F480129

General Info

Members Datasets Scaffolds Average Seq Length
772 329 1544 263

Family's Representative Sequence

Representative Sequence 3300046542|Ga0495597_0076063|Ga0495597_0076063_115_1002
Length 295
Sequence VTQPNDFLTRPCDRYDQIFPAHPVGAGRTMISPLMLRGVWAYRGFVLGSVKREFQARYANAVLGALWSLLSPLAMILVYTVIFSEVMQSRLPGAESRFAYSIYLCAGILTWGLFAEIVGRAQGMFIEQANLIKKISFPRICLPLIVVLNALVNFAIIFGLFTLFLLATDSFPGWTYFAILPVLVLQVLLAIGVGMIAGVLNVFFRDVGQLVTIALQFWFWFTPIVYPPTILPDNVRPLLAFNPMAQVVGAYQAVLVRGATPHWPSLAPVLALALLLCLFGLRLFRKRSAELVDEL

Samples

Sample ID Description Type Environment
1 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
38 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
59 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
63 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
64 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
97 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
98 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
99 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
111 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
114 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
115 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
116 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
117 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
118 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
119 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
120 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
121 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
122 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
123 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
124 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
125 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
129 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
130 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
131 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
136 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
139 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
147 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
148 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
149 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
152 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
153 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
156 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
157 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
160 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
161 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
162 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
163 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
166 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
167 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
170 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
176 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
177 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
178 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
184 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
187 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
190 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
191 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
192 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
193 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
194 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
195 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
196 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
204 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
207 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
208 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
209 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
210 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
211 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
214 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
227 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
228 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
229 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
230 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
231 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
232 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
233 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
234 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
235 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
238 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
252 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
253 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 2511231007 Pseudomonas sp. GM18 Isolate Nodule
256 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
257 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
258 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
259 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
260 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
261 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
262 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
263 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
264 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
265 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
266 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
267 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
268 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
269 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
270 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
271 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
272 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
273 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
274 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
275 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
276 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
277 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
278 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
279 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
280 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
281 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
282 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
283 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
284 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
285 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
286 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
287 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
288 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
289 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
290 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
291 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
292 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
293 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
294 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
295 2636415599 Klebsiella variicola DX120E Isolate Unclassified
296 2643221556 Massilia sp. Root1485 Isolate Unclassified
297 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
298 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
299 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
300 2643221645 Massilia sp. Root351 Isolate Unclassified
301 2643221664 Massilia sp. Root418 Isolate Unclassified
302 2643221684 Massilia sp. Root133 Isolate Unclassified
303 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
304 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
305 2738541297 Duganella sp. GV083 Isolate Unclassified
306 2738541300 Massilia sp. GV016 Isolate Unclassified
307 2738541357 Duganella sp. GV053 Isolate Unclassified
308 2738543003 Duganella sp. GV066 Isolate Unclassified
309 2738543018 Massilia sp. GV045 Isolate Unclassified
310 2738543026 Duganella sp. GV089 Isolate Unclassified
311 2738543029 Duganella sp. GV039 Isolate Unclassified
312 2738543030 Massilia sp. GV097 Isolate Unclassified
313 2775507074 Klebsiella sp. D5A Isolate Unclassified
314 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
315 2821131069 Duganella sp. 1224 Isolate Unclassified
316 2857558681 Duganella sp. R-74565 Isolate Unclassified
317 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
318 2904424332 Duganella sp. 1411 Isolate Rhizosphere
319 2904504865 Serratia marcescens 1822 Isolate Unclassified
320 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
321 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
322 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
323 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
324 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
325 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
326 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
327 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
328 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
329 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.03
Metatranscriptomes 0.26
Isolates 9.72

Biome Distribution

Category Percentage (%)
Aerial Root 0.26
Bulb 0
Endosphere 4.66
Nodule 0.65
Rhizoplane 7.25
Rhizosphere 78.37
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495597_0076063 3300046542 Bacteria 1440
2 JGI25154J39366_1002119 3300002738 Bacteria 5560
3 JGI25163J39215_1000028 3300002771 Bacteria 67700
4 JGI25164J39214_1000107 3300002772 Bacteria 80489
5 JGI25152J39213_1014295 3300002773 Bacteria 1615
6 JGI25159J45721_1000601 3300002987 Bacteria 16095
7 JGI25165J46597_1000218 3300003214 Bacteria 80489
8 rootH1_10043487 3300003316 Bacteria 1582
9 Ga0055525_1000135 3300003759 Bacteria 108217
10 Ga0055526_1000110 3300003771 Bacteria 72034
11 Ga0055537_1000284 3300003773 Bacteria 36171
12 Ga0055524_1006844 3300003775 Bacteria 4916
13 Ga0055534_1000059 3300003784 Bacteria 84386
14 Ga0055528_1000124 3300003790 Bacteria 61627
15 Ga0055543_1007100 3300004625 Bacteria 2623
16 Ga0065165_1000050 3300005262 Bacteria 195237
17 Ga0065165_1010202 3300005262 Bacteria 4096
18 Ga0070658_10001501 3300005327 Bacteria 19811
19 Ga0070680_100043772 3300005336 Bacteria 3636
20 Ga0070682_100052125 3300005337 Bacteria 2560
21 Ga0070660_100051350 3300005339 Bacteria 3175
22 Ga0070660_100077774 3300005339 Bacteria 2601
23 Ga0070661_100227593 3300005344 Bacteria 1432
24 Ga0070669_100290047 3300005353 Bacteria 1313
25 Ga0070714_100169783 3300005435 Bacteria 1979
26 Ga0070679_100026869 3300005530 Bacteria 5661
27 Ga0070684_100033946 3300005535 Bacteria 4360
28 Ga0068853_100016929 3300005539 Bacteria 6009
29 Ga0068853_100741298 3300005539 Bacteria 938
30 Ga0068855_100006913 3300005563 Bacteria 13759
31 Ga0068855_100134421 3300005563 Bacteria 2822
32 Ga0070664_100044370 3300005564 Bacteria 3754
33 Ga0070664_100213336 3300005564 Bacteria 1725
34 Ga0068854_100140395 3300005578 Bacteria 1853
35 Ga0068852_100106833 3300005616 Bacteria 2538
36 Ga0068861_100031002 3300005719 Bacteria 3923
37 Ga0068851_10009237 3300005834 Bacteria 4578
38 Ga0070717_10094997 3300006028 Bacteria 2523
39 Ga0075362_10030522 3300006177 Bacteria 2328
40 Ga0068871_100610880 3300006358 Bacteria 992
41 Ga0075436_100262641 3300006914 Bacteria 1231
42 Ga0099826_10000003 3300006948 Bacteria 1067817
43 Ga0105251_10001634 3300009011 Bacteria 18983
44 Ga0105251_10042925 3300009011 Bacteria 2192
45 Ga0105251_10076207 3300009011 Bacteria 1556
46 Ga0105244_10004218 3300009036 Bacteria 9992
47 Ga0105244_10006422 3300009036 Bacteria 7611
48 Ga0105244_10007894 3300009036 Bacteria 6709
49 Ga0105244_10009942 3300009036 Bacteria 5800
50 Ga0105250_10001524 3300009092 Bacteria 12492
51 Ga0105250_10002509 3300009092 Bacteria 9199
52 Ga0105240_10089222 3300009093 Bacteria 3771
53 Ga0105240_10393415 3300009093 Bacteria 1563
54 Ga0105245_10052912 3300009098 Bacteria 3643
55 Ga0105243_10001703 3300009148 Bacteria 18949
56 Ga0105241_10009038 3300009174 Bacteria 7329
57 Ga0105241_10343692 3300009174 Bacteria 1294
58 Ga0105238_10055978 3300009551 Bacteria 3957
59 Ga0105239_10071052 3300010375 Bacteria 3824
60 Ga0157373_10005862 3300013100 Bacteria 9191
61 Ga0157371_10000001 3300013102 Bacteria 1162285
62 Ga0157371_10007873 3300013102 Bacteria 8555
63 Ga0157371_10020003 3300013102 Bacteria 4929
64 Ga0157370_10004280 3300013104 Bacteria 16440
65 Ga0157370_10074910 3300013104 Bacteria 3192
66 Ga0157370_10158140 3300013104 Bacteria 2108
67 Ga0157370_10191145 3300013104 Unclassified 1900
68 Ga0157369_10004954 3300013105 Bacteria 15599
69 Ga0157369_10013873 3300013105 Bacteria 9102
70 Ga0157369_10675990 3300013105 Bacteria 1064
71 Ga0163162_10263821 3300013306 Bacteria 1854
72 Ga0157372_10043201 3300013307 Bacteria 4989
73 Ga0157372_10055155 3300013307 Bacteria 4437
74 Ga0157372_10094965 3300013307 Bacteria 3397
75 Ga0157372_10751311 3300013307 Bacteria 1134
76 Ga0157375_10800698 3300013308 Unclassified 1091
77 Ga0182008_10101808 3300014497 Bacteria 1420
78 Ga0182005_1002413 3300015265 Bacteria 6688
79 Ga0182005_1005606 3300015265 Bacteria 3908
80 Ga0213872_10000002 3300021361 Bacteria 554092
81 Ga0213872_10005552 3300021361 Bacteria 6459
82 Ga0213872_10011940 3300021361 Bacteria 4100
83 Ga0209760_100020 3300025207 Bacteria 169879
84 Ga0209436_104856 3300025208 Bacteria 3221
85 Ga0209563_100036 3300025230 Bacteria 448275
86 Ga0207427_100006 3300025231 Bacteria 785415
87 Ga0209437_100013 3300025233 Bacteria 785457
88 Ga0209437_106803 3300025233 Bacteria 1889
89 Ga0209646_1000117 3300025246 Bacteria 150025
90 Ga0209026_1009208 3300025250 Bacteria 1964
91 Ga0209148_1000298 3300025254 Bacteria 72028
92 Ga0209129_1002747 3300025258 Bacteria 8232
93 Ga0209233_1000022 3300025261 Bacteria 785415
94 Ga0209565_1000006 3300025263 Bacteria 897294
95 Ga0209673_1000004 3300025273 Bacteria 896155
96 Ga0209130_1000065 3300025284 Bacteria 195251
97 Ga0209675_1000006 3300025291 Bacteria 732267
98 Ga0209025_1004912 3300025294 Bacteria 11250
99 Ga0209564_1000038 3300025295 Bacteria 414357
100 Ga0209564_1000064 3300025295 Bacteria 316431
101 Ga0209564_1041708 3300025295 Bacteria 1228
102 Ga0209758_1000803 3300025297 Bacteria 44495
103 Ga0209256_1000013 3300025299 Bacteria 689442
104 Ga0209256_1000365 3300025299 Bacteria 72787
105 Ga0207656_10027760 3300025321 Bacteria 2318
106 Ga0207696_1001500 3300025711 Bacteria 12536
107 Ga0207696_1002414 3300025711 Bacteria 9174
108 Ga0207655_1002995 3300025728 Bacteria 12938
109 Ga0207655_1017635 3300025728 Bacteria 3839
110 Ga0207655_1019803 3300025728 Bacteria 3495
111 Ga0207713_1000024 3300025735 Bacteria 339156
112 Ga0207713_1055231 3300025735 Bacteria 1551
113 Ga0207654_10080902 3300025911 Bacteria 1955
114 Ga0207695_10294291 3300025913 Bacteria 1515
115 Ga0207660_10012052 3300025917 Bacteria 5650
116 Ga0207657_10001327 3300025919 Bacteria 26265
117 Ga0207657_10014755 3300025919 Bacteria 7608
118 Ga0207649_10111432 3300025920 Bacteria 1829
119 Ga0207664_10142949 3300025929 Bacteria 2026
120 Ga0207709_10000117 3300025935 Bacteria 122667
121 Ga0207661_10024149 3300025944 Bacteria 4603
122 Ga0207679_10295864 3300025945 Bacteria 1393
123 Ga0207667_10006285 3300025949 Bacteria 14410
124 Ga0207667_10402715 3300025949 Bacteria 1393
125 Ga0207667_10421009 3300025949 Bacteria 1359
126 Ga0207640_10124573 3300025981 Bacteria 1853
127 Ga0207703_10454247 3300026035 Bacteria 1197
128 Ga0207639_10567145 3300026041 Bacteria 1044
129 Ga0207678_10178285 3300026067 Bacteria 1814
130 Ga0207702_10129161 3300026078 Bacteria 2272
131 Ga0207674_10359504 3300026116 Bacteria 1407
132 Ga0207675_100097998 3300026118 Bacteria 2761
133 Ga0209282_1000002 3300027666 Bacteria 1067825
134 Ga0316181_1077120 3300030744 Bacteria 3705
135 Ga0265332_10044632 3300031238 Bacteria 1911
136 Ga0265331_10090732 3300031250 Bacteria 1412
137 Ga0265327_10059110 3300031251 Bacteria 1965
138 Ga0265316_10321435 3300031344 Bacteria 1124
139 Ga0307408_100000461 3300031548 Bacteria 35591
140 Ga0265314_10001032 3300031711 Bacteria 32416
141 Ga0265342_10141992 3300031712 Bacteria 1339
142 Ga0307411_10104209 3300032005 Bacteria 2014
143 Ga0395899_0000141 3300037312 Bacteria 109773
144 Ga0395899_0000962 3300037312 Bacteria 26757
145 Ga0395899_0048791 3300037312 Bacteria 3149
146 Ga0395899_0235813 3300037312 Bacteria 1261
147 Ga0395899_0358560 3300037312 Bacteria 973
148 Ga0395900_0000550 3300037418 Bacteria 52140
149 Ga0395900_0271209 3300037418 Bacteria 1691
150 Ga0395905_0025457 3300037471 Bacteria 5580
151 Ga0395905_0173557 3300037471 Bacteria 2024
152 Ga0395901_0000073 3300038443 Bacteria 139769
153 Ga0400486_23214 3300038742 Bacteria 2857
154 Ga0400489_53656 3300039093 Bacteria 48451
155 Ga0436361_0154055 3300039447 Bacteria 57887
156 Ga0436361_0584108 3300039447 Bacteria 4087
157 Ga0436361_1009709 3300039447 Bacteria 25382
158 Ga0436361_1165509 3300039447 Bacteria 12217
159 Ga0439438_000002 3300041405 Bacteria 618223
160 Ga0439438_001771 3300041405 Bacteria 9486
161 Ga0439447_000704 3300041407 Bacteria 12370
162 Ga0439466_0000001 3300041411 Bacteria 647258
163 Ga0439466_0000913 3300041411 Bacteria 11266
164 Ga0439432_000295 3300042006 Bacteria 17930
165 Ga0439451_002484 3300042009 Bacteria 3738
166 Ga0439452_001060 3300042010 Bacteria 12146
167 Ga0439452_009893 3300042010 Bacteria 2794
168 Ga0439456_000306 3300042013 Bacteria 11480
169 Ga0439456_012038 3300042013 Bacteria 1793
170 Ga0450907_021497 3300042146 Bacteria 1085
171 Ga0439434_0000037 3300042435 Bacteria 32174
172 Ga0439460_0001533 3300042461 Bacteria 5432
173 Ga0466972_0000029 3300044658 Bacteria 165236
174 Ga0466972_0007618 3300044658 Bacteria 5433
175 Ga0453683_0001365 3300044673 Bacteria 21310
176 Ga0453683_0014203 3300044673 Bacteria 5176
177 Ga0466965_0000599 3300044683 Bacteria 13144
178 Ga0466965_0037202 3300044683 Bacteria 2389
179 Ga0466966_0001041 3300044684 Bacteria 17743
180 Ga0466966_0011708 3300044684 Bacteria 5815
181 Ga0466961_0003208 3300044693 Bacteria 10177
182 Ga0466961_0048871 3300044693 Bacteria 2704
183 Ga0466961_0181121 3300044693 Bacteria 1308
184 Ga0466964_0003420 3300044706 Bacteria 5789
185 Ga0466964_0009814 3300044706 Bacteria 3607
186 Ga0466964_0046403 3300044706 Bacteria 1771
187 Ga0466971_0005347 3300044719 Bacteria 5567
188 Ga0466968_0002143 3300044735 Bacteria 7194
189 Ga0466970_0000701 3300044765 Bacteria 16371
190 Ga0466970_0004144 3300044765 Bacteria 7131
191 Ga0466970_0217674 3300044765 Bacteria 1065
192 Ga0466970_0313579 3300044765 Bacteria 886
193 Ga0466957_0000386 3300044842 Bacteria 21569
194 Ga0466957_0007223 3300044842 Bacteria 6277
195 Ga0466957_0300242 3300044842 Bacteria 1079
196 Ga0466959_0002124 3300045049 Bacteria 12544
197 Ga0466959_0021570 3300045049 Bacteria 4753
198 Ga0466959_0063627 3300045049 Bacteria 2678
199 Ga0466959_0076389 3300045049 Bacteria 2418
200 Ga0451576_0003730 3300045051 Bacteria 20605
201 Ga0451576_0081461 3300045051 Bacteria 3366
202 Ga0495617_000007 3300046452 Bacteria 369986
203 Ga0495617_000138 3300046452 Bacteria 48070
204 Ga0495617_000433 3300046452 Bacteria 22580
205 Ga0495617_105191 3300046452 Bacteria 915
206 Ga0495627_000174 3300046453 Bacteria 72709
207 Ga0495627_001312 3300046453 Bacteria 15164
208 Ga0495627_011935 3300046453 Bacteria 3096
209 Ga0495603_0012022 3300046455 Bacteria 5240
210 Ga0495590_0000004 3300046457 Bacteria 402091
211 Ga0495590_0000007 3300046457 Bacteria 331108
212 Ga0495590_0000287 3300046457 Bacteria 27199
213 Ga0495590_0004196 3300046457 Bacteria 5828
214 Ga0495591_000039 3300046458 Bacteria 156460
215 Ga0495591_000310 3300046458 Bacteria 44305
216 Ga0495629_0004670 3300046459 Bacteria 10260
217 Ga0495629_0017142 3300046459 Bacteria 5195
218 Ga0495638_0000023 3300046460 Bacteria 363063
219 Ga0495638_0010460 3300046460 Bacteria 6436
220 Ga0495638_0045065 3300046460 Bacteria 2776
221 Ga0495638_0048659 3300046460 Bacteria 2653
222 Ga0495638_0066732 3300046460 Bacteria 2211
223 Ga0495653_0008794 3300046463 Bacteria 8271
224 Ga0495653_0085772 3300046463 Bacteria 2315
225 Ga0495653_0159421 3300046463 Bacteria 1567
226 Ga0495650_0000154 3300046471 Bacteria 156130
227 Ga0495650_0000320 3300046471 Bacteria 85951
228 Ga0495650_0001964 3300046471 Bacteria 18158
229 Ga0495650_0077965 3300046471 Bacteria 1284
230 Ga0495580_0183491 3300046472 Bacteria 1444
231 Ga0495580_0192523 3300046472 Bacteria 1406
232 Ga0495582_0003493 3300046473 Bacteria 8853
233 Ga0495582_0025219 3300046473 Bacteria 3257
234 Ga0495582_0117379 3300046473 Bacteria 1497
235 Ga0495605_0000133 3300046474 Bacteria 97036
236 Ga0495605_0000169 3300046474 Bacteria 82458
237 Ga0495605_0020011 3300046474 Bacteria 3561
238 Ga0495605_0046434 3300046474 Bacteria 2135
239 Ga0495605_0055141 3300046474 Bacteria 1921
240 Ga0495639_0087431 3300046475 Bacteria 1459
241 Ga0495584_0000010 3300046491 Bacteria 225095
242 Ga0495584_0000678 3300046491 Bacteria 22636
243 Ga0495584_0001011 3300046491 Bacteria 17554
244 Ga0495584_0001901 3300046491 Bacteria 12038
245 Ga0495584_0009175 3300046491 Bacteria 5100
246 Ga0495584_0044712 3300046491 Bacteria 2234
247 Ga0495584_0062617 3300046491 Bacteria 1869
248 Ga0495584_0075250 3300046491 Bacteria 1697
249 Ga0495584_0138493 3300046491 Bacteria 1235
250 Ga0495584_0212819 3300046491 Bacteria 982
251 Ga0495585_0000004 3300046492 Bacteria 348260
252 Ga0495585_0000451 3300046492 Bacteria 39252
253 Ga0495585_0000935 3300046492 Bacteria 24635
254 Ga0495585_0001097 3300046492 Bacteria 22286
255 Ga0495585_0001154 3300046492 Bacteria 21551
256 Ga0495585_0001166 3300046492 Bacteria 21382
257 Ga0495585_0001278 3300046492 Bacteria 20114
258 Ga0495585_0003335 3300046492 Bacteria 10895
259 Ga0495585_0024506 3300046492 Bacteria 3459
260 Ga0495585_0046425 3300046492 Bacteria 2422
261 Ga0495585_0047395 3300046492 Bacteria 2393
262 Ga0495585_0063889 3300046492 Bacteria 2019
263 Ga0495585_0102595 3300046492 Bacteria 1528
264 Ga0495585_0130479 3300046492 Bacteria 1323
265 Ga0495585_0283387 3300046492 Bacteria 818
266 Ga0495594_0007839 3300046499 Bacteria 5491
267 Ga0495594_0020081 3300046499 Bacteria 3557
268 Ga0495596_0000608 3300046500 Bacteria 22479
269 Ga0495596_0000617 3300046500 Bacteria 22347
270 Ga0495596_0001806 3300046500 Bacteria 11900
271 Ga0495596_0004514 3300046500 Bacteria 6766
272 Ga0495596_0006947 3300046500 Bacteria 5153
273 Ga0495596_0010807 3300046500 Bacteria 3961
274 Ga0495596_0011029 3300046500 Bacteria 3912
275 Ga0495596_0060511 3300046500 Bacteria 1475
276 Ga0495607_0000261 3300046501 Bacteria 56378
277 Ga0495607_0001157 3300046501 Bacteria 23898
278 Ga0495607_0002475 3300046501 Bacteria 14990
279 Ga0495607_0007573 3300046501 Bacteria 7493
280 Ga0495607_0018160 3300046501 Bacteria 4490
281 Ga0495607_0032895 3300046501 Bacteria 3159
282 Ga0495607_0033200 3300046501 Bacteria 3141
283 Ga0495607_0179741 3300046501 Bacteria 1061
284 Ga0495583_0000084 3300046506 Bacteria 165375
285 Ga0495583_0001335 3300046506 Bacteria 25594
286 Ga0495583_0001776 3300046506 Bacteria 20548
287 Ga0495583_0002955 3300046506 Bacteria 13660
288 Ga0495583_0003212 3300046506 Bacteria 12790
289 Ga0495583_0005922 3300046506 Bacteria 8122
290 Ga0495583_0031730 3300046506 Bacteria 2557
291 Ga0495583_0045571 3300046506 Bacteria 2027
292 Ga0495583_0051211 3300046506 Bacteria 1883
293 Ga0495583_0115797 3300046506 Bacteria 1132
294 Ga0495583_0124301 3300046506 Bacteria 1083
295 Ga0495606_0000037 3300046507 Bacteria 231282
296 Ga0495606_0000402 3300046507 Bacteria 73035
297 Ga0495606_0000533 3300046507 Bacteria 61375
298 Ga0495606_0000576 3300046507 Bacteria 58266
299 Ga0495606_0000982 3300046507 Bacteria 41525
300 Ga0495606_0002384 3300046507 Bacteria 22041
301 Ga0495606_0002810 3300046507 Bacteria 19380
302 Ga0495606_0003445 3300046507 Bacteria 16787
303 Ga0495606_0009074 3300046507 Bacteria 8480
304 Ga0495606_0012562 3300046507 Bacteria 6780
305 Ga0495606_0019010 3300046507 Bacteria 5131
306 Ga0495606_0039354 3300046507 Bacteria 3188
307 Ga0495606_0050693 3300046507 Bacteria 2713
308 Ga0495606_0052508 3300046507 Bacteria 2650
309 Ga0495606_0055725 3300046507 Bacteria 2555
310 Ga0495606_0128971 3300046507 Bacteria 1505
311 Ga0495606_0148232 3300046507 Bacteria 1379
312 Ga0495606_0216569 3300046507 Bacteria 1081
313 Ga0495606_0224489 3300046507 Bacteria 1056
314 Ga0495610_0000004 3300046512 Bacteria 1006135
315 Ga0495610_0000128 3300046512 Bacteria 83166
316 Ga0495610_0000428 3300046512 Bacteria 43253
317 Ga0495610_0001171 3300046512 Bacteria 23803
318 Ga0495610_0005473 3300046512 Bacteria 9016
319 Ga0495610_0021762 3300046512 Bacteria 3520
320 Ga0495610_0024589 3300046512 Bacteria 3247
321 Ga0495616_0000269 3300046513 Bacteria 42108
322 Ga0495616_0000344 3300046513 Bacteria 36907
323 Ga0495616_0001060 3300046513 Bacteria 19653
324 Ga0495616_0001272 3300046513 Bacteria 17715
325 Ga0495616_0001627 3300046513 Bacteria 15387
326 Ga0495616_0002122 3300046513 Bacteria 13291
327 Ga0495616_0012422 3300046513 Bacteria 4836
328 Ga0495616_0014231 3300046513 Bacteria 4462
329 Ga0495616_0019934 3300046513 Bacteria 3653
330 Ga0495616_0028294 3300046513 Bacteria 2968
331 Ga0495616_0034553 3300046513 Bacteria 2625
332 Ga0495616_0048310 3300046513 Bacteria 2139
333 Ga0495616_0069156 3300046513 Bacteria 1713
334 Ga0495616_0079823 3300046513 Bacteria 1567
335 Ga0495620_0025247 3300046515 Bacteria 2814
336 Ga0495630_0258890 3300046517 Bacteria 1329
337 Ga0495631_0000886 3300046518 Bacteria 18737
338 Ga0495631_0003700 3300046518 Bacteria 8341
339 Ga0495631_0021272 3300046518 Bacteria 3021
340 Ga0495631_0024386 3300046518 Bacteria 2792
341 Ga0495631_0027447 3300046518 Bacteria 2605
342 Ga0495631_0042274 3300046518 Bacteria 2014
343 Ga0495632_0000504 3300046519 Bacteria 36804
344 Ga0495632_0001557 3300046519 Bacteria 18923
345 Ga0495632_0006690 3300046519 Bacteria 7369
346 Ga0495632_0009303 3300046519 Bacteria 5932
347 Ga0495632_0032005 3300046519 Bacteria 2713
348 Ga0495637_0000006 3300046520 Bacteria 435763
349 Ga0495637_0000223 3300046520 Bacteria 43805
350 Ga0495637_0024391 3300046520 Bacteria 2737
351 Ga0495643_0000196 3300046522 Bacteria 95989
352 Ga0495643_0000239 3300046522 Bacteria 82416
353 Ga0495643_0003999 3300046522 Bacteria 10530
354 Ga0495643_0130596 3300046522 Bacteria 1261
355 Ga0495643_0219819 3300046522 Bacteria 902
356 Ga0495644_0012766 3300046523 Bacteria 3229
357 Ga0495644_0037310 3300046523 Bacteria 1833
358 Ga0495644_0051309 3300046523 Bacteria 1549
359 Ga0495648_0000007 3300046524 Bacteria 347305
360 Ga0495648_0001034 3300046524 Bacteria 28205
361 Ga0495648_0002116 3300046524 Bacteria 18701
362 Ga0495648_0005003 3300046524 Bacteria 11135
363 Ga0495648_0009830 3300046524 Bacteria 7352
364 Ga0495648_0018262 3300046524 Bacteria 4976
365 Ga0495648_0029372 3300046524 Bacteria 3649
366 Ga0495648_0029956 3300046524 Bacteria 3605
367 Ga0495648_0088687 3300046524 Bacteria 1738
368 Ga0495648_0149311 3300046524 Bacteria 1221
369 Ga0495648_0162848 3300046524 Bacteria 1151
370 Ga0495663_0073619 3300046525 Bacteria 1091
371 Ga0495663_0074604 3300046525 Bacteria 1084
372 Ga0495666_0047360 3300046526 Bacteria 2070
373 Ga0495666_0075095 3300046526 Bacteria 1603
374 Ga0495642_0000383 3300046528 Bacteria 23859
375 Ga0495642_0000499 3300046528 Bacteria 20174
376 Ga0495642_0001165 3300046528 Bacteria 12065
377 Ga0495642_0001497 3300046528 Bacteria 10432
378 Ga0495642_0001671 3300046528 Bacteria 9619
379 Ga0495642_0019207 3300046528 Bacteria 2678
380 Ga0495642_0053029 3300046528 Bacteria 1670
381 Ga0495642_0072656 3300046528 Bacteria 1440
382 Ga0495642_0102339 3300046528 Bacteria 1220
383 Ga0495642_0120098 3300046528 Bacteria 1127
384 Ga0495652_0024781 3300046529 Bacteria 5309
385 Ga0495652_0086848 3300046529 Bacteria 2567
386 Ga0495654_0000004 3300046530 Bacteria 515304
387 Ga0495654_0001755 3300046530 Bacteria 14525
388 Ga0495654_0001896 3300046530 Bacteria 13905
389 Ga0495654_0003847 3300046530 Bacteria 9067
390 Ga0495654_0006878 3300046530 Bacteria 6415
391 Ga0495654_0010948 3300046530 Bacteria 4927
392 Ga0495665_0053775 3300046531 Bacteria 2128
393 Ga0495665_0082749 3300046531 Bacteria 1687
394 Ga0495586_0005660 3300046535 Bacteria 6681
395 Ga0495587_0009893 3300046536 Bacteria 6085
396 Ga0495587_0303542 3300046536 Bacteria 892
397 Ga0495609_0000545 3300046538 Bacteria 29804
398 Ga0495609_0000732 3300046538 Bacteria 24952
399 Ga0495609_0000832 3300046538 Bacteria 22914
400 Ga0495609_0000847 3300046538 Bacteria 22600
401 Ga0495609_0000856 3300046538 Bacteria 22445
402 Ga0495609_0004528 3300046538 Bacteria 7562
403 Ga0495609_0009843 3300046538 Bacteria 4609
404 Ga0495609_0021589 3300046538 Bacteria 2970
405 Ga0495609_0038242 3300046538 Bacteria 2163
406 Ga0495609_0059848 3300046538 Bacteria 1684
407 Ga0495609_0138079 3300046538 Bacteria 1041
408 Ga0495597_0000239 3300046542 Bacteria 49769
409 Ga0495597_0000479 3300046542 Bacteria 33628
410 Ga0495597_0000496 3300046542 Bacteria 32885
411 Ga0495597_0000621 3300046542 Bacteria 28981
412 Ga0495597_0001375 3300046542 Bacteria 17590
413 Ga0495597_0136501 3300046542 Bacteria 1014
414 Ga0495597_0136802 3300046542 Bacteria 1012
415 Ga0495645_0211932 3300046543 Bacteria 1307
416 Ga0495622_0000003 3300046557 Bacteria 268681
417 Ga0495622_0007635 3300046557 Bacteria 5023
418 Ga0495622_0089412 3300046557 Bacteria 1415
419 Ga0495633_0000541 3300046558 Bacteria 37760
420 Ga0495633_0001029 3300046558 Bacteria 22793
421 Ga0495633_0002925 3300046558 Bacteria 11708
422 Ga0495633_0003831 3300046558 Bacteria 9838
423 Ga0495633_0005412 3300046558 Bacteria 7818
424 Ga0495633_0015370 3300046558 Bacteria 3972
425 Ga0495633_0016694 3300046558 Bacteria 3778
426 Ga0495633_0020676 3300046558 Bacteria 3306
427 Ga0495633_0027375 3300046558 Bacteria 2787
428 Ga0495633_0028557 3300046558 Bacteria 2717
429 Ga0495633_0043503 3300046558 Bacteria 2131
430 Ga0495633_0167059 3300046558 Bacteria 1014
431 Ga0495656_0007063 3300046615 Bacteria 3958
432 Ga0495656_0037398 3300046615 Bacteria 2005
433 Ga0495656_0041726 3300046615 Bacteria 1918
434 Ga0495656_0061928 3300046615 Bacteria 1636
435 Ga0495668_0000049 3300046616 Bacteria 217657
436 Ga0495668_0000051 3300046616 Bacteria 214532
437 Ga0495668_0001802 3300046616 Bacteria 19550
438 Ga0495668_0001821 3300046616 Bacteria 19337
439 Ga0495668_0002559 3300046616 Bacteria 14773
440 Ga0495668_0003825 3300046616 Bacteria 11023
441 Ga0495668_0011300 3300046616 Bacteria 5356
442 Ga0495668_0043218 3300046616 Bacteria 2507
443 Ga0495668_0064421 3300046616 Bacteria 2017
444 Ga0495668_0105447 3300046616 Bacteria 1542
445 Ga0495668_0271193 3300046616 Bacteria 929
446 Ga0495634_0058086 3300046642 Bacteria 2580
447 Ga0495611_0000496 3300046648 Bacteria 23480
448 Ga0495611_0054994 3300046648 Bacteria 1800
449 Ga0495611_0061461 3300046648 Bacteria 1707
450 Ga0495611_0243923 3300046648 Bacteria 833
451 Ga0495625_0023566 3300046660 Bacteria 4700
452 Ga0495625_0035638 3300046660 Bacteria 3666
453 Ga0495625_0085276 3300046660 Bacteria 2192
454 Ga0495625_0131054 3300046660 Bacteria 1698
455 Ga0495625_0172548 3300046660 Bacteria 1443
456 Ga0495625_0254275 3300046660 Bacteria 1139
457 Ga0495625_0341234 3300046660 Bacteria 949
458 Ga0495635_0020507 3300046663 Bacteria 4604
459 Ga0495659_0018014 3300046664 Bacteria 2349
460 Ga0495659_0034369 3300046664 Bacteria 1782
461 Ga0495661_0000338 3300046665 Bacteria 51135
462 Ga0495661_0000651 3300046665 Bacteria 35125
463 Ga0495661_0000802 3300046665 Bacteria 29694
464 Ga0495661_0012141 3300046665 Bacteria 5820
465 Ga0495661_0012900 3300046665 Bacteria 5630
466 Ga0495661_0020847 3300046665 Bacteria 4273
467 Ga0495661_0023696 3300046665 Bacteria 3979
468 Ga0495661_0057951 3300046665 Bacteria 2310
469 Ga0495661_0088408 3300046665 Bacteria 1768
470 Ga0495661_0121830 3300046665 Bacteria 1439
471 Ga0495661_0126846 3300046665 Bacteria 1403
472 Ga0495661_0134896 3300046665 Bacteria 1348
473 Ga0495661_0198110 3300046665 Bacteria 1053
474 Ga0495588_0000226 3300046674 Bacteria 51538
475 Ga0495588_0000447 3300046674 Bacteria 20763
476 Ga0495588_0017069 3300046674 Bacteria 3518
477 Ga0495588_0017445 3300046674 Bacteria 3487
478 Ga0495588_0031570 3300046674 Bacteria 2667
479 Ga0495588_0032033 3300046674 Bacteria 2649
480 Ga0495588_0111710 3300046674 Bacteria 1439
481 Ga0495588_0247320 3300046674 Bacteria 940
482 Ga0495623_0065228 3300046679 Bacteria 2277
483 Ga0495669_0001886 3300046684 Bacteria 8601
484 Ga0495669_0010859 3300046684 Bacteria 3855
485 Ga0495669_0020156 3300046684 Bacteria 2883
486 Ga0495669_0067605 3300046684 Bacteria 1624
487 Ga0495613_0107974 3300046689 Bacteria 2007
488 Ga0495624_0013524 3300046690 Bacteria 5564
489 Ga0495670_0007797 3300046691 Bacteria 5265
490 Ga0495670_0009193 3300046691 Bacteria 4859
491 Ga0495670_0024751 3300046691 Bacteria 2967
492 Ga0495670_0040525 3300046691 Bacteria 2322
493 Ga0495670_0048885 3300046691 Bacteria 2115
494 Ga0495671_0000070 3300046692 Bacteria 97889
495 Ga0495671_0000192 3300046692 Bacteria 53483
496 Ga0495671_0000422 3300046692 Bacteria 33738
497 Ga0495671_0000483 3300046692 Bacteria 30968
498 Ga0495671_0000602 3300046692 Bacteria 26521
499 Ga0495671_0001766 3300046692 Bacteria 13995
500 Ga0495671_0013388 3300046692 Bacteria 4445
501 Ga0495671_0041693 3300046692 Bacteria 2310
502 Ga0495671_0046098 3300046692 Bacteria 2180
503 Ga0495671_0072158 3300046692 Bacteria 1695
504 Ga0495671_0157021 3300046692 Bacteria 1107
505 Ga0495649_0000184 3300046694 Bacteria 54636
506 Ga0495649_0000424 3300046694 Bacteria 36607
507 Ga0495649_0057588 3300046694 Bacteria 2095
508 Ga0495649_0123385 3300046694 Bacteria 1369
509 Ga0495649_0183789 3300046694 Bacteria 1090
510 Ga0495589_0000188 3300046794 Bacteria 54693
511 Ga0495589_0000921 3300046794 Bacteria 18055
512 Ga0495589_0008404 3300046794 Bacteria 5396
513 Ga0495589_0014417 3300046794 Bacteria 4070
514 Ga0495589_0020128 3300046794 Bacteria 3413
515 Ga0495600_0109674 3300046809 Bacteria 1797
516 Ga0495660_0000394 3300046810 Bacteria 37748
517 Ga0495660_0001755 3300046810 Bacteria 14449
518 Ga0495660_0002473 3300046810 Bacteria 11777
519 Ga0495660_0027715 3300046810 Bacteria 3203
520 Ga0495660_0055373 3300046810 Bacteria 2147
521 Ga0495660_0066006 3300046810 Bacteria 1930
522 Ga0495660_0131388 3300046810 Bacteria 1256
523 Ga0495660_0158241 3300046810 Bacteria 1113
524 Ga0495581_0490654 3300047315 Bacteria 714
525 Ga0495604_0007372 3300047317 Bacteria 8715
526 Ga0495636_0017913 3300047318 Bacteria 2838
527 Ga0495636_0074010 3300047318 Bacteria 1458
528 Ga0495674_0003686 3300047319 Bacteria 14897
529 Ga0495672_0000015 3300047320 Bacteria 502855
530 Ga0495672_0000441 3300047320 Bacteria 49584
531 Ga0495672_0000695 3300047320 Bacteria 37258
532 Ga0495672_0001226 3300047320 Bacteria 25838
533 Ga0495672_0046603 3300047320 Bacteria 2584
534 Ga0495672_0100740 3300047320 Bacteria 1567
535 Ga0495676_0000014 3300047321 Bacteria 203356
536 Ga0495676_0005083 3300047321 Bacteria 12068
537 Ga0495676_0056475 3300047321 Bacteria 3104
538 Ga0495676_0112139 3300047321 Bacteria 1999
539 Ga0495680_0013638 3300047322 Bacteria 7080
540 Ga0495683_0000180 3300047323 Bacteria 62230
541 Ga0495683_0000306 3300047323 Bacteria 41377
542 Ga0495683_0002293 3300047323 Bacteria 11661
543 Ga0495683_0007893 3300047323 Bacteria 5712
544 Ga0495683_0034699 3300047323 Bacteria 2565
545 Ga0495683_0060138 3300047323 Bacteria 1883
546 Ga0495683_0070268 3300047323 Bacteria 1719
547 Ga0495683_0080155 3300047323 Bacteria 1594
548 Ga0495683_0118400 3300047323 Bacteria 1259
549 Ga0495683_0135778 3300047323 Bacteria 1156
550 Ga0495687_000049 3300047443 Bacteria 205432
551 Ga0495687_000088 3300047443 Bacteria 142499
552 Ga0495687_000533 3300047443 Bacteria 45573
553 Ga0495687_000732 3300047443 Bacteria 36155
554 Ga0495687_000848 3300047443 Bacteria 32587
555 Ga0495687_000928 3300047443 Bacteria 30405
556 Ga0495687_001000 3300047443 Bacteria 28318
557 Ga0495687_026413 3300047443 Bacteria 2733
558 Ga0495687_034718 3300047443 Bacteria 2275
559 Ga0495675_0011916 3300047444 Bacteria 5463
560 Ga0495677_0000286 3300047445 Bacteria 22170
561 Ga0495677_0003083 3300047445 Bacteria 6484
562 Ga0495677_0003494 3300047445 Bacteria 6097
563 Ga0495677_0010972 3300047445 Bacteria 3319
564 Ga0495677_0053896 3300047445 Bacteria 1483
565 Ga0495677_0090213 3300047445 Bacteria 1154
566 Ga0495679_000965 3300047446 Bacteria 17777
567 Ga0495679_000979 3300047446 Bacteria 17640
568 Ga0495679_004840 3300047446 Bacteria 6084
569 Ga0495679_011850 3300047446 Bacteria 3348
570 Ga0495679_015636 3300047446 Bacteria 2769
571 Ga0495679_017285 3300047446 Bacteria 2585
572 Ga0495685_008963 3300047447 Bacteria 3334
573 Ga0495685_009579 3300047447 Bacteria 3240
574 Ga0495673_0000017 3300047469 Bacteria 574970
575 Ga0495673_0000027 3300047469 Bacteria 475440
576 Ga0495673_0005555 3300047469 Bacteria 7596
577 Ga0495673_0024772 3300047469 Bacteria 2892
578 Ga0495681_0000073 3300047470 Bacteria 92561
579 Ga0495681_0000127 3300047470 Bacteria 67389
580 Ga0495681_0000168 3300047470 Bacteria 54934
581 Ga0495681_0012405 3300047470 Bacteria 5007
582 Ga0495681_0012756 3300047470 Bacteria 4918
583 Ga0495681_0012820 3300047470 Bacteria 4902
584 Ga0495681_0033177 3300047470 Bacteria 2590
585 Ga0495681_0060135 3300047470 Bacteria 1754
586 Ga0495681_0069432 3300047470 Bacteria 1600
587 Ga0495686_0000696 3300047472 Bacteria 45475
588 Ga0495686_0001565 3300047472 Bacteria 24374
589 Ga0495686_0009279 3300047472 Bacteria 7104
590 Ga0495686_0011457 3300047472 Bacteria 6244
591 Ga0495686_0018422 3300047472 Bacteria 4687
592 Ga0495686_0021104 3300047472 Bacteria 4332
593 Ga0495686_0114693 3300047472 Bacteria 1612
594 Ga0495602_0001704 3300048088 Bacteria 21874
595 Ga0495602_0264797 3300048088 Bacteria 1273
596 Ga0495614_0016008 3300048089 Bacteria 3265
597 Ga0495614_0103412 3300048089 Bacteria 1247
598 Ga0495626_0000677 3300048091 Bacteria 32591
599 Ga0495626_0001122 3300048091 Bacteria 22502
600 Ga0495626_0001575 3300048091 Bacteria 17878
601 Ga0495626_0001656 3300048091 Bacteria 17198
602 Ga0495626_0002929 3300048091 Bacteria 11365
603 Ga0495626_0003190 3300048091 Bacteria 10672
604 Ga0495626_0003269 3300048091 Bacteria 10478
605 Ga0495626_0007954 3300048091 Bacteria 5863
606 Ga0495626_0019732 3300048091 Bacteria 3367
607 Ga0495626_0023535 3300048091 Bacteria 3032
608 Ga0495626_0044686 3300048091 Bacteria 2071
609 Ga0495626_0061379 3300048091 Bacteria 1709
610 Ga0495626_0094654 3300048091 Bacteria 1309
611 Ga0495626_0150249 3300048091 Bacteria 982
612 Ga0495626_0150256 3300048091 Bacteria 982
613 Ga0496100_0232150 3300048903 Bacteria 1358
614 Ga0496101_0009552 3300048904 Bacteria 6377
615 Ga0496102_0002678 3300048905 Bacteria 15150
616 Ga0496102_0179889 3300048905 Bacteria 1992
617 Ga0496102_0286742 3300048905 Bacteria 1552
618 Ga0496103_0008794 3300048906 Bacteria 5992
619 Ga0496103_0019302 3300048906 Bacteria 4094
620 Ga0496103_0150959 3300048906 Bacteria 1488
621 Ga0496104_0047423 3300048907 Bacteria 4049
622 Ga0496105_0257209 3300048908 Bacteria 1413
623 Ga0496106_0006898 3300048909 Bacteria 8403
624 Ga0496106_0070812 3300048909 Bacteria 2664
625 Ga0496109_0006624 3300048912 Bacteria 9754
626 Ga0496110_0000065 3300048913 Bacteria 52525
627 Ga0496110_0252368 3300048913 Bacteria 1605
628 Ga0496111_0032691 3300048914 Bacteria 3710
629 Ga0496111_0214931 3300048914 Bacteria 1428
630 Ga0496115_0001661 3300048918 Bacteria 15999
631 Ga0496115_0025058 3300048918 Bacteria 4641
632 Ga0496116_0002320 3300048919 Bacteria 20148
633 Ga0496116_0008949 3300048919 Bacteria 8610
634 Ga0496116_0020781 3300048919 Bacteria 4973
635 Ga0496117_0030586 3300048920 Bacteria 4128
636 Ga0496117_0056551 3300048920 Bacteria 2731
637 Ga0496118_0120057 3300048921 Bacteria 1716
638 Ga0496118_0155211 3300048921 Bacteria 1425
639 Ga0496118_0188913 3300048921 Bacteria 1234
640 Ga0496119_0005089 3300048922 Bacteria 12762
641 Ga0496119_0008370 3300048922 Bacteria 9100
642 Ga0496119_0022762 3300048922 Bacteria 4473
643 Ga0496119_0183336 3300048922 Bacteria 1096
644 Ga0496120_0003966 3300048923 Bacteria 12866
645 Ga0496120_0051956 3300048923 Bacteria 2337
646 Ga0496121_0023379 3300048924 Bacteria 5955
647 Ga0496122_0000169 3300048925 Bacteria 155380
648 Ga0496122_0003279 3300048925 Bacteria 21451
649 Ga0496122_0053369 3300048925 Bacteria 3048
650 Ga0496123_0001393 3300048926 Bacteria 33882
651 Ga0496123_0001911 3300048926 Bacteria 27177
652 Ga0496123_0002716 3300048926 Bacteria 21264
653 Ga0496123_0003363 3300048926 Bacteria 18084
654 Ga0496124_0000484 3300048927 Bacteria 68281
655 Ga0496124_0006649 3300048927 Bacteria 12541
656 Ga0496124_0010167 3300048927 Bacteria 9568
657 Ga0496124_0011735 3300048927 Bacteria 8738
658 Ga0496124_0064232 3300048927 Bacteria 3065
659 Ga0496124_0185603 3300048927 Bacteria 1596
660 Ga0496124_0265532 3300048927 Bacteria 1260
661 Ga0496124_0416224 3300048927 Bacteria 928
662 Ga0496125_0000916 3300048928 Bacteria 46400
663 Ga0496125_0004916 3300048928 Bacteria 15128
664 Ga0496125_0051385 3300048928 Bacteria 3400
665 Ga0496125_0127054 3300048928 Bacteria 1804
666 Ga0496125_0131621 3300048928 Bacteria 1760
667 Ga0496126_0001412 3300048929 Bacteria 38001
668 Ga0496126_0104768 3300048929 Bacteria 2471
669 Ga0495678_000056 3300049459 Bacteria 149598
670 Ga0495678_000079 3300049459 Bacteria 122038
671 Ga0495678_000449 3300049459 Bacteria 40814
672 Ga0495678_000565 3300049459 Bacteria 35612
673 Ga0495678_006643 3300049459 Bacteria 6121
674 Ga0495682_0000095 3300049460 Bacteria 77918
675 Ga0495682_0000378 3300049460 Bacteria 32210
676 Ga0495682_0000610 3300049460 Bacteria 24098
677 Ga0495682_0011263 3300049460 Bacteria 3442
678 Ga0495682_0040989 3300049460 Bacteria 1697
679 Ga0495682_0046845 3300049460 Bacteria 1577
680 Ga0495682_0196966 3300049460 Bacteria 715
681 Ga0501034_0387661 3300049571 Bacteria 1321
682 Ga0501036_0115471 3300049572 Bacteria 2268
683 Ga0501041_0194118 3300049577 Bacteria 1272
684 Ga0501046_0073916 3300049580 Bacteria 2644
685 Ga0501047_0092639 3300049581 Bacteria 2900
686 Ga0501047_0274909 3300049581 Bacteria 1530
687 Ga0501073_0225096 3300049589 Bacteria 1296
688 Ga0501076_0244872 3300049592 Bacteria 1467
689 Ga0501240_019454 3300049673 Bacteria 1009
690 Ga0501080_0025339 3300049742 Bacteria 5503
691 Ga0501083_0128850 3300049744 Bacteria 1659
692 Ga0501035_0003724 3300049822 Bacteria 14537
693 Ga0501044_0237922 3300049823 Bacteria 1766
694 nmdc:mga08x19_211136_c1 3300050514 Bacteria 1332
695 Ga0500618_000138 3300053125 Bacteria 61503
696 Ga0587068_012394 3300059641 Bacteria 1300
697 Ga0587107_007464 3300059652 Bacteria 1233
698 2511273008 2511231007 Bacteria 6306603
699 2513555954 2513237082 Bacteria 8640282
700 2516017127 2515154189 Bacteria 9629850
701 2554818575 2554235132 Bacteria 6772433
702 2599411448 2599185169 Bacteria 5441380
703 2601522956 2600255254 Bacteria 5281859
704 2601527983 2600255255 Bacteria 5282785
705 2601614817 2600255280 Bacteria 5292309
706 2601619534 2600255281 Bacteria 5288753
707 2601641871 2600255287 Bacteria 5210468
708 2601646708 2600255288 Bacteria 5282738
709 2601656347 2600255289 Bacteria 5281907
710 2601658287 2600255290 Bacteria 5282218
711 2601665911 2600255291 Bacteria 5217298
712 2601698768 2600255298 Bacteria 5215185
713 2601701614 2600255299 Bacteria 5218662
714 2601706808 2600255300 Bacteria 5287774
715 2601711112 2600255301 Bacteria 5280532
716 2601716126 2600255302 Bacteria 5288235
717 2601719678 2600255303 Bacteria 5219315
718 2601726532 2600255304 Bacteria 5283973
719 2601731073 2600255305 Bacteria 5282329
720 2601736088 2600255306 Bacteria 5281613
721 2601741498 2600255307 Bacteria 5439064
722 2601752248 2600255309 Bacteria 5431045
723 2602019089 2600255392 Bacteria 5437392
724 2603661372 2602042052 Bacteria 5215873
725 2603664326 2602042053 Bacteria 5214361
726 2603838468 2602042103 Bacteria 5284714
727 2603843545 2602042104 Bacteria 5281639
728 2603848619 2602042105 Bacteria 5282303
729 2603853692 2602042106 Bacteria 5282744
730 2603868779 2602042109 Bacteria 5152801
731 2603871746 2602042110 Bacteria 5283285
732 2603876648 2602042111 Bacteria 5212080
733 2606048936 2603880178 Bacteria 5283018
734 2606068756 2603880184 Bacteria 5217896
735 2606144549 2603880202 Bacteria 5284684
736 2606176339 2603880211 Bacteria 5284226
737 2608384239 2606217733 Bacteria 6360972
738 2637224272 2636415599 Bacteria 5718434
739 2643797905 2643221556 Bacteria 7251154
740 2643831111 2643221562 Bacteria 4048635
741 2644027402 2643221603 Bacteria 6147767
742 2644237287 2643221643 Bacteria 5749658
743 2644250951 2643221645 Bacteria 7207331
744 2644356366 2643221664 Bacteria 7272945
745 2644473084 2643221684 Bacteria 7145183
746 2676405674 2675903046 Bacteria 5451247
747 2729148711 2728369097 Bacteria 4333476
748 2738825393 2738541297 Bacteria 6549566
749 2738846226 2738541300 Bacteria 6675882
750 2739149190 2738541357 Bacteria 6549408
751 2739191109 2738543003 Bacteria 6549560
752 2739275125 2738543018 Bacteria 6718814
753 2739317586 2738543026 Bacteria 6549408
754 2739335827 2738543029 Bacteria 6549249
755 2739344169 2738543030 Bacteria 6719714
756 2777020756 2775507074 Bacteria 5532402
757 2809144391 2808606418 Bacteria 6724496
758 2821133991 2821131069 Bacteria 6108407
759 2857564547 2857558681 Bacteria 6617694
760 2894024100 2894023352 Bacteria 5167372
761 2904429204 2904424332 Bacteria 7633521
762 2904507960 2904504865 Bacteria 5152820
763 2928159725 2928157003 Bacteria 7522202
764 2932422618 2932422444 Bacteria 4678430
765 2939634816 2939631187 Bacteria 6118131
766 2969081312 2969079654 Bacteria 5439582
767 2984563775 2984559226 Bacteria 5683096
768 2984596507 2984595703 Bacteria 5682994
769 642415789 641736154 Bacteria 7689995
770 8015397726 8015394850 Bacteria 5064660
771 8047677907 8047673197 Bacteria 7395230
772 8055226199 8055225921 Bacteria 3341787
773 Ga0495597_0076063
774 JGI25154J39366_1002119
775 JGI25163J39215_1000028
776 JGI25164J39214_1000107
777 JGI25152J39213_1014295
778 JGI25159J45721_1000601
779 JGI25165J46597_1000218
780 rootH1_10043487
781 Ga0055525_1000135
782 Ga0055526_1000110
783 Ga0055537_1000284
784 Ga0055524_1006844
785 Ga0055534_1000059
786 Ga0055528_1000124
787 Ga0055543_1007100
788 Ga0065165_1000050
789 Ga0065165_1010202
790 Ga0070658_10001501
791 Ga0070680_100043772
792 Ga0070682_100052125
793 Ga0070660_100051350
794 Ga0070660_100077774
795 Ga0070661_100227593
796 Ga0070669_100290047
797 Ga0070714_100169783
798 Ga0070679_100026869
799 Ga0070684_100033946
800 Ga0068853_100016929
801 Ga0068853_100741298
802 Ga0068855_100006913
803 Ga0068855_100134421
804 Ga0070664_100044370
805 Ga0070664_100213336
806 Ga0068854_100140395
807 Ga0068852_100106833
808 Ga0068861_100031002
809 Ga0068851_10009237
810 Ga0070717_10094997
811 Ga0075362_10030522
812 Ga0068871_100610880
813 Ga0075436_100262641
814 Ga0099826_10000003
815 Ga0105251_10001634
816 Ga0105251_10042925
817 Ga0105251_10076207
818 Ga0105244_10004218
819 Ga0105244_10006422
820 Ga0105244_10007894
821 Ga0105244_10009942
822 Ga0105250_10001524
823 Ga0105250_10002509
824 Ga0105240_10089222
825 Ga0105240_10393415
826 Ga0105245_10052912
827 Ga0105243_10001703
828 Ga0105241_10009038
829 Ga0105241_10343692
830 Ga0105238_10055978
831 Ga0105239_10071052
832 Ga0157373_10005862
833 Ga0157371_10000001
834 Ga0157371_10007873
835 Ga0157371_10020003
836 Ga0157370_10004280
837 Ga0157370_10074910
838 Ga0157370_10158140
839 Ga0157370_10191145
840 Ga0157369_10004954
841 Ga0157369_10013873
842 Ga0157369_10675990
843 Ga0163162_10263821
844 Ga0157372_10043201
845 Ga0157372_10055155
846 Ga0157372_10094965
847 Ga0157372_10751311
848 Ga0157375_10800698
849 Ga0182008_10101808
850 Ga0182005_1002413
851 Ga0182005_1005606
852 Ga0213872_10000002
853 Ga0213872_10005552
854 Ga0213872_10011940
855 Ga0209760_100020
856 Ga0209436_104856
857 Ga0209563_100036
858 Ga0207427_100006
859 Ga0209437_100013
860 Ga0209437_106803
861 Ga0209646_1000117
862 Ga0209026_1009208
863 Ga0209148_1000298
864 Ga0209129_1002747
865 Ga0209233_1000022
866 Ga0209565_1000006
867 Ga0209673_1000004
868 Ga0209130_1000065
869 Ga0209675_1000006
870 Ga0209025_1004912
871 Ga0209564_1000038
872 Ga0209564_1000064
873 Ga0209564_1041708
874 Ga0209758_1000803
875 Ga0209256_1000013
876 Ga0209256_1000365
877 Ga0207656_10027760
878 Ga0207696_1001500
879 Ga0207696_1002414
880 Ga0207655_1002995
881 Ga0207655_1017635
882 Ga0207655_1019803
883 Ga0207713_1000024
884 Ga0207713_1055231
885 Ga0207654_10080902
886 Ga0207695_10294291
887 Ga0207660_10012052
888 Ga0207657_10001327
889 Ga0207657_10014755
890 Ga0207649_10111432
891 Ga0207664_10142949
892 Ga0207709_10000117
893 Ga0207661_10024149
894 Ga0207679_10295864
895 Ga0207667_10006285
896 Ga0207667_10402715
897 Ga0207667_10421009
898 Ga0207640_10124573
899 Ga0207703_10454247
900 Ga0207639_10567145
901 Ga0207678_10178285
902 Ga0207702_10129161
903 Ga0207674_10359504
904 Ga0207675_100097998
905 Ga0209282_1000002
906 Ga0316181_1077120
907 Ga0265332_10044632
908 Ga0265331_10090732
909 Ga0265327_10059110
910 Ga0265316_10321435
911 Ga0307408_100000461
912 Ga0265314_10001032
913 Ga0265342_10141992
914 Ga0307411_10104209
915 Ga0395899_0000141
916 Ga0395899_0000962
917 Ga0395899_0048791
918 Ga0395899_0235813
919 Ga0395899_0358560
920 Ga0395900_0000550
921 Ga0395900_0271209
922 Ga0395905_0025457
923 Ga0395905_0173557
924 Ga0395901_0000073
925 Ga0400486_23214
926 Ga0400489_53656
927 Ga0436361_0154055
928 Ga0436361_0584108
929 Ga0436361_1009709
930 Ga0436361_1165509
931 Ga0439438_000002
932 Ga0439438_001771
933 Ga0439447_000704
934 Ga0439466_0000001
935 Ga0439466_0000913
936 Ga0439432_000295
937 Ga0439451_002484
938 Ga0439452_001060
939 Ga0439452_009893
940 Ga0439456_000306
941 Ga0439456_012038
942 Ga0450907_021497
943 Ga0439434_0000037
944 Ga0439460_0001533
945 Ga0466972_0000029
946 Ga0466972_0007618
947 Ga0453683_0001365
948 Ga0453683_0014203
949 Ga0466965_0000599
950 Ga0466965_0037202
951 Ga0466966_0001041
952 Ga0466966_0011708
953 Ga0466961_0003208
954 Ga0466961_0048871
955 Ga0466961_0181121
956 Ga0466964_0003420
957 Ga0466964_0009814
958 Ga0466964_0046403
959 Ga0466971_0005347
960 Ga0466968_0002143
961 Ga0466970_0000701
962 Ga0466970_0004144
963 Ga0466970_0217674
964 Ga0466970_0313579
965 Ga0466957_0000386
966 Ga0466957_0007223
967 Ga0466957_0300242
968 Ga0466959_0002124
969 Ga0466959_0021570
970 Ga0466959_0063627
971 Ga0466959_0076389
972 Ga0451576_0003730
973 Ga0451576_0081461
974 Ga0495617_000007
975 Ga0495617_000138
976 Ga0495617_000433
977 Ga0495617_105191
978 Ga0495627_000174
979 Ga0495627_001312
980 Ga0495627_011935
981 Ga0495603_0012022
982 Ga0495590_0000004
983 Ga0495590_0000007
984 Ga0495590_0000287
985 Ga0495590_0004196
986 Ga0495591_000039
987 Ga0495591_000310
988 Ga0495629_0004670
989 Ga0495629_0017142
990 Ga0495638_0000023
991 Ga0495638_0010460
992 Ga0495638_0045065
993 Ga0495638_0048659
994 Ga0495638_0066732
995 Ga0495653_0008794
996 Ga0495653_0085772
997 Ga0495653_0159421
998 Ga0495650_0000154
999 Ga0495650_0000320
1000 Ga0495650_0001964
1001 Ga0495650_0077965
1002 Ga0495580_0183491
1003 Ga0495580_0192523
1004 Ga0495582_0003493
1005 Ga0495582_0025219
1006 Ga0495582_0117379
1007 Ga0495605_0000133
1008 Ga0495605_0000169
1009 Ga0495605_0020011
1010 Ga0495605_0046434
1011 Ga0495605_0055141
1012 Ga0495639_0087431
1013 Ga0495584_0000010
1014 Ga0495584_0000678
1015 Ga0495584_0001011
1016 Ga0495584_0001901
1017 Ga0495584_0009175
1018 Ga0495584_0044712
1019 Ga0495584_0062617
1020 Ga0495584_0075250
1021 Ga0495584_0138493
1022 Ga0495584_0212819
1023 Ga0495585_0000004
1024 Ga0495585_0000451
1025 Ga0495585_0000935
1026 Ga0495585_0001097
1027 Ga0495585_0001154
1028 Ga0495585_0001166
1029 Ga0495585_0001278
1030 Ga0495585_0003335
1031 Ga0495585_0024506
1032 Ga0495585_0046425
1033 Ga0495585_0047395
1034 Ga0495585_0063889
1035 Ga0495585_0102595
1036 Ga0495585_0130479
1037 Ga0495585_0283387
1038 Ga0495594_0007839
1039 Ga0495594_0020081
1040 Ga0495596_0000608
1041 Ga0495596_0000617
1042 Ga0495596_0001806
1043 Ga0495596_0004514
1044 Ga0495596_0006947
1045 Ga0495596_0010807
1046 Ga0495596_0011029
1047 Ga0495596_0060511
1048 Ga0495607_0000261
1049 Ga0495607_0001157
1050 Ga0495607_0002475
1051 Ga0495607_0007573
1052 Ga0495607_0018160
1053 Ga0495607_0032895
1054 Ga0495607_0033200
1055 Ga0495607_0179741
1056 Ga0495583_0000084
1057 Ga0495583_0001335
1058 Ga0495583_0001776
1059 Ga0495583_0002955
1060 Ga0495583_0003212
1061 Ga0495583_0005922
1062 Ga0495583_0031730
1063 Ga0495583_0045571
1064 Ga0495583_0051211
1065 Ga0495583_0115797
1066 Ga0495583_0124301
1067 Ga0495606_0000037
1068 Ga0495606_0000402
1069 Ga0495606_0000533
1070 Ga0495606_0000576
1071 Ga0495606_0000982
1072 Ga0495606_0002384
1073 Ga0495606_0002810
1074 Ga0495606_0003445
1075 Ga0495606_0009074
1076 Ga0495606_0012562
1077 Ga0495606_0019010
1078 Ga0495606_0039354
1079 Ga0495606_0050693
1080 Ga0495606_0052508
1081 Ga0495606_0055725
1082 Ga0495606_0128971
1083 Ga0495606_0148232
1084 Ga0495606_0216569
1085 Ga0495606_0224489
1086 Ga0495610_0000004
1087 Ga0495610_0000128
1088 Ga0495610_0000428
1089 Ga0495610_0001171
1090 Ga0495610_0005473
1091 Ga0495610_0021762
1092 Ga0495610_0024589
1093 Ga0495616_0000269
1094 Ga0495616_0000344
1095 Ga0495616_0001060
1096 Ga0495616_0001272
1097 Ga0495616_0001627
1098 Ga0495616_0002122
1099 Ga0495616_0012422
1100 Ga0495616_0014231
1101 Ga0495616_0019934
1102 Ga0495616_0028294
1103 Ga0495616_0034553
1104 Ga0495616_0048310
1105 Ga0495616_0069156
1106 Ga0495616_0079823
1107 Ga0495620_0025247
1108 Ga0495630_0258890
1109 Ga0495631_0000886
1110 Ga0495631_0003700
1111 Ga0495631_0021272
1112 Ga0495631_0024386
1113 Ga0495631_0027447
1114 Ga0495631_0042274
1115 Ga0495632_0000504
1116 Ga0495632_0001557
1117 Ga0495632_0006690
1118 Ga0495632_0009303
1119 Ga0495632_0032005
1120 Ga0495637_0000006
1121 Ga0495637_0000223
1122 Ga0495637_0024391
1123 Ga0495643_0000196
1124 Ga0495643_0000239
1125 Ga0495643_0003999
1126 Ga0495643_0130596
1127 Ga0495643_0219819
1128 Ga0495644_0012766
1129 Ga0495644_0037310
1130 Ga0495644_0051309
1131 Ga0495648_0000007
1132 Ga0495648_0001034
1133 Ga0495648_0002116
1134 Ga0495648_0005003
1135 Ga0495648_0009830
1136 Ga0495648_0018262
1137 Ga0495648_0029372
1138 Ga0495648_0029956
1139 Ga0495648_0088687
1140 Ga0495648_0149311
1141 Ga0495648_0162848
1142 Ga0495663_0073619
1143 Ga0495663_0074604
1144 Ga0495666_0047360
1145 Ga0495666_0075095
1146 Ga0495642_0000383
1147 Ga0495642_0000499
1148 Ga0495642_0001165
1149 Ga0495642_0001497
1150 Ga0495642_0001671
1151 Ga0495642_0019207
1152 Ga0495642_0053029
1153 Ga0495642_0072656
1154 Ga0495642_0102339
1155 Ga0495642_0120098
1156 Ga0495652_0024781
1157 Ga0495652_0086848
1158 Ga0495654_0000004
1159 Ga0495654_0001755
1160 Ga0495654_0001896
1161 Ga0495654_0003847
1162 Ga0495654_0006878
1163 Ga0495654_0010948
1164 Ga0495665_0053775
1165 Ga0495665_0082749
1166 Ga0495586_0005660
1167 Ga0495587_0009893
1168 Ga0495587_0303542
1169 Ga0495609_0000545
1170 Ga0495609_0000732
1171 Ga0495609_0000832
1172 Ga0495609_0000847
1173 Ga0495609_0000856
1174 Ga0495609_0004528
1175 Ga0495609_0009843
1176 Ga0495609_0021589
1177 Ga0495609_0038242
1178 Ga0495609_0059848
1179 Ga0495609_0138079
1180 Ga0495597_0000239
1181 Ga0495597_0000479
1182 Ga0495597_0000496
1183 Ga0495597_0000621
1184 Ga0495597_0001375
1185 Ga0495597_0136501
1186 Ga0495597_0136802
1187 Ga0495645_0211932
1188 Ga0495622_0000003
1189 Ga0495622_0007635
1190 Ga0495622_0089412
1191 Ga0495633_0000541
1192 Ga0495633_0001029
1193 Ga0495633_0002925
1194 Ga0495633_0003831
1195 Ga0495633_0005412
1196 Ga0495633_0015370
1197 Ga0495633_0016694
1198 Ga0495633_0020676
1199 Ga0495633_0027375
1200 Ga0495633_0028557
1201 Ga0495633_0043503
1202 Ga0495633_0167059
1203 Ga0495656_0007063
1204 Ga0495656_0037398
1205 Ga0495656_0041726
1206 Ga0495656_0061928
1207 Ga0495668_0000049
1208 Ga0495668_0000051
1209 Ga0495668_0001802
1210 Ga0495668_0001821
1211 Ga0495668_0002559
1212 Ga0495668_0003825
1213 Ga0495668_0011300
1214 Ga0495668_0043218
1215 Ga0495668_0064421
1216 Ga0495668_0105447
1217 Ga0495668_0271193
1218 Ga0495634_0058086
1219 Ga0495611_0000496
1220 Ga0495611_0054994
1221 Ga0495611_0061461
1222 Ga0495611_0243923
1223 Ga0495625_0023566
1224 Ga0495625_0035638
1225 Ga0495625_0085276
1226 Ga0495625_0131054
1227 Ga0495625_0172548
1228 Ga0495625_0254275
1229 Ga0495625_0341234
1230 Ga0495635_0020507
1231 Ga0495659_0018014
1232 Ga0495659_0034369
1233 Ga0495661_0000338
1234 Ga0495661_0000651
1235 Ga0495661_0000802
1236 Ga0495661_0012141
1237 Ga0495661_0012900
1238 Ga0495661_0020847
1239 Ga0495661_0023696
1240 Ga0495661_0057951
1241 Ga0495661_0088408
1242 Ga0495661_0121830
1243 Ga0495661_0126846
1244 Ga0495661_0134896
1245 Ga0495661_0198110
1246 Ga0495588_0000226
1247 Ga0495588_0000447
1248 Ga0495588_0017069
1249 Ga0495588_0017445
1250 Ga0495588_0031570
1251 Ga0495588_0032033
1252 Ga0495588_0111710
1253 Ga0495588_0247320
1254 Ga0495623_0065228
1255 Ga0495669_0001886
1256 Ga0495669_0010859
1257 Ga0495669_0020156
1258 Ga0495669_0067605
1259 Ga0495613_0107974
1260 Ga0495624_0013524
1261 Ga0495670_0007797
1262 Ga0495670_0009193
1263 Ga0495670_0024751
1264 Ga0495670_0040525
1265 Ga0495670_0048885
1266 Ga0495671_0000070
1267 Ga0495671_0000192
1268 Ga0495671_0000422
1269 Ga0495671_0000483
1270 Ga0495671_0000602
1271 Ga0495671_0001766
1272 Ga0495671_0013388
1273 Ga0495671_0041693
1274 Ga0495671_0046098
1275 Ga0495671_0072158
1276 Ga0495671_0157021
1277 Ga0495649_0000184
1278 Ga0495649_0000424
1279 Ga0495649_0057588
1280 Ga0495649_0123385
1281 Ga0495649_0183789
1282 Ga0495589_0000188
1283 Ga0495589_0000921
1284 Ga0495589_0008404
1285 Ga0495589_0014417
1286 Ga0495589_0020128
1287 Ga0495600_0109674
1288 Ga0495660_0000394
1289 Ga0495660_0001755
1290 Ga0495660_0002473
1291 Ga0495660_0027715
1292 Ga0495660_0055373
1293 Ga0495660_0066006
1294 Ga0495660_0131388
1295 Ga0495660_0158241
1296 Ga0495581_0490654
1297 Ga0495604_0007372
1298 Ga0495636_0017913
1299 Ga0495636_0074010
1300 Ga0495674_0003686
1301 Ga0495672_0000015
1302 Ga0495672_0000441
1303 Ga0495672_0000695
1304 Ga0495672_0001226
1305 Ga0495672_0046603
1306 Ga0495672_0100740
1307 Ga0495676_0000014
1308 Ga0495676_0005083
1309 Ga0495676_0056475
1310 Ga0495676_0112139
1311 Ga0495680_0013638
1312 Ga0495683_0000180
1313 Ga0495683_0000306
1314 Ga0495683_0002293
1315 Ga0495683_0007893
1316 Ga0495683_0034699
1317 Ga0495683_0060138
1318 Ga0495683_0070268
1319 Ga0495683_0080155
1320 Ga0495683_0118400
1321 Ga0495683_0135778
1322 Ga0495687_000049
1323 Ga0495687_000088
1324 Ga0495687_000533
1325 Ga0495687_000732
1326 Ga0495687_000848
1327 Ga0495687_000928
1328 Ga0495687_001000
1329 Ga0495687_026413
1330 Ga0495687_034718
1331 Ga0495675_0011916
1332 Ga0495677_0000286
1333 Ga0495677_0003083
1334 Ga0495677_0003494
1335 Ga0495677_0010972
1336 Ga0495677_0053896
1337 Ga0495677_0090213
1338 Ga0495679_000965
1339 Ga0495679_000979
1340 Ga0495679_004840
1341 Ga0495679_011850
1342 Ga0495679_015636
1343 Ga0495679_017285
1344 Ga0495685_008963
1345 Ga0495685_009579
1346 Ga0495673_0000017
1347 Ga0495673_0000027
1348 Ga0495673_0005555
1349 Ga0495673_0024772
1350 Ga0495681_0000073
1351 Ga0495681_0000127
1352 Ga0495681_0000168
1353 Ga0495681_0012405
1354 Ga0495681_0012756
1355 Ga0495681_0012820
1356 Ga0495681_0033177
1357 Ga0495681_0060135
1358 Ga0495681_0069432
1359 Ga0495686_0000696
1360 Ga0495686_0001565
1361 Ga0495686_0009279
1362 Ga0495686_0011457
1363 Ga0495686_0018422
1364 Ga0495686_0021104
1365 Ga0495686_0114693
1366 Ga0495602_0001704
1367 Ga0495602_0264797
1368 Ga0495614_0016008
1369 Ga0495614_0103412
1370 Ga0495626_0000677
1371 Ga0495626_0001122
1372 Ga0495626_0001575
1373 Ga0495626_0001656
1374 Ga0495626_0002929
1375 Ga0495626_0003190
1376 Ga0495626_0003269
1377 Ga0495626_0007954
1378 Ga0495626_0019732
1379 Ga0495626_0023535
1380 Ga0495626_0044686
1381 Ga0495626_0061379
1382 Ga0495626_0094654
1383 Ga0495626_0150249
1384 Ga0495626_0150256
1385 Ga0496100_0232150
1386 Ga0496101_0009552
1387 Ga0496102_0002678
1388 Ga0496102_0179889
1389 Ga0496102_0286742
1390 Ga0496103_0008794
1391 Ga0496103_0019302
1392 Ga0496103_0150959
1393 Ga0496104_0047423
1394 Ga0496105_0257209
1395 Ga0496106_0006898
1396 Ga0496106_0070812
1397 Ga0496109_0006624
1398 Ga0496110_0000065
1399 Ga0496110_0252368
1400 Ga0496111_0032691
1401 Ga0496111_0214931
1402 Ga0496115_0001661
1403 Ga0496115_0025058
1404 Ga0496116_0002320
1405 Ga0496116_0008949
1406 Ga0496116_0020781
1407 Ga0496117_0030586
1408 Ga0496117_0056551
1409 Ga0496118_0120057
1410 Ga0496118_0155211
1411 Ga0496118_0188913
1412 Ga0496119_0005089
1413 Ga0496119_0008370
1414 Ga0496119_0022762
1415 Ga0496119_0183336
1416 Ga0496120_0003966
1417 Ga0496120_0051956
1418 Ga0496121_0023379
1419 Ga0496122_0000169
1420 Ga0496122_0003279
1421 Ga0496122_0053369
1422 Ga0496123_0001393
1423 Ga0496123_0001911
1424 Ga0496123_0002716
1425 Ga0496123_0003363
1426 Ga0496124_0000484
1427 Ga0496124_0006649
1428 Ga0496124_0010167
1429 Ga0496124_0011735
1430 Ga0496124_0064232
1431 Ga0496124_0185603
1432 Ga0496124_0265532
1433 Ga0496124_0416224
1434 Ga0496125_0000916
1435 Ga0496125_0004916
1436 Ga0496125_0051385
1437 Ga0496125_0127054
1438 Ga0496125_0131621
1439 Ga0496126_0001412
1440 Ga0496126_0104768
1441 Ga0495678_000056
1442 Ga0495678_000079
1443 Ga0495678_000449
1444 Ga0495678_000565
1445 Ga0495678_006643
1446 Ga0495682_0000095
1447 Ga0495682_0000378
1448 Ga0495682_0000610
1449 Ga0495682_0011263
1450 Ga0495682_0040989
1451 Ga0495682_0046845
1452 Ga0495682_0196966
1453 Ga0501034_0387661
1454 Ga0501036_0115471
1455 Ga0501041_0194118
1456 Ga0501046_0073916
1457 Ga0501047_0092639
1458 Ga0501047_0274909
1459 Ga0501073_0225096
1460 Ga0501076_0244872
1461 Ga0501240_019454
1462 Ga0501080_0025339
1463 Ga0501083_0128850
1464 Ga0501035_0003724
1465 Ga0501044_0237922
1466 nmdc:mga08x19_211136_c1
1467 Ga0500618_000138
1468 Ga0587068_012394
1469 Ga0587107_007464
1470 2511273008
1471 2513555954
1472 2516017127
1473 2554818575
1474 2599411448
1475 2601522956
1476 2601527983
1477 2601614817
1478 2601619534
1479 2601641871
1480 2601646708
1481 2601656347
1482 2601658287
1483 2601665911
1484 2601698768
1485 2601701614
1486 2601706808
1487 2601711112
1488 2601716126
1489 2601719678
1490 2601726532
1491 2601731073
1492 2601736088
1493 2601741498
1494 2601752248
1495 2602019089
1496 2603661372
1497 2603664326
1498 2603838468
1499 2603843545
1500 2603848619
1501 2603853692
1502 2603868779
1503 2603871746
1504 2603876648
1505 2606048936
1506 2606068756
1507 2606144549
1508 2606176339
1509 2608384239
1510 2637224272
1511 2643797905
1512 2643831111
1513 2644027402
1514 2644237287
1515 2644250951
1516 2644356366
1517 2644473084
1518 2676405674
1519 2729148711
1520 2738825393
1521 2738846226
1522 2739149190
1523 2739191109
1524 2739275125
1525 2739317586
1526 2739335827
1527 2739344169
1528 2777020756
1529 2809144391
1530 2821133991
1531 2857564547
1532 2894024100
1533 2904429204
1534 2904507960
1535 2928159725
1536 2932422618
1537 2939634816
1538 2969081312
1539 2984563775
1540 2984596507
1541 642415789
1542 8015397726
1543 8047677907
1544 8055226199

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

46

256

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6oih-assembly1.cif.gz_D crystal structure of o-antigen polysaccharide abc-transporter 0.8919 15 264
6oih-assembly2.cif.gz_C crystal structure of o-antigen polysaccharide abc-transporter 0.8832 15 264
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.883 15 266
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.879 15 264
6oih-assembly1.cif.gz_D crystal structure of o-antigen polysaccharide abc-transporter 0.8786 15 264
ID Description Score Start End Superfamily
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6253 71 254 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.595 67 255 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5411 70 266 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4585 71 254 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4381 67 255 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A1G7ZXH7-F1-model_v4 Lipopolysaccharide transport system permease protein 0.9715 58 266 GO:0005886
GO:0015920
GO:0140359
AF-A0A4P6L157-F1-model_v4 Transport permease protein 0.9698 2 266 GO:0005886
GO:0015920
GO:0140359
AF-A0A0X8XC14-F1-model_v4 Transport permease protein 0.9694 33 266 GO:0005886
GO:0015920
GO:0140359
AF-A0A1G7ZXH7-F1-model_v4 Lipopolysaccharide transport system permease protein 0.9669 58 266 GO:0005886
GO:0015920
GO:0140359
AF-A0A0X8XC14-F1-model_v4 Transport permease protein 0.9653 33 266 GO:0005886
GO:0015920
GO:0140359

Map