 | Ga0105244_10006422 | |||
| 820 | Ga0105244_10007894 | |||
| 821 | Ga0105244_10009942 | |||
| 822 | Ga0105250_10001524 | |||
| 823 | Ga0105250_10002509 | |||
| 824 | Ga0105240_10089222 | |||
| 825 | Ga0105240_10393415 | |||
| 826 | Ga0105245_10052912 | |||
| 827 | Ga0105243_10001703 | |||
| 828 | Ga0105241_10009038 | |||
| 829 | Ga0105241_10343692 | |||
| 830 | Ga0105238_10055978 | |||
| 831 | Ga0105239_10071052 | |||
| 832 | Ga0157373_10005862 | |||
| 833 | Ga0157371_10000001 | |||
| 834 | Ga0157371_10007873 | |||
| 835 | Ga0157371_10020003 | |||
| 836 | Ga0157370_10004280 | |||
| 837 | Ga0157370_10074910 | |||
| 838 | Ga0157370_10158140 | |||
| 839 | Ga0157370_10191145 | |||
| 840 | Ga0157369_10004954 | |||
| 841 | Ga0157369_10013873 | |||
| 842 | Ga0157369_10675990 | |||
| 843 | Ga0163162_10263821 | |||
| 844 | Ga0157372_10043201 | |||
| 845 | Ga0157372_10055155 | |||
| 846 | Ga0157372_10094965 | |||
| 847 | Ga0157372_10751311 | |||
| 848 | Ga0157375_10800698 | |||
| 849 | Ga0182008_10101808 | |||
| 850 | Ga0182005_1002413 | |||
| 851 | Ga0182005_1005606 | |||
| 852 | Ga0213872_10000002 | |||
| 853 | Ga0213872_10005552 | |||
| 854 | Ga0213872_10011940 | |||
| 855 | Ga0209760_100020 | |||
| 856 | Ga0209436_104856 | |||
| 857 | Ga0209563_100036 | |||
| 858 | Ga0207427_100006 | |||
| 859 | Ga0209437_100013 | |||
| 860 | Ga0209437_106803 | |||
| 861 | Ga0209646_1000117 | |||
| 862 | Ga0209026_1009208 | |||
| 863 | Ga0209148_1000298 | |||
| 864 | Ga0209129_1002747 | |||
| 865 | Ga0209233_1000022 | |||
| 866 | Ga0209565_1000006 | |||
| 867 | Ga0209673_1000004 | |||
| 868 | Ga0209130_1000065 | |||
| 869 | Ga0209675_1000006 | |||
| 870 | Ga0209025_1004912 | |||
| 871 | Ga0209564_1000038 | |||
| 872 | Ga0209564_1000064 | |||
| 873 | Ga0209564_1041708 | |||
| 874 | Ga0209758_1000803 | |||
| 875 | Ga0209256_1000013 | |||
| 876 | Ga0209256_1000365 | |||
| 877 | Ga0207656_10027760 | |||
| 878 | Ga0207696_1001500 | |||
| 879 | Ga0207696_1002414 | |||
| 880 | Ga0207655_1002995 | |||
| 881 | Ga0207655_1017635 | |||
| 882 | Ga0207655_1019803 | |||
| 883 | Ga0207713_1000024 | |||
| 884 | Ga0207713_1055231 | |||
| 885 | Ga0207654_10080902 | |||
| 886 | Ga0207695_10294291 | |||
| 887 | Ga0207660_10012052 | |||
| 888 | Ga0207657_10001327 | |||
| 889 | Ga0207657_10014755 | |||
| 890 | Ga0207649_10111432 | |||
| 891 | Ga0207664_10142949 | |||
| 892 | Ga0207709_10000117 | |||
| 893 | Ga0207661_10024149 | |||
| 894 | Ga0207679_10295864 | |||
| 895 | Ga0207667_10006285 | |||
| 896 | Ga0207667_10402715 | |||
| 897 | Ga0207667_10421009 | |||
| 898 | Ga0207640_10124573 | |||
| 899 | Ga0207703_10454247 | |||
| 900 | Ga0207639_10567145 | |||
| 901 | Ga0207678_10178285 | |||
| 902 | Ga0207702_10129161 | |||
| 903 | Ga0207674_10359504 | |||
| 904 | Ga0207675_100097998 | |||
| 905 | Ga0209282_1000002 | |||
| 906 | Ga0316181_1077120 | |||
| 907 | Ga0265332_10044632 | |||
| 908 | Ga0265331_10090732 | |||
| 909 | Ga0265327_10059110 | |||
| 910 | Ga0265316_10321435 | |||
| 911 | Ga0307408_100000461 | |||
| 912 | Ga0265314_10001032 | |||
| 913 | Ga0265342_10141992 | |||
| 914 | Ga0307411_10104209 | |||
| 915 | Ga0395899_0000141 | |||
| 916 | Ga0395899_0000962 | |||
| 917 | Ga0395899_0048791 | |||
| 918 | Ga0395899_0235813 | |||
| 919 | Ga0395899_0358560 | |||
| 920 | Ga0395900_0000550 | |||
| 921 | Ga0395900_0271209 | |||
| 922 | Ga0395905_0025457 | |||
| 923 | Ga0395905_0173557 | |||
| 924 | Ga0395901_0000073 | |||
| 925 | Ga0400486_23214 | |||
| 926 | Ga0400489_53656 | |||
| 927 | Ga0436361_0154055 | |||
| 928 | Ga0436361_0584108 | |||
| 929 | Ga0436361_1009709 | |||
| 930 | Ga0436361_1165509 | |||
| 931 | Ga0439438_000002 | |||
| 932 | Ga0439438_001771 | |||
| 933 | Ga0439447_000704 | |||
| 934 | Ga0439466_0000001 | |||
| 935 | Ga0439466_0000913 | |||
| 936 | Ga0439432_000295 | |||
| 937 | Ga0439451_002484 | |||
| 938 | Ga0439452_001060 | |||
| 939 | Ga0439452_009893 | |||
| 940 | Ga0439456_000306 | |||
| 941 | Ga0439456_012038 | |||
| 942 | Ga0450907_021497 | |||
| 943 | Ga0439434_0000037 | |||
| 944 | Ga0439460_0001533 | |||
| 945 | Ga0466972_0000029 | |||
| 946 | Ga0466972_0007618 | |||
| 947 | Ga0453683_0001365 | |||
| 948 | Ga0453683_0014203 | |||
| 949 | Ga0466965_0000599 | |||
| 950 | Ga0466965_0037202 | |||
| 951 | Ga0466966_0001041 | |||
| 952 | Ga0466966_0011708 | |||
| 953 | Ga0466961_0003208 | |||
| 954 | Ga0466961_0048871 | |||
| 955 | Ga0466961_0181121 | |||
| 956 | Ga0466964_0003420 | |||
| 957 | Ga0466964_0009814 | |||
| 958 | Ga0466964_0046403 | |||
| 959 | Ga0466971_0005347 | |||
| 960 | Ga0466968_0002143 | |||
| 961 | Ga0466970_0000701 | |||
| 962 | Ga0466970_0004144 | |||
| 963 | Ga0466970_0217674 | |||
| 964 | Ga0466970_0313579 | |||
| 965 | Ga0466957_0000386 | |||
| 966 | Ga0466957_0007223 | |||
| 967 | Ga0466957_0300242 | |||
| 968 | Ga0466959_0002124 | |||
| 969 | Ga0466959_0021570 | |||
| 970 | Ga0466959_0063627 | |||
| 971 | Ga0466959_0076389 | |||
| 972 | Ga0451576_0003730 | |||
| 973 | Ga0451576_0081461 | |||
| 974 | Ga0495617_000007 | |||
| 975 | Ga0495617_000138 | |||
| 976 | Ga0495617_000433 | |||
| 977 | Ga0495617_105191 | |||
| 978 | Ga0495627_000174 | |||
| 979 | Ga0495627_001312 | |||
| 980 | Ga0495627_011935 | |||
| 981 | Ga0495603_0012022 | |||
| 982 | Ga0495590_0000004 | |||
| 983 | Ga0495590_0000007 | |||
| 984 | Ga0495590_0000287 | |||
| 985 | Ga0495590_0004196 | |||
| 986 | Ga0495591_000039 | |||
| 987 | Ga0495591_000310 | |||
| 988 | Ga0495629_0004670 | |||
| 989 | Ga0495629_0017142 | |||
| 990 | Ga0495638_0000023 | |||
| 991 | Ga0495638_0010460 | |||
| 992 | Ga0495638_0045065 | |||
| 993 | Ga0495638_0048659 | |||
| 994 | Ga0495638_0066732 | |||
| 995 | Ga0495653_0008794 | |||
| 996 | Ga0495653_0085772 | |||
| 997 | Ga0495653_0159421 | |||
| 998 | Ga0495650_0000154 | |||
| 999 | Ga0495650_0000320 | |||
| 1000 | Ga0495650_0001964 | |||
| 1001 | Ga0495650_0077965 | |||
| 1002 | Ga0495580_0183491 | |||
| 1003 | Ga0495580_0192523 | |||
| 1004 | Ga0495582_0003493 | |||
| 1005 | Ga0495582_0025219 | |||
| 1006 | Ga0495582_0117379 | |||
| 1007 | Ga0495605_0000133 | |||
| 1008 | Ga0495605_0000169 | |||
| 1009 | Ga0495605_0020011 | |||
| 1010 | Ga0495605_0046434 | |||
| 1011 | Ga0495605_0055141 | |||
| 1012 | Ga0495639_0087431 | |||
| 1013 | Ga0495584_0000010 | |||
| 1014 | Ga0495584_0000678 | |||
| 1015 | Ga0495584_0001011 | |||
| 1016 | Ga0495584_0001901 | |||
| 1017 | Ga0495584_0009175 | |||
| 1018 | Ga0495584_0044712 | |||
| 1019 | Ga0495584_0062617 | |||
| 1020 | Ga0495584_0075250 | |||
| 1021 | Ga0495584_0138493 | |||
| 1022 | Ga0495584_0212819 | |||
| 1023 | Ga0495585_0000004 | |||
| 1024 | Ga0495585_0000451 | |||
| 1025 | Ga0495585_0000935 | |||
| 1026 | Ga0495585_0001097 | |||
| 1027 | Ga0495585_0001154 | |||
| 1028 | Ga0495585_0001166 | |||
| 1029 | Ga0495585_0001278 | |||
| 1030 | Ga0495585_0003335 | |||
| 1031 | Ga0495585_0024506 | |||
| 1032 | Ga0495585_0046425 | |||
| 1033 | Ga0495585_0047395 | |||
| 1034 | Ga0495585_0063889 | |||
| 1035 | Ga0495585_0102595 | |||
| 1036 | Ga0495585_0130479 | |||
| 1037 | Ga0495585_0283387 | |||
| 1038 | Ga0495594_0007839 | |||
| 1039 | Ga0495594_0020081 | |||
| 1040 | Ga0495596_0000608 | |||
| 1041 | Ga0495596_0000617 | |||
| 1042 | Ga0495596_0001806 | |||
| 1043 | Ga0495596_0004514 | |||
| 1044 | Ga0495596_0006947 | |||
| 1045 | Ga0495596_0010807 | |||
| 1046 | Ga0495596_0011029 | |||
| 1047 | Ga0495596_0060511 | |||
| 1048 | Ga0495607_0000261 | |||
| 1049 | Ga0495607_0001157 | |||
| 1050 | Ga0495607_0002475 | |||
| 1051 | Ga0495607_0007573 | |||
| 1052 | Ga0495607_0018160 | |||
| 1053 | Ga0495607_0032895 | |||
| 1054 | Ga0495607_0033200 | |||
| 1055 | Ga0495607_0179741 | |||
| 1056 | Ga0495583_0000084 | |||
| 1057 | Ga0495583_0001335 | |||
| 1058 | Ga0495583_0001776 | |||
| 1059 | Ga0495583_0002955 | |||
| 1060 | Ga0495583_0003212 | |||
| 1061 | Ga0495583_0005922 | |||
| 1062 | Ga0495583_0031730 | |||
| 1063 | Ga0495583_0045571 | |||
| 1064 | Ga0495583_0051211 | |||
| 1065 | Ga0495583_0115797 | |||
| 1066 | Ga0495583_0124301 | |||
| 1067 | Ga0495606_0000037 | |||
| 1068 | Ga0495606_0000402 | |||
| 1069 | Ga0495606_0000533 | |||
| 1070 | Ga0495606_0000576 | |||
| 1071 | Ga0495606_0000982 | |||
| 1072 | Ga0495606_0002384 | |||
| 1073 | Ga0495606_0002810 | |||
| 1074 | Ga0495606_0003445 | |||
| 1075 | Ga0495606_0009074 | |||
| 1076 | Ga0495606_0012562 | |||
| 1077 | Ga0495606_0019010 | |||
| 1078 | Ga0495606_0039354 | |||
| 1079 | Ga0495606_0050693 | |||
| 1080 | Ga0495606_0052508 | |||
| 1081 | Ga0495606_0055725 | |||
| 1082 | Ga0495606_0128971 | |||
| 1083 | Ga0495606_0148232 | |||
| 1084 | Ga0495606_0216569 | |||
| 1085 | Ga0495606_0224489 | |||
| 1086 | Ga0495610_0000004 | |||
| 1087 | Ga0495610_0000128 | |||
| 1088 | Ga0495610_0000428 | |||
| 1089 | Ga0495610_0001171 | |||
| 1090 | Ga0495610_0005473 | |||
| 1091 | Ga0495610_0021762 | |||
| 1092 | Ga0495610_0024589 | |||
| 1093 | Ga0495616_0000269 | |||
| 1094 | Ga0495616_0000344 | |||
| 1095 | Ga0495616_0001060 | |||
| 1096 | Ga0495616_0001272 | |||
| 1097 | Ga0495616_0001627 | |||
| 1098 | Ga0495616_0002122 | |||
| 1099 | Ga0495616_0012422 | |||
| 1100 | Ga0495616_0014231 | |||
| 1101 | Ga0495616_0019934 | |||
| 1102 | Ga0495616_0028294 | |||
| 1103 | Ga0495616_0034553 | |||
| 1104 | Ga0495616_0048310 | |||
| 1105 | Ga0495616_0069156 | |||
| 1106 | Ga0495616_0079823 | |||
| 1107 | Ga0495620_0025247 | |||
| 1108 | Ga0495630_0258890 | |||
| 1109 | Ga0495631_0000886 | |||
| 1110 | Ga0495631_0003700 | |||
| 1111 | Ga0495631_0021272 | |||
| 1112 | Ga0495631_0024386 | |||
| 1113 | Ga0495631_0027447 | |||
| 1114 | Ga0495631_0042274 | |||
| 1115 | Ga0495632_0000504 | |||
| 1116 | Ga0495632_0001557 | |||
| 1117 | Ga0495632_0006690 | |||
| 1118 | Ga0495632_0009303 | |||
| 1119 | Ga0495632_0032005 | |||
| 1120 | Ga0495637_0000006 | |||
| 1121 | Ga0495637_0000223 | |||
| 1122 | Ga0495637_0024391 | |||
| 1123 | Ga0495643_0000196 | |||
| 1124 | Ga0495643_0000239 | |||
| 1125 | Ga0495643_0003999 | |||
| 1126 | Ga0495643_0130596 | |||
| 1127 | Ga0495643_0219819 | |||
| 1128 | Ga0495644_0012766 | |||
| 1129 | Ga0495644_0037310 | |||
| 1130 | Ga0495644_0051309 | |||
| 1131 | Ga0495648_0000007 | |||
| 1132 | Ga0495648_0001034 | |||
| 1133 | Ga0495648_0002116 | |||
| 1134 | Ga0495648_0005003 | |||
| 1135 | Ga0495648_0009830 | |||
| 1136 | Ga0495648_0018262 | |||
| 1137 | Ga0495648_0029372 | |||
| 1138 | Ga0495648_0029956 | |||
| 1139 | Ga0495648_0088687 | |||
| 1140 | Ga0495648_0149311 | |||
| 1141 | Ga0495648_0162848 | |||
| 1142 | Ga0495663_0073619 | |||
| 1143 | Ga0495663_0074604 | |||
| 1144 | Ga0495666_0047360 | |||
| 1145 | Ga0495666_0075095 | |||
| 1146 | Ga0495642_0000383 | |||
| 1147 | Ga0495642_0000499 | |||
| 1148 | Ga0495642_0001165 | |||
| 1149 | Ga0495642_0001497 | |||
| 1150 | Ga0495642_0001671 | |||
| 1151 | Ga0495642_0019207 | |||
| 1152 | Ga0495642_0053029 | |||
| 1153 | Ga0495642_0072656 | |||
| 1154 | Ga0495642_0102339 | |||
| 1155 | Ga0495642_0120098 | |||
| 1156 | Ga0495652_0024781 | |||
| 1157 | Ga0495652_0086848 | |||
| 1158 | Ga0495654_0000004 | |||
| 1159 | Ga0495654_0001755 | |||
| 1160 | Ga0495654_0001896 | |||
| 1161 | Ga0495654_0003847 | |||
| 1162 | Ga0495654_0006878 | |||
| 1163 | Ga0495654_0010948 | |||
| 1164 | Ga0495665_0053775 | |||
| 1165 | Ga0495665_0082749 | |||
| 1166 | Ga0495586_0005660 | |||
| 1167 | Ga0495587_0009893 | |||
| 1168 | Ga0495587_0303542 | |||
| 1169 | Ga0495609_0000545 | |||
| 1170 | Ga0495609_0000732 | |||
| 1171 | Ga0495609_0000832 | |||
| 1172 | Ga0495609_0000847 | |||
| 1173 | Ga0495609_0000856 | |||
| 1174 | Ga0495609_0004528 | |||
| 1175 | Ga0495609_0009843 | |||
| 1176 | Ga0495609_0021589 | |||
| 1177 | Ga0495609_0038242 | |||
| 1178 | Ga0495609_0059848 | |||
| 1179 | Ga0495609_0138079 | |||
| 1180 | Ga0495597_0000239 | |||
| 1181 | Ga0495597_0000479 | |||
| 1182 | Ga0495597_0000496 | |||
| 1183 | Ga0495597_0000621 | |||
| 1184 | Ga0495597_0001375 | |||
| 1185 | Ga0495597_0136501 | |||
| 1186 | Ga0495597_0136802 | |||
| 1187 | Ga0495645_0211932 | |||
| 1188 | Ga0495622_0000003 | |||
| 1189 | Ga0495622_0007635 | |||
| 1190 | Ga0495622_0089412 | |||
| 1191 | Ga0495633_0000541 | |||
| 1192 | Ga0495633_0001029 | |||
| 1193 | Ga0495633_0002925 | |||
| 1194 | Ga0495633_0003831 | |||
| 1195 | Ga0495633_0005412 | |||
| 1196 | Ga0495633_0015370 | |||
| 1197 | Ga0495633_0016694 | |||
| 1198 | Ga0495633_0020676 | |||
| 1199 | Ga0495633_0027375 | |||
| 1200 | Ga0495633_0028557 | |||
| 1201 | Ga0495633_0043503 | |||
| 1202 | Ga0495633_0167059 | |||
| 1203 | Ga0495656_0007063 | |||
| 1204 | Ga0495656_0037398 | |||
| 1205 | Ga0495656_0041726 | |||
| 1206 | Ga0495656_0061928 | |||
| 1207 | Ga0495668_0000049 | |||
| 1208 | Ga0495668_0000051 | |||
| 1209 | Ga0495668_0001802 | |||
| 1210 | Ga0495668_0001821 | |||
| 1211 | Ga0495668_0002559 | |||
| 1212 | Ga0495668_0003825 | |||
| 1213 | Ga0495668_0011300 | |||
| 1214 | Ga0495668_0043218 | |||
| 1215 | Ga0495668_0064421 | |||
| 1216 | Ga0495668_0105447 | |||
| 1217 | Ga0495668_0271193 | |||
| 1218 | Ga0495634_0058086 | |||
| 1219 | Ga0495611_0000496 | |||
| 1220 | Ga0495611_0054994 | |||
| 1221 | Ga0495611_0061461 | |||
| 1222 | Ga0495611_0243923 | |||
| 1223 | Ga0495625_0023566 | |||
| 1224 | Ga0495625_0035638 | |||
| 1225 | Ga0495625_0085276 | |||
| 1226 | Ga0495625_0131054 | |||
| 1227 | Ga0495625_0172548 | |||
| 1228 | Ga0495625_0254275 | |||
| 1229 | Ga0495625_0341234 | |||
| 1230 | Ga0495635_0020507 | |||
| 1231 | Ga0495659_0018014 | |||
| 1232 | Ga0495659_0034369 | |||
| 1233 | Ga0495661_0000338 | |||
| 1234 | Ga0495661_0000651 | |||
| 1235 | Ga0495661_0000802 | |||
| 1236 | Ga0495661_0012141 | |||
| 1237 | Ga0495661_0012900 | |||
| 1238 | Ga0495661_0020847 | |||
| 1239 | Ga0495661_0023696 | |||
| 1240 | Ga0495661_0057951 | |||
| 1241 | Ga0495661_0088408 | |||
| 1242 | Ga0495661_0121830 | |||
| 1243 | Ga0495661_0126846 | |||
| 1244 | Ga0495661_0134896 | |||
| 1245 | Ga0495661_0198110 | |||
| 1246 | Ga0495588_0000226 | |||
| 1247 | Ga0495588_0000447 | |||
| 1248 | Ga0495588_0017069 | |||
| 1249 | Ga0495588_0017445 | |||
| 1250 | Ga0495588_0031570 | |||
| 1251 | Ga0495588_0032033 | |||
| 1252 | Ga0495588_0111710 | |||
| 1253 | Ga0495588_0247320 | |||
| 1254 | Ga0495623_0065228 | |||
| 1255 | Ga0495669_0001886 | |||
| 1256 | Ga0495669_0010859 | |||
| 1257 | Ga0495669_0020156 | |||
| 1258 | Ga0495669_0067605 | |||
| 1259 | Ga0495613_0107974 | |||
| 1260 | Ga0495624_0013524 | |||
| 1261 | Ga0495670_0007797 | |||
| 1262 | Ga0495670_0009193 | |||
| 1263 | Ga0495670_0024751 | |||
| 1264 | Ga0495670_0040525 | |||
| 1265 | Ga0495670_0048885 | |||
| 1266 | Ga0495671_0000070 | |||
| 1267 | Ga0495671_0000192 | |||
| 1268 | Ga0495671_0000422 | |||
| 1269 | Ga0495671_0000483 | |||
| 1270 | Ga0495671_0000602 | |||
| 1271 | Ga0495671_0001766 | |||
| 1272 | Ga0495671_0013388 | |||
| 1273 | Ga0495671_0041693 | |||
| 1274 | Ga0495671_0046098 | |||
| 1275 | Ga0495671_0072158 | |||
| 1276 | Ga0495671_0157021 | |||
| 1277 | Ga0495649_0000184 | |||
| 1278 | Ga0495649_0000424 | |||
| 1279 | Ga0495649_0057588 | |||
| 1280 | Ga0495649_0123385 | |||
| 1281 | Ga0495649_0183789 | |||
| 1282 | Ga0495589_0000188 | |||
| 1283 | Ga0495589_0000921 | |||
| 1284 | Ga0495589_0008404 | |||
| 1285 | Ga0495589_0014417 | |||
| 1286 | Ga0495589_0020128 | |||
| 1287 | Ga0495600_0109674 | |||
| 1288 | Ga0495660_0000394 | |||
| 1289 | Ga0495660_0001755 | |||
| 1290 | Ga0495660_0002473 | |||
| 1291 | Ga0495660_0027715 | |||
| 1292 | Ga0495660_0055373 | |||
| 1293 | Ga0495660_0066006 | |||
| 1294 | Ga0495660_0131388 | |||
| 1295 | Ga0495660_0158241 | |||
| 1296 | Ga0495581_0490654 | |||
| 1297 | Ga0495604_0007372 | |||
| 1298 | Ga0495636_0017913 | |||
| 1299 | Ga0495636_0074010 | |||
| 1300 | Ga0495674_0003686 | |||
| 1301 | Ga0495672_0000015 | |||
| 1302 | Ga0495672_0000441 | |||
| 1303 | Ga0495672_0000695 | |||
| 1304 | Ga0495672_0001226 | |||
| 1305 | Ga0495672_0046603 | |||
| 1306 | Ga0495672_0100740 | |||
| 1307 | Ga0495676_0000014 | |||
| 1308 | Ga0495676_0005083 | |||
| 1309 | Ga0495676_0056475 | |||
| 1310 | Ga0495676_0112139 | |||
| 1311 | Ga0495680_0013638 | |||
| 1312 | Ga0495683_0000180 | |||
| 1313 | Ga0495683_0000306 | |||
| 1314 | Ga0495683_0002293 | |||
| 1315 | Ga0495683_0007893 | |||
| 1316 | Ga0495683_0034699 | |||
| 1317 | Ga0495683_0060138 | |||
| 1318 | Ga0495683_0070268 | |||
| 1319 | Ga0495683_0080155 | |||
| 1320 | Ga0495683_0118400 | |||
| 1321 | Ga0495683_0135778 | |||
| 1322 | Ga0495687_000049 | |||
| 1323 | Ga0495687_000088 | |||
| 1324 | Ga0495687_000533 | |||
| 1325 | Ga0495687_000732 | |||
| 1326 | Ga0495687_000848 | |||
| 1327 | Ga0495687_000928 | |||
| 1328 | Ga0495687_001000 | |||
| 1329 | Ga0495687_026413 | |||
| 1330 | Ga0495687_034718 | |||
| 1331 | Ga0495675_0011916 | |||
| 1332 | Ga0495677_0000286 | |||
| 1333 | Ga0495677_0003083 | |||
| 1334 | Ga0495677_0003494 | |||
| 1335 | Ga0495677_0010972 | |||
| 1336 | Ga0495677_0053896 | |||
| 1337 | Ga0495677_0090213 | |||
| 1338 | Ga0495679_000965 | |||
| 1339 | Ga0495679_000979 | |||
| 1340 | Ga0495679_004840 | |||
| 1341 | Ga0495679_011850 | |||
| 1342 | Ga0495679_015636 | |||
| 1343 | Ga0495679_017285 | |||
| 1344 | Ga0495685_008963 | |||
| 1345 | Ga0495685_009579 | |||
| 1346 | Ga0495673_0000017 | |||
| 1347 | Ga0495673_0000027 | |||
| 1348 | Ga0495673_0005555 | |||
| 1349 | Ga0495673_0024772 | |||
| 1350 | Ga0495681_0000073 | |||
| 1351 | Ga0495681_0000127 | |||
| 1352 | Ga0495681_0000168 | |||
| 1353 | Ga0495681_0012405 | |||
| 1354 | Ga0495681_0012756 | |||
| 1355 | Ga0495681_0012820 | |||
| 1356 | Ga0495681_0033177 | |||
| 1357 | Ga0495681_0060135 | |||
| 1358 | Ga0495681_0069432 | |||
| 1359 | Ga0495686_0000696 | |||
| 1360 | Ga0495686_0001565 | |||
| 1361 | Ga0495686_0009279 | |||
| 1362 | Ga0495686_0011457 | |||
| 1363 | Ga0495686_0018422 | |||
| 1364 | Ga0495686_0021104 | |||
| 1365 | Ga0495686_0114693 | |||
| 1366 | Ga0495602_0001704 | |||
| 1367 | Ga0495602_0264797 | |||
| 1368 | Ga0495614_0016008 | |||
| 1369 | Ga0495614_0103412 | |||
| 1370 | Ga0495626_0000677 | |||
| 1371 | Ga0495626_0001122 | |||
| 1372 | Ga0495626_0001575 | |||
| 1373 | Ga0495626_0001656 | |||
| 1374 | Ga0495626_0002929 | |||
| 1375 | Ga0495626_0003190 | |||
| 1376 | Ga0495626_0003269 | |||
| 1377 | Ga0495626_0007954 | |||
| 1378 | Ga0495626_0019732 | |||
| 1379 | Ga0495626_0023535 | |||
| 1380 | Ga0495626_0044686 | |||
| 1381 | Ga0495626_0061379 | |||
| 1382 | Ga0495626_0094654 | |||
| 1383 | Ga0495626_0150249 | |||
| 1384 | Ga0495626_0150256 | |||
| 1385 | Ga0496100_0232150 | |||
| 1386 | Ga0496101_0009552 | |||
| 1387 | Ga0496102_0002678 | |||
| 1388 | Ga0496102_0179889 | |||
| 1389 | Ga0496102_0286742 | |||
| 1390 | Ga0496103_0008794 | |||
| 1391 | Ga0496103_0019302 | |||
| 1392 | Ga0496103_0150959 | |||
| 1393 | Ga0496104_0047423 | |||
| 1394 | Ga0496105_0257209 | |||
| 1395 | Ga0496106_0006898 | |||
| 1396 | Ga0496106_0070812 | |||
| 1397 | Ga0496109_0006624 | |||
| 1398 | Ga0496110_0000065 | |||
| 1399 | Ga0496110_0252368 | |||
| 1400 | Ga0496111_0032691 | |||
| 1401 | Ga0496111_0214931 | |||
| 1402 | Ga0496115_0001661 | |||
| 1403 | Ga0496115_0025058 | |||
| 1404 | Ga0496116_0002320 | |||
| 1405 | Ga0496116_0008949 | |||
| 1406 | Ga0496116_0020781 | |||
| 1407 | Ga0496117_0030586 | |||
| 1408 | Ga0496117_0056551 | |||
| 1409 | Ga0496118_0120057 | |||
| 1410 | Ga0496118_0155211 | |||
| 1411 | Ga0496118_0188913 | |||
| 1412 | Ga0496119_0005089 | |||
| 1413 | Ga0496119_0008370 | |||
| 1414 | Ga0496119_0022762 | |||
| 1415 | Ga0496119_0183336 | |||
| 1416 | Ga0496120_0003966 | |||
| 1417 | Ga0496120_0051956 | |||
| 1418 | Ga0496121_0023379 | |||
| 1419 | Ga0496122_0000169 | |||
| 1420 | Ga0496122_0003279 | |||
| 1421 | Ga0496122_0053369 | |||
| 1422 | Ga0496123_0001393 | |||
| 1423 | Ga0496123_0001911 | |||
| 1424 | Ga0496123_0002716 | |||
| 1425 | Ga0496123_0003363 | |||
| 1426 | Ga0496124_0000484 | |||
| 1427 | Ga0496124_0006649 | |||
| 1428 | Ga0496124_0010167 | |||
| 1429 | Ga0496124_0011735 | |||
| 1430 | Ga0496124_0064232 | |||
| 1431 | Ga0496124_0185603 | |||
| 1432 | Ga0496124_0265532 | |||
| 1433 | Ga0496124_0416224 | |||
| 1434 | Ga0496125_0000916 | |||
| 1435 | Ga0496125_0004916 | |||
| 1436 | Ga0496125_0051385 | |||
| 1437 | Ga0496125_0127054 | |||
| 1438 | Ga0496125_0131621 | |||
| 1439 | Ga0496126_0001412 | |||
| 1440 | Ga0496126_0104768 | |||
| 1441 | Ga0495678_000056 | |||
| 1442 | Ga0495678_000079 | |||
| 1443 | Ga0495678_000449 | |||
| 1444 | Ga0495678_000565 | |||
| 1445 | Ga0495678_006643 | |||
| 1446 | Ga0495682_0000095 | |||
| 1447 | Ga0495682_0000378 | |||
| 1448 | Ga0495682_0000610 | |||
| 1449 | Ga0495682_0011263 | |||
| 1450 | Ga0495682_0040989 | |||
| 1451 | Ga0495682_0046845 | |||
| 1452 | Ga0495682_0196966 | |||
| 1453 | Ga0501034_0387661 | |||
| 1454 | Ga0501036_0115471 | |||
| 1455 | Ga0501041_0194118 | |||
| 1456 | Ga0501046_0073916 | |||
| 1457 | Ga0501047_0092639 | |||
| 1458 | Ga0501047_0274909 | |||
| 1459 | Ga0501073_0225096 | |||
| 1460 | Ga0501076_0244872 | |||
| 1461 | Ga0501240_019454 | |||
| 1462 | Ga0501080_0025339 | |||
| 1463 | Ga0501083_0128850 | |||
| 1464 | Ga0501035_0003724 | |||
| 1465 | Ga0501044_0237922 | |||
| 1466 | nmdc:mga08x19_211136_c1 | |||
| 1467 | Ga0500618_000138 | |||
| 1468 | Ga0587068_012394 | |||
| 1469 | Ga0587107_007464 | |||
| 1470 | 2511273008 | |||
| 1471 | 2513555954 | |||
| 1472 | 2516017127 | |||
| 1473 | 2554818575 | |||
| 1474 | 2599411448 | |||
| 1475 | 2601522956 | |||
| 1476 | 2601527983 | |||
| 1477 | 2601614817 | |||
| 1478 | 2601619534 | |||
| 1479 | 2601641871 | |||
| 1480 | 2601646708 | |||
| 1481 | 2601656347 | |||
| 1482 | 2601658287 | |||
| 1483 | 2601665911 | |||
| 1484 | 2601698768 | |||
| 1485 | 2601701614 | |||
| 1486 | 2601706808 | |||
| 1487 | 2601711112 | |||
| 1488 | 2601716126 | |||
| 1489 | 2601719678 | |||
| 1490 | 2601726532 | |||
| 1491 | 2601731073 | |||
| 1492 | 2601736088 | |||
| 1493 | 2601741498 | |||
| 1494 | 2601752248 | |||
| 1495 | 2602019089 | |||
| 1496 | 2603661372 | |||
| 1497 | 2603664326 | |||
| 1498 | 2603838468 | |||
| 1499 | 2603843545 | |||
| 1500 | 2603848619 | |||
| 1501 | 2603853692 | |||
| 1502 | 2603868779 | |||
| 1503 | 2603871746 | |||
| 1504 | 2603876648 | |||
| 1505 | 2606048936 | |||
| 1506 | 2606068756 | |||
| 1507 | 2606144549 | |||
| 1508 | 2606176339 | |||
| 1509 | 2608384239 | |||
| 1510 | 2637224272 | |||
| 1511 | 2643797905 | |||
| 1512 | 2643831111 | |||
| 1513 | 2644027402 | |||
| 1514 | 2644237287 | |||
| 1515 | 2644250951 | |||
| 1516 | 2644356366 | |||
| 1517 | 2644473084 | |||
| 1518 | 2676405674 | |||
| 1519 | 2729148711 | |||
| 1520 | 2738825393 | |||
| 1521 | 2738846226 | |||
| 1522 | 2739149190 | |||
| 1523 | 2739191109 | |||
| 1524 | 2739275125 | |||
| 1525 | 2739317586 | |||
| 1526 | 2739335827 | |||
| 1527 | 2739344169 | |||
| 1528 | 2777020756 | |||
| 1529 | 2809144391 | |||
| 1530 | 2821133991 | |||
| 1531 | 2857564547 | |||
| 1532 | 2894024100 | |||
| 1533 | 2904429204 | |||
| 1534 | 2904507960 | |||
| 1535 | 2928159725 | |||
| 1536 | 2932422618 | |||
| 1537 | 2939634816 | |||
| 1538 | 2969081312 | |||
| 1539 | 2984563775 | |||
| 1540 | 2984596507 | |||
| 1541 | 642415789 | |||
| 1542 | 8015397726 | |||
| 1543 | 8047677907 | |||
| 1544 | 8055226199 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6oih-assembly1.cif.gz_D | crystal structure of o-antigen polysaccharide abc-transporter | 0.8919 | 15 | 264 |
| 6oih-assembly2.cif.gz_C | crystal structure of o-antigen polysaccharide abc-transporter | 0.8832 | 15 | 264 |
| 7k2t-assembly1.cif.gz_B | mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs | 0.883 | 15 | 266 |
| 8dku-assembly1.cif.gz_B | cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen | 0.879 | 15 | 264 |
| 6oih-assembly1.cif.gz_D | crystal structure of o-antigen polysaccharide abc-transporter | 0.8786 | 15 | 264 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VMM9_322_706_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.6253 | 71 | 254 | 3.40.1710.10 |
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.595 | 67 | 255 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.5411 | 70 | 266 | 3.40.1710.10 |
| af_Q9VMM9_322_706_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.4585 | 71 | 254 | 3.40.1710.10 |
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.4381 | 67 | 255 | 3.40.1710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G7ZXH7-F1-model_v4 | Lipopolysaccharide transport system permease protein | 0.9715 | 58 | 266 |
GO:0005886
GO:0015920 GO:0140359 |
| AF-A0A4P6L157-F1-model_v4 | Transport permease protein | 0.9698 | 2 | 266 |
GO:0005886
GO:0015920 GO:0140359 |
| AF-A0A0X8XC14-F1-model_v4 | Transport permease protein | 0.9694 | 33 | 266 |
GO:0005886
GO:0015920 GO:0140359 |
| AF-A0A1G7ZXH7-F1-model_v4 | Lipopolysaccharide transport system permease protein | 0.9669 | 58 | 266 |
GO:0005886
GO:0015920 GO:0140359 |
| AF-A0A0X8XC14-F1-model_v4 | Transport permease protein | 0.9653 | 33 | 266 |
GO:0005886
GO:0015920 GO:0140359 |