F480133
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 772 | 292 | 772 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300049570|Ga0501033_0346609|Ga0501033_0346609_558_1028 |
| Length | 156 |
| Sequence | MAVERTLTIIKPDAVAKGVIGRIISRFEEAGLTIVAAQLVHLTAAQAAGFYVVHRDRPFYASLCAFMTQGPCLPMVLEGDNAIARLRELMGATNPAQAAPGTIRRDFASSIEANAVHGSDSPASAAFEIPYFFAAIDLGARPFTLDNPASRGSDLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 3 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 4 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 84 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 104 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 178 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 179 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 180 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 181 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 183 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 184 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 185 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 186 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 188 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 189 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 190 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 191 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 192 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 193 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 194 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 204 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 205 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 206 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 207 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 209 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 210 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 211 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 212 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 213 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 214 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 215 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 216 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 217 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 218 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 219 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 220 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 221 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 222 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 246 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 247 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 248 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 250 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 251 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 252 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 278 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.74 |
| Metatranscriptomes | 0.26 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.04 |
| Rhizosphere | 98.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10003938 | 3300003203 | Bacteria | 6941 |
| 2 | JGI26128J50194_1001745 | 3300003347 | Bacteria | 1401 |
| 3 | JGI26129J50193_1002186 | 3300003349 | Bacteria | 1370 |
| 4 | JGI26145J50221_1004190 | 3300003371 | Bacteria | 1164 |
| 5 | Ga0065704_10300065 | 3300005289 | Bacteria | 870 |
| 6 | Ga0065707_10189561 | 3300005295 | Bacteria | 1369 |
| 7 | Ga0070676_10072020 | 3300005328 | Bacteria | 2077 |
| 8 | Ga0070676_10403122 | 3300005328 | Bacteria | 952 |
| 9 | Ga0070690_100099974 | 3300005330 | Bacteria | 1922 |
| 10 | Ga0070690_100348285 | 3300005330 | Bacteria | 1075 |
| 11 | Ga0070670_100001558 | 3300005331 | Bacteria | 18473 |
| 12 | Ga0070670_100397997 | 3300005331 | Bacteria | 1215 |
| 13 | Ga0070677_10085365 | 3300005333 | Bacteria | 1361 |
| 14 | Ga0070677_10176291 | 3300005333 | Bacteria | 1015 |
| 15 | Ga0068869_100000795 | 3300005334 | Bacteria | 18019 |
| 16 | Ga0068869_100002588 | 3300005334 | Bacteria | 10924 |
| 17 | Ga0070666_10222011 | 3300005335 | Bacteria | 1333 |
| 18 | Ga0070680_100022284 | 3300005336 | Bacteria | 5043 |
| 19 | Ga0070680_100041507 | 3300005336 | Bacteria | 3730 |
| 20 | Ga0070682_100000179 | 3300005337 | Bacteria | 47429 |
| 21 | Ga0070660_100000476 | 3300005339 | Bacteria | 26750 |
| 22 | Ga0070689_100117769 | 3300005340 | Bacteria | 2119 |
| 23 | Ga0070691_10002169 | 3300005341 | Bacteria | 8686 |
| 24 | Ga0070691_10004078 | 3300005341 | Bacteria | 6624 |
| 25 | Ga0070691_10014775 | 3300005341 | Bacteria | 3584 |
| 26 | Ga0070687_100053925 | 3300005343 | Bacteria | 2093 |
| 27 | Ga0070661_100003535 | 3300005344 | Bacteria | 10766 |
| 28 | Ga0070668_100647689 | 3300005347 | Bacteria | 928 |
| 29 | Ga0070669_100754242 | 3300005353 | Bacteria | 825 |
| 30 | Ga0070669_101400303 | 3300005353 | Bacteria | 607 |
| 31 | Ga0070669_101702722 | 3300005353 | Bacteria | 550 |
| 32 | Ga0070673_100069126 | 3300005364 | Bacteria | 2830 |
| 33 | Ga0070673_100437437 | 3300005364 | Bacteria | 1175 |
| 34 | Ga0070688_100575453 | 3300005365 | Bacteria | 859 |
| 35 | Ga0070659_100000831 | 3300005366 | Bacteria | 22519 |
| 36 | Ga0070703_10001108 | 3300005406 | Bacteria | 8360 |
| 37 | Ga0070703_10200434 | 3300005406 | Bacteria | 783 |
| 38 | Ga0070709_10239346 | 3300005434 | Bacteria | 1303 |
| 39 | Ga0070714_100089998 | 3300005435 | Bacteria | 2687 |
| 40 | Ga0070713_101273668 | 3300005436 | Bacteria | 712 |
| 41 | Ga0070701_10003890 | 3300005438 | Bacteria | 5963 |
| 42 | Ga0070711_100043201 | 3300005439 | Bacteria | 3051 |
| 43 | Ga0070705_100020219 | 3300005440 | Bacteria | 3519 |
| 44 | Ga0070705_100087499 | 3300005440 | Bacteria | 1931 |
| 45 | Ga0070700_100282179 | 3300005441 | Bacteria | 1204 |
| 46 | Ga0070700_101773915 | 3300005441 | Bacteria | 531 |
| 47 | Ga0070694_100009346 | 3300005444 | Bacteria | 6017 |
| 48 | Ga0070694_100020836 | 3300005444 | Bacteria | 4184 |
| 49 | Ga0070694_100161703 | 3300005444 | Bacteria | 1643 |
| 50 | Ga0070694_100488871 | 3300005444 | Bacteria | 978 |
| 51 | Ga0070694_101007338 | 3300005444 | Bacteria | 692 |
| 52 | Ga0070708_100004603 | 3300005445 | Bacteria | 10860 |
| 53 | Ga0070708_100006589 | 3300005445 | Bacteria | 9242 |
| 54 | Ga0070708_100034392 | 3300005445 | Bacteria | 4409 |
| 55 | Ga0070708_100085159 | 3300005445 | Bacteria | 2868 |
| 56 | Ga0070708_100125603 | 3300005445 | Bacteria | 2371 |
| 57 | Ga0070708_100131633 | 3300005445 | Bacteria | 2315 |
| 58 | Ga0070708_100260968 | 3300005445 | Bacteria | 1628 |
| 59 | Ga0070708_100266552 | 3300005445 | Bacteria | 1610 |
| 60 | Ga0070708_100453768 | 3300005445 | Bacteria | 1209 |
| 61 | Ga0070708_100503594 | 3300005445 | Bacteria | 1142 |
| 62 | Ga0070708_101674497 | 3300005445 | Bacteria | 591 |
| 63 | Ga0070708_101839302 | 3300005445 | Unclassified | 562 |
| 64 | Ga0070663_100004633 | 3300005455 | Bacteria | 8098 |
| 65 | Ga0070662_100007466 | 3300005457 | Bacteria | 7087 |
| 66 | Ga0070662_100019598 | 3300005457 | Bacteria | 4594 |
| 67 | Ga0068867_100000455 | 3300005459 | Bacteria | 27140 |
| 68 | Ga0070706_100044301 | 3300005467 | Bacteria | 4110 |
| 69 | Ga0070706_100055848 | 3300005467 | Bacteria | 3645 |
| 70 | Ga0070706_100061105 | 3300005467 | Bacteria | 3479 |
| 71 | Ga0070706_100098679 | 3300005467 | Bacteria | 2714 |
| 72 | Ga0070706_100231284 | 3300005467 | Bacteria | 1726 |
| 73 | Ga0070706_100300795 | 3300005467 | Bacteria | 1497 |
| 74 | Ga0070706_100311721 | 3300005467 | Bacteria | 1468 |
| 75 | Ga0070706_100362363 | 3300005467 | Bacteria | 1351 |
| 76 | Ga0070706_101299873 | 3300005467 | Bacteria | 667 |
| 77 | Ga0070707_100000653 | 3300005468 | Bacteria | 34576 |
| 78 | Ga0070707_100002097 | 3300005468 | Bacteria | 19110 |
| 79 | Ga0070707_100007614 | 3300005468 | Bacteria | 10056 |
| 80 | Ga0070707_100090616 | 3300005468 | Bacteria | 2959 |
| 81 | Ga0070707_100160597 | 3300005468 | Bacteria | 2190 |
| 82 | Ga0070707_100174924 | 3300005468 | Bacteria | 2092 |
| 83 | Ga0070707_100188393 | 3300005468 | Bacteria | 2011 |
| 84 | Ga0070707_100195256 | 3300005468 | Bacteria | 1973 |
| 85 | Ga0070707_100901755 | 3300005468 | Bacteria | 848 |
| 86 | Ga0070698_100000691 | 3300005471 | Bacteria | 36018 |
| 87 | Ga0070698_100004796 | 3300005471 | Bacteria | 14846 |
| 88 | Ga0070698_100014980 | 3300005471 | Bacteria | 8196 |
| 89 | Ga0070698_100055478 | 3300005471 | Bacteria | 4017 |
| 90 | Ga0070698_100059663 | 3300005471 | Bacteria | 3852 |
| 91 | Ga0070698_100203970 | 3300005471 | Bacteria | 1912 |
| 92 | Ga0070698_100447234 | 3300005471 | Bacteria | 1228 |
| 93 | Ga0070698_100911742 | 3300005471 | Bacteria | 824 |
| 94 | Ga0070698_101083046 | 3300005471 | Bacteria | 750 |
| 95 | Ga0070698_101723082 | 3300005471 | Bacteria | 579 |
| 96 | Ga0070699_100013216 | 3300005518 | Bacteria | 7118 |
| 97 | Ga0070699_100030616 | 3300005518 | Bacteria | 4646 |
| 98 | Ga0070699_100036410 | 3300005518 | Bacteria | 4257 |
| 99 | Ga0070699_100045159 | 3300005518 | Bacteria | 3813 |
| 100 | Ga0070699_100049254 | 3300005518 | Bacteria | 3647 |
| 101 | Ga0070699_100337732 | 3300005518 | Bacteria | 1355 |
| 102 | Ga0070699_100357162 | 3300005518 | Bacteria | 1317 |
| 103 | Ga0070699_100841838 | 3300005518 | Bacteria | 840 |
| 104 | Ga0070699_100947699 | 3300005518 | Bacteria | 789 |
| 105 | Ga0070679_100037758 | 3300005530 | Bacteria | 4799 |
| 106 | Ga0070684_100042713 | 3300005535 | Bacteria | 3915 |
| 107 | Ga0070697_100016378 | 3300005536 | Bacteria | 5829 |
| 108 | Ga0070697_100023819 | 3300005536 | Bacteria | 4873 |
| 109 | Ga0070697_100095843 | 3300005536 | Bacteria | 2461 |
| 110 | Ga0070697_100158015 | 3300005536 | Bacteria | 1914 |
| 111 | Ga0070697_100251041 | 3300005536 | Bacteria | 1513 |
| 112 | Ga0070697_100361715 | 3300005536 | Bacteria | 1254 |
| 113 | Ga0070697_100385861 | 3300005536 | Bacteria | 1214 |
| 114 | Ga0070697_100568403 | 3300005536 | Bacteria | 995 |
| 115 | Ga0070697_101304356 | 3300005536 | Bacteria | 648 |
| 116 | Ga0070697_101796079 | 3300005536 | Bacteria | 548 |
| 117 | Ga0068853_100003324 | 3300005539 | Bacteria | 12308 |
| 118 | Ga0070672_100051439 | 3300005543 | Bacteria | 3213 |
| 119 | Ga0070686_100924816 | 3300005544 | Bacteria | 711 |
| 120 | Ga0070695_100001891 | 3300005545 | Bacteria | 11838 |
| 121 | Ga0070695_100137249 | 3300005545 | Bacteria | 1692 |
| 122 | Ga0070695_100277788 | 3300005545 | Bacteria | 1229 |
| 123 | Ga0070695_100608306 | 3300005545 | Bacteria | 859 |
| 124 | Ga0070695_100827942 | 3300005545 | Bacteria | 743 |
| 125 | Ga0070695_101241927 | 3300005545 | Bacteria | 614 |
| 126 | Ga0070696_100007948 | 3300005546 | Bacteria | 7082 |
| 127 | Ga0070696_100011958 | 3300005546 | Bacteria | 5817 |
| 128 | Ga0070696_100061448 | 3300005546 | Bacteria | 2628 |
| 129 | Ga0070696_100066473 | 3300005546 | Bacteria | 2528 |
| 130 | Ga0070696_100317632 | 3300005546 | Bacteria | 1198 |
| 131 | Ga0070693_100010068 | 3300005547 | Bacteria | 4720 |
| 132 | Ga0070693_100015387 | 3300005547 | Bacteria | 3938 |
| 133 | Ga0070704_100001374 | 3300005549 | Bacteria | 12913 |
| 134 | Ga0070704_100081158 | 3300005549 | Bacteria | 2388 |
| 135 | Ga0070704_100169859 | 3300005549 | Bacteria | 1733 |
| 136 | Ga0070704_100261988 | 3300005549 | Bacteria | 1425 |
| 137 | Ga0068855_100000225 | 3300005563 | Bacteria | 72196 |
| 138 | Ga0070664_100207701 | 3300005564 | Bacteria | 1749 |
| 139 | Ga0068857_100036222 | 3300005577 | Bacteria | 4372 |
| 140 | Ga0068857_100117893 | 3300005577 | Bacteria | 2389 |
| 141 | Ga0068857_100263207 | 3300005577 | Bacteria | 1583 |
| 142 | Ga0068854_100007476 | 3300005578 | Bacteria | 6981 |
| 143 | Ga0068856_100001169 | 3300005614 | Bacteria | 27611 |
| 144 | Ga0070702_100062811 | 3300005615 | Bacteria | 2166 |
| 145 | Ga0068859_100509788 | 3300005617 | Bacteria | 1298 |
| 146 | Ga0068864_100869366 | 3300005618 | Bacteria | 889 |
| 147 | Ga0068866_10163854 | 3300005718 | Bacteria | 1299 |
| 148 | Ga0068861_100007123 | 3300005719 | Bacteria | 7655 |
| 149 | Ga0068870_10007719 | 3300005840 | Bacteria | 4809 |
| 150 | Ga0068870_10272864 | 3300005840 | Bacteria | 1057 |
| 151 | Ga0068863_100033502 | 3300005841 | Bacteria | 4894 |
| 152 | Ga0068858_100113125 | 3300005842 | Bacteria | 2535 |
| 153 | Ga0068858_100433959 | 3300005842 | Bacteria | 1264 |
| 154 | Ga0068860_100001109 | 3300005843 | Bacteria | 29627 |
| 155 | Ga0068860_100212652 | 3300005843 | Bacteria | 1876 |
| 156 | Ga0068860_100403565 | 3300005843 | Bacteria | 1352 |
| 157 | Ga0068862_100003750 | 3300005844 | Bacteria | 12958 |
| 158 | Ga0068862_100342658 | 3300005844 | Bacteria | 1385 |
| 159 | Ga0068862_100456991 | 3300005844 | Bacteria | 1205 |
| 160 | Ga0068862_100869224 | 3300005844 | Bacteria | 885 |
| 161 | Ga0081455_10001810 | 3300005937 | Bacteria | 25776 |
| 162 | Ga0081540_1024694 | 3300005983 | Bacteria | 3481 |
| 163 | Ga0081539_10000005 | 3300005985 | Bacteria | 549026 |
| 164 | Ga0075432_10024616 | 3300006058 | Bacteria | 2064 |
| 165 | Ga0075432_10134811 | 3300006058 | Bacteria | 938 |
| 166 | Ga0075432_10340225 | 3300006058 | Bacteria | 633 |
| 167 | Ga0070715_10650925 | 3300006163 | Bacteria | 624 |
| 168 | Ga0068871_100999311 | 3300006358 | Bacteria | 779 |
| 169 | Ga0075428_100000924 | 3300006844 | Bacteria | 31024 |
| 170 | Ga0075428_100001380 | 3300006844 | Bacteria | 25833 |
| 171 | Ga0075428_100005362 | 3300006844 | Bacteria | 14256 |
| 172 | Ga0075428_100037258 | 3300006844 | Bacteria | 5355 |
| 173 | Ga0075428_100579952 | 3300006844 | Bacteria | 1198 |
| 174 | Ga0075428_100884197 | 3300006844 | Bacteria | 948 |
| 175 | Ga0075428_101050823 | 3300006844 | Bacteria | 861 |
| 176 | Ga0075430_100000487 | 3300006846 | Bacteria | 29740 |
| 177 | Ga0075430_100245726 | 3300006846 | Bacteria | 1483 |
| 178 | Ga0075431_100002180 | 3300006847 | Bacteria | 18719 |
| 179 | Ga0075431_100005577 | 3300006847 | Bacteria | 12425 |
| 180 | Ga0075431_100044298 | 3300006847 | Bacteria | 4590 |
| 181 | Ga0075431_100178495 | 3300006847 | Bacteria | 2180 |
| 182 | Ga0075431_100198080 | 3300006847 | Bacteria | 2056 |
| 183 | Ga0075431_100285247 | 3300006847 | Bacteria | 1671 |
| 184 | Ga0075431_100386286 | 3300006847 | Bacteria | 1403 |
| 185 | Ga0075431_100431648 | 3300006847 | Bacteria | 1315 |
| 186 | Ga0075431_100844821 | 3300006847 | Bacteria | 887 |
| 187 | Ga0075431_101266904 | 3300006847 | Bacteria | 699 |
| 188 | Ga0075433_10006420 | 3300006852 | Bacteria | 9298 |
| 189 | Ga0075433_10019706 | 3300006852 | Bacteria | 5627 |
| 190 | Ga0075433_10030670 | 3300006852 | Bacteria | 4589 |
| 191 | Ga0075433_10043087 | 3300006852 | Bacteria | 3917 |
| 192 | Ga0075433_10050068 | 3300006852 | Bacteria | 3636 |
| 193 | Ga0075433_10799416 | 3300006852 | Bacteria | 824 |
| 194 | Ga0075433_10836521 | 3300006852 | Bacteria | 804 |
| 195 | Ga0075434_100009447 | 3300006871 | Bacteria | 9091 |
| 196 | Ga0075434_100019775 | 3300006871 | Bacteria | 6519 |
| 197 | Ga0075434_100185055 | 3300006871 | Bacteria | 2103 |
| 198 | Ga0075434_100268238 | 3300006871 | Bacteria | 1726 |
| 199 | Ga0075434_100313380 | 3300006871 | Bacteria | 1589 |
| 200 | Ga0075434_100322773 | 3300006871 | Bacteria | 1564 |
| 201 | Ga0075434_100442550 | 3300006871 | Bacteria | 1321 |
| 202 | Ga0075434_100659998 | 3300006871 | Bacteria | 1064 |
| 203 | Ga0075434_100740616 | 3300006871 | Bacteria | 1000 |
| 204 | Ga0075434_100754702 | 3300006871 | Bacteria | 990 |
| 205 | Ga0075434_100781872 | 3300006871 | Bacteria | 971 |
| 206 | Ga0075429_100000859 | 3300006880 | Bacteria | 23924 |
| 207 | Ga0075429_100008092 | 3300006880 | Bacteria | 9139 |
| 208 | Ga0075429_100020425 | 3300006880 | Bacteria | 5747 |
| 209 | Ga0075429_100113445 | 3300006880 | Bacteria | 2369 |
| 210 | Ga0075429_100455868 | 3300006880 | Bacteria | 1120 |
| 211 | Ga0068865_100092831 | 3300006881 | Bacteria | 2194 |
| 212 | Ga0068865_100139728 | 3300006881 | Bacteria | 1825 |
| 213 | Ga0068865_100251966 | 3300006881 | Bacteria | 1394 |
| 214 | Ga0068865_100648292 | 3300006881 | Bacteria | 897 |
| 215 | Ga0075436_100001157 | 3300006914 | Bacteria | 17854 |
| 216 | Ga0075436_100025186 | 3300006914 | Bacteria | 4092 |
| 217 | Ga0075436_100078112 | 3300006914 | Bacteria | 2293 |
| 218 | Ga0075436_100119904 | 3300006914 | Bacteria | 1840 |
| 219 | Ga0097620_100509819 | 3300006931 | Bacteria | 1298 |
| 220 | Ga0075435_100000661 | 3300007076 | Bacteria | 21221 |
| 221 | Ga0075435_100007138 | 3300007076 | Bacteria | 7939 |
| 222 | Ga0075435_100034638 | 3300007076 | Bacteria | 4002 |
| 223 | Ga0075435_100037266 | 3300007076 | Bacteria | 3870 |
| 224 | Ga0075435_100043704 | 3300007076 | Bacteria | 3587 |
| 225 | Ga0075435_100077920 | 3300007076 | Bacteria | 2717 |
| 226 | Ga0075435_100080674 | 3300007076 | Bacteria | 2672 |
| 227 | Ga0075435_100114033 | 3300007076 | Bacteria | 2250 |
| 228 | Ga0075435_100433984 | 3300007076 | Bacteria | 1132 |
| 229 | Ga0099794_10013014 | 3300007265 | Bacteria | 3610 |
| 230 | Ga0099794_10048892 | 3300007265 | Bacteria | 2031 |
| 231 | Ga0099795_10579111 | 3300007788 | Bacteria | 532 |
| 232 | Ga0111539_10018495 | 3300009094 | Bacteria | 8631 |
| 233 | Ga0111539_10216404 | 3300009094 | Bacteria | 2231 |
| 234 | Ga0111539_10301746 | 3300009094 | Bacteria | 1864 |
| 235 | Ga0111539_10940847 | 3300009094 | Bacteria | 1005 |
| 236 | Ga0111539_12317347 | 3300009094 | Bacteria | 623 |
| 237 | Ga0105245_10200020 | 3300009098 | Bacteria | 1918 |
| 238 | Ga0114129_10000115 | 3300009147 | Bacteria | 80576 |
| 239 | Ga0114129_10000606 | 3300009147 | Bacteria | 44322 |
| 240 | Ga0114129_10001631 | 3300009147 | Bacteria | 30466 |
| 241 | Ga0114129_10044948 | 3300009147 | Bacteria | 6211 |
| 242 | Ga0114129_10052378 | 3300009147 | Bacteria | 5727 |
| 243 | Ga0114129_10099562 | 3300009147 | Bacteria | 4023 |
| 244 | Ga0114129_10181958 | 3300009147 | Bacteria | 2859 |
| 245 | Ga0114129_10296398 | 3300009147 | Bacteria | 2157 |
| 246 | Ga0114129_10380919 | 3300009147 | Bacteria | 1863 |
| 247 | Ga0114129_10473394 | 3300009147 | Bacteria | 1640 |
| 248 | Ga0114129_10543133 | 3300009147 | Bacteria | 1512 |
| 249 | Ga0114129_10638587 | 3300009147 | Bacteria | 1375 |
| 250 | Ga0114129_10833734 | 3300009147 | Bacteria | 1174 |
| 251 | Ga0114129_11939752 | 3300009147 | Bacteria | 713 |
| 252 | Ga0105243_10007747 | 3300009148 | Bacteria | 8258 |
| 253 | Ga0105243_10183874 | 3300009148 | Bacteria | 1820 |
| 254 | Ga0105241_10171445 | 3300009174 | Bacteria | 1793 |
| 255 | Ga0105241_10181111 | 3300009174 | Bacteria | 1748 |
| 256 | Ga0105242_10144974 | 3300009176 | Bacteria | 2065 |
| 257 | Ga0105237_10081739 | 3300009545 | Bacteria | 3222 |
| 258 | Ga0105238_10640592 | 3300009551 | Bacteria | 1072 |
| 259 | Ga0105249_10031638 | 3300009553 | Bacteria | 4786 |
| 260 | Ga0105249_10328103 | 3300009553 | Bacteria | 1543 |
| 261 | Ga0105249_10698852 | 3300009553 | Bacteria | 1074 |
| 262 | Ga0105249_10759559 | 3300009553 | Bacteria | 1032 |
| 263 | Ga0105249_10868964 | 3300009553 | Bacteria | 968 |
| 264 | Ga0105249_13085990 | 3300009553 | Bacteria | 535 |
| 265 | Ga0105239_11349287 | 3300010375 | Bacteria | 823 |
| 266 | Ga0105246_10289229 | 3300011119 | Bacteria | 1318 |
| 267 | Ga0157373_10000388 | 3300013100 | Bacteria | 35150 |
| 268 | Ga0157371_10123835 | 3300013102 | Bacteria | 1839 |
| 269 | Ga0157371_10807538 | 3300013102 | Bacteria | 707 |
| 270 | Ga0157369_10109413 | 3300013105 | Bacteria | 2938 |
| 271 | Ga0157378_10537610 | 3300013297 | Bacteria | 1172 |
| 272 | Ga0157372_10000105 | 3300013307 | Bacteria | 88007 |
| 273 | Ga0157372_10402152 | 3300013307 | Bacteria | 1596 |
| 274 | Ga0157375_10295519 | 3300013308 | Bacteria | 1783 |
| 275 | Ga0157380_10205551 | 3300014326 | Bacteria | 1751 |
| 276 | Ga0182008_10038771 | 3300014497 | Bacteria | 2382 |
| 277 | Ga0157377_10344437 | 3300014745 | Bacteria | 998 |
| 278 | Ga0157379_10126211 | 3300014968 | Bacteria | 2302 |
| 279 | Ga0182007_10202743 | 3300015262 | Bacteria | 694 |
| 280 | Ga0182007_10218446 | 3300015262 | Bacteria | 673 |
| 281 | Ga0206356_10921615 | 3300020070 | Bacteria | 851 |
| 282 | Ga0206353_11152683 | 3300020082 | Bacteria | 1108 |
| 283 | Ga0207653_10062032 | 3300025885 | Bacteria | 1263 |
| 284 | Ga0207682_10106879 | 3300025893 | Bacteria | 1228 |
| 285 | Ga0207682_10160133 | 3300025893 | Bacteria | 1019 |
| 286 | Ga0207688_10038779 | 3300025901 | Bacteria | 2645 |
| 287 | Ga0207680_10242575 | 3300025903 | Bacteria | 1242 |
| 288 | Ga0207647_10130297 | 3300025904 | Bacteria | 1478 |
| 289 | Ga0207685_10240848 | 3300025905 | Bacteria | 870 |
| 290 | Ga0207699_10373815 | 3300025906 | Bacteria | 1010 |
| 291 | Ga0207645_10005499 | 3300025907 | Bacteria | 9176 |
| 292 | Ga0207643_10000329 | 3300025908 | Bacteria | 32532 |
| 293 | Ga0207643_10058926 | 3300025908 | Bacteria | 2190 |
| 294 | Ga0207643_10072224 | 3300025908 | Bacteria | 1987 |
| 295 | Ga0207684_10000115 | 3300025910 | Bacteria | 149762 |
| 296 | Ga0207684_10004217 | 3300025910 | Bacteria | 13644 |
| 297 | Ga0207684_10012100 | 3300025910 | Bacteria | 7513 |
| 298 | Ga0207684_10016655 | 3300025910 | Bacteria | 6312 |
| 299 | Ga0207684_10041537 | 3300025910 | Bacteria | 3899 |
| 300 | Ga0207684_10055055 | 3300025910 | Bacteria | 3375 |
| 301 | Ga0207684_10075787 | 3300025910 | Bacteria | 2859 |
| 302 | Ga0207684_10087362 | 3300025910 | Bacteria | 2657 |
| 303 | Ga0207684_10114071 | 3300025910 | Bacteria | 2314 |
| 304 | Ga0207684_10155793 | 3300025910 | Bacteria | 1966 |
| 305 | Ga0207684_10314967 | 3300025910 | Bacteria | 1349 |
| 306 | Ga0207684_10320745 | 3300025910 | Bacteria | 1335 |
| 307 | Ga0207684_11492938 | 3300025910 | Bacteria | 550 |
| 308 | Ga0207654_10004154 | 3300025911 | Bacteria | 7301 |
| 309 | Ga0207654_10175934 | 3300025911 | Bacteria | 1393 |
| 310 | Ga0207707_10000352 | 3300025912 | Bacteria | 48248 |
| 311 | Ga0207671_10100012 | 3300025914 | Bacteria | 2195 |
| 312 | Ga0207660_10000334 | 3300025917 | Bacteria | 30356 |
| 313 | Ga0207660_10090303 | 3300025917 | Bacteria | 2269 |
| 314 | Ga0207660_10350194 | 3300025917 | Bacteria | 1184 |
| 315 | Ga0207662_10017645 | 3300025918 | Bacteria | 4039 |
| 316 | Ga0207657_10002264 | 3300025919 | Bacteria | 20869 |
| 317 | Ga0207649_10013687 | 3300025920 | Bacteria | 4533 |
| 318 | Ga0207652_10000466 | 3300025921 | Bacteria | 41482 |
| 319 | Ga0207646_10000250 | 3300025922 | Bacteria | 73162 |
| 320 | Ga0207646_10008025 | 3300025922 | Bacteria | 10643 |
| 321 | Ga0207646_10017586 | 3300025922 | Bacteria | 6683 |
| 322 | Ga0207646_10030213 | 3300025922 | Bacteria | 4915 |
| 323 | Ga0207646_10035173 | 3300025922 | Bacteria | 4525 |
| 324 | Ga0207646_10162660 | 3300025922 | Bacteria | 2014 |
| 325 | Ga0207646_10168402 | 3300025922 | Bacteria | 1978 |
| 326 | Ga0207646_10201847 | 3300025922 | Bacteria | 1796 |
| 327 | Ga0207646_10246117 | 3300025922 | Bacteria | 1615 |
| 328 | Ga0207646_10532405 | 3300025922 | Bacteria | 1057 |
| 329 | Ga0207646_10981408 | 3300025922 | Bacteria | 747 |
| 330 | Ga0207646_11206851 | 3300025922 | Unclassified | 663 |
| 331 | Ga0207681_10082617 | 3300025923 | Bacteria | 2271 |
| 332 | Ga0207681_10240368 | 3300025923 | Bacteria | 1409 |
| 333 | Ga0207681_11334407 | 3300025923 | Bacteria | 602 |
| 334 | Ga0207681_11406862 | 3300025923 | Bacteria | 585 |
| 335 | Ga0207694_10355091 | 3300025924 | Bacteria | 1214 |
| 336 | Ga0207650_10268037 | 3300025925 | Bacteria | 1387 |
| 337 | Ga0207690_10003653 | 3300025932 | Bacteria | 9163 |
| 338 | Ga0207706_10008780 | 3300025933 | Bacteria | 9302 |
| 339 | Ga0207706_10038603 | 3300025933 | Bacteria | 4236 |
| 340 | Ga0207686_10099272 | 3300025934 | Bacteria | 1940 |
| 341 | Ga0207709_10003271 | 3300025935 | Bacteria | 9720 |
| 342 | Ga0207709_10366549 | 3300025935 | Bacteria | 1092 |
| 343 | Ga0207709_11077258 | 3300025935 | Bacteria | 659 |
| 344 | Ga0207670_10003001 | 3300025936 | Bacteria | 8909 |
| 345 | Ga0207704_10588999 | 3300025938 | Bacteria | 909 |
| 346 | Ga0207665_10010689 | 3300025939 | Bacteria | 6028 |
| 347 | Ga0207691_10044338 | 3300025940 | Bacteria | 4095 |
| 348 | Ga0207689_10003685 | 3300025942 | Bacteria | 13959 |
| 349 | Ga0207689_10011582 | 3300025942 | Bacteria | 7556 |
| 350 | Ga0207689_10054717 | 3300025942 | Bacteria | 3285 |
| 351 | Ga0207661_10269170 | 3300025944 | Bacteria | 1520 |
| 352 | Ga0207679_10000878 | 3300025945 | Bacteria | 19200 |
| 353 | Ga0207679_10358722 | 3300025945 | Bacteria | 1272 |
| 354 | Ga0207667_10000497 | 3300025949 | Bacteria | 51927 |
| 355 | Ga0207651_11198234 | 3300025960 | Bacteria | 682 |
| 356 | Ga0207712_10044142 | 3300025961 | Bacteria | 3079 |
| 357 | Ga0207712_10353842 | 3300025961 | Bacteria | 1222 |
| 358 | Ga0207712_10561970 | 3300025961 | Bacteria | 983 |
| 359 | Ga0207712_10671043 | 3300025961 | Bacteria | 902 |
| 360 | Ga0207668_10410578 | 3300025972 | Bacteria | 1147 |
| 361 | Ga0207640_10009082 | 3300025981 | Bacteria | 5550 |
| 362 | Ga0207658_10506765 | 3300025986 | Bacteria | 1076 |
| 363 | Ga0207658_11569601 | 3300025986 | Bacteria | 602 |
| 364 | Ga0207703_10085583 | 3300026035 | Unclassified | 2638 |
| 365 | Ga0207639_10002384 | 3300026041 | Bacteria | 12612 |
| 366 | Ga0207678_10054455 | 3300026067 | Bacteria | 3445 |
| 367 | Ga0207708_10217137 | 3300026075 | Bacteria | 1531 |
| 368 | Ga0207708_10707004 | 3300026075 | Bacteria | 862 |
| 369 | Ga0207708_10790475 | 3300026075 | Bacteria | 816 |
| 370 | Ga0207702_10008955 | 3300026078 | Bacteria | 8434 |
| 371 | Ga0207648_10005839 | 3300026089 | Bacteria | 12327 |
| 372 | Ga0207648_10115995 | 3300026089 | Bacteria | 2354 |
| 373 | Ga0207648_11166398 | 3300026089 | Bacteria | 723 |
| 374 | Ga0207676_10014367 | 3300026095 | Bacteria | 5695 |
| 375 | Ga0207676_10960199 | 3300026095 | Bacteria | 841 |
| 376 | Ga0207674_10000550 | 3300026116 | Bacteria | 49205 |
| 377 | Ga0207674_10161954 | 3300026116 | Bacteria | 2191 |
| 378 | Ga0207674_10629755 | 3300026116 | Bacteria | 1036 |
| 379 | Ga0207675_100005709 | 3300026118 | Bacteria | 11909 |
| 380 | Ga0207675_100267941 | 3300026118 | Bacteria | 1657 |
| 381 | Ga0207675_100356310 | 3300026118 | Bacteria | 1434 |
| 382 | Ga0209969_1010320 | 3300027360 | Bacteria | 1336 |
| 383 | Ga0209967_1015709 | 3300027364 | Bacteria | 1084 |
| 384 | Ga0209981_1012710 | 3300027378 | Bacteria | 1167 |
| 385 | Ga0209996_1000987 | 3300027395 | Bacteria | 3383 |
| 386 | Ga0210000_1001288 | 3300027462 | Bacteria | 3530 |
| 387 | Ga0209995_1001479 | 3300027471 | Bacteria | 3625 |
| 388 | Ga0209968_1005623 | 3300027526 | Bacteria | 1884 |
| 389 | Ga0209968_1058298 | 3300027526 | Bacteria | 678 |
| 390 | Ga0209999_1000243 | 3300027543 | Bacteria | 7873 |
| 391 | Ga0209982_1000487 | 3300027552 | Bacteria | 4921 |
| 392 | Ga0209970_1017224 | 3300027614 | Bacteria | 1209 |
| 393 | Ga0210002_1033995 | 3300027617 | Bacteria | 854 |
| 394 | Ga0209983_1000034 | 3300027665 | Bacteria | 19527 |
| 395 | Ga0209588_1041569 | 3300027671 | Bacteria | 1484 |
| 396 | Ga0209588_1111984 | 3300027671 | Bacteria | 876 |
| 397 | Ga0209588_1156985 | 3300027671 | Bacteria | 719 |
| 398 | Ga0209971_1000028 | 3300027682 | Bacteria | 53458 |
| 399 | Ga0209971_1020061 | 3300027682 | Bacteria | 1588 |
| 400 | Ga0209966_1000073 | 3300027695 | Bacteria | 44067 |
| 401 | Ga0209998_10000001 | 3300027717 | Bacteria | 203589 |
| 402 | Ga0209998_10017838 | 3300027717 | Bacteria | 1503 |
| 403 | Ga0209998_10085113 | 3300027717 | Bacteria | 770 |
| 404 | Ga0209974_10000369 | 3300027876 | Bacteria | 14852 |
| 405 | Ga0207428_10355343 | 3300027907 | Bacteria | 1077 |
| 406 | Ga0268265_10002923 | 3300028380 | Bacteria | 12524 |
| 407 | Ga0268265_10136227 | 3300028380 | Bacteria | 2049 |
| 408 | Ga0268265_10196008 | 3300028380 | Bacteria | 1748 |
| 409 | Ga0268265_11144355 | 3300028380 | Bacteria | 774 |
| 410 | Ga0268264_10182259 | 3300028381 | Bacteria | 1908 |
| 411 | Ga0268264_10342083 | 3300028381 | Bacteria | 1421 |
| 412 | Ga0268264_10758437 | 3300028381 | Bacteria | 967 |
| 413 | Ga0307408_100049624 | 3300031548 | Bacteria | 3015 |
| 414 | Ga0307408_100058377 | 3300031548 | Bacteria | 2805 |
| 415 | Ga0307408_100105981 | 3300031548 | Bacteria | 2150 |
| 416 | Ga0307408_100409067 | 3300031548 | Bacteria | 1167 |
| 417 | Ga0307408_100685699 | 3300031548 | Bacteria | 919 |
| 418 | Ga0307408_101107260 | 3300031548 | Bacteria | 735 |
| 419 | Ga0316575_10093872 | 3300031665 | Bacteria | 1217 |
| 420 | Ga0316579_10171936 | 3300031691 | Bacteria | 1047 |
| 421 | Ga0316578_10007755 | 3300031728 | Bacteria | 5412 |
| 422 | Ga0307405_10778720 | 3300031731 | Bacteria | 799 |
| 423 | Ga0316577_10039459 | 3300031733 | Bacteria | 2641 |
| 424 | Ga0307413_11716277 | 3300031824 | Bacteria | 560 |
| 425 | Ga0307406_10423026 | 3300031901 | Bacteria | 1062 |
| 426 | Ga0307406_10522711 | 3300031901 | Bacteria | 966 |
| 427 | Ga0307407_10924550 | 3300031903 | Bacteria | 670 |
| 428 | Ga0307412_10067622 | 3300031911 | Bacteria | 2427 |
| 429 | Ga0307409_100055052 | 3300031995 | Bacteria | 3069 |
| 430 | Ga0307409_100249842 | 3300031995 | Bacteria | 1621 |
| 431 | Ga0307409_101084352 | 3300031995 | Bacteria | 822 |
| 432 | Ga0307409_101402134 | 3300031995 | Bacteria | 725 |
| 433 | Ga0307416_100116219 | 3300032002 | Bacteria | 2371 |
| 434 | Ga0307416_100117613 | 3300032002 | Bacteria | 2360 |
| 435 | Ga0307416_100364315 | 3300032002 | Bacteria | 1469 |
| 436 | Ga0307416_100977422 | 3300032002 | Bacteria | 949 |
| 437 | Ga0307411_10501390 | 3300032005 | Bacteria | 1026 |
| 438 | Ga0373930_0025476 | 3300034816 | Bacteria | 1187 |
| 439 | Ga0373929_0019492 | 3300035085 | Bacteria | 1359 |
| 440 | Ga0373952_0012443 | 3300035092 | Bacteria | 1674 |
| 441 | Ga0373939_0008845 | 3300035114 | Bacteria | 2480 |
| 442 | Ga0373939_0121915 | 3300035114 | Bacteria | 921 |
| 443 | Ga0373941_0137792 | 3300035115 | Bacteria | 885 |
| 444 | Ga0373960_0017235 | 3300035121 | Bacteria | 1869 |
| 445 | Ga0373946_0761397 | 3300035171 | Bacteria | 509 |
| 446 | Ga0373942_0126126 | 3300035207 | Bacteria | 804 |
| 447 | Ga0373961_0136875 | 3300035241 | Bacteria | 824 |
| 448 | Ga0373931_0168586 | 3300035691 | Bacteria | 1288 |
| 449 | Ga0373935_0136475 | 3300035692 | Bacteria | 1653 |
| 450 | Ga0395899_0098186 | 3300037312 | Bacteria | 2116 |
| 451 | Ga0395900_0158493 | 3300037418 | Bacteria | 2310 |
| 452 | Ga0395900_0262037 | 3300037418 | Bacteria | 1726 |
| 453 | Ga0395898_0068101 | 3300037466 | Bacteria | 3445 |
| 454 | Ga0395898_0754785 | 3300037466 | Bacteria | 914 |
| 455 | Ga0395905_0032845 | 3300037471 | Bacteria | 4879 |
| 456 | Ga0395901_0003553 | 3300038443 | Bacteria | 15718 |
| 457 | Ga0395901_0316283 | 3300038443 | Bacteria | 1616 |
| 458 | Ga0400486_00771 | 3300038742 | Bacteria | 4504 |
| 459 | Ga0451793_0606111 | 3300041452 | Unclassified | 711 |
| 460 | Ga0451837_0530276 | 3300041494 | Bacteria | 1279 |
| 461 | Ga0439441_014767 | 3300042001 | Bacteria | 1374 |
| 462 | Ga0439448_0001340 | 3300042005 | Bacteria | 6305 |
| 463 | Ga0439448_0050970 | 3300042005 | Bacteria | 1355 |
| 464 | Ga0439450_014251 | 3300042008 | Bacteria | 1610 |
| 465 | Ga0439455_0010262 | 3300042012 | Bacteria | 2056 |
| 466 | Ga0439456_006513 | 3300042013 | Bacteria | 2386 |
| 467 | Ga0450889_016641 | 3300042144 | Bacteria | 795 |
| 468 | Ga0439459_0000265 | 3300042438 | Bacteria | 6158 |
| 469 | Ga0439464_0001792 | 3300042439 | Bacteria | 5179 |
| 470 | Ga0439460_0000935 | 3300042461 | Bacteria | 6679 |
| 471 | Ga0451577_0005206 | 3300042876 | Bacteria | 13385 |
| 472 | Ga0451577_0010038 | 3300042876 | Bacteria | 9071 |
| 473 | Ga0451577_0196697 | 3300042876 | Bacteria | 1820 |
| 474 | Ga0453683_0003008 | 3300044673 | Bacteria | 12624 |
| 475 | Ga0453683_0013004 | 3300044673 | Bacteria | 5442 |
| 476 | Ga0453684_0019511 | 3300044712 | Bacteria | 10315 |
| 477 | Ga0453684_0202154 | 3300044712 | Bacteria | 2315 |
| 478 | Ga0453684_1231168 | 3300044712 | Bacteria | 784 |
| 479 | Ga0453684_1268941 | 3300044712 | Bacteria | 770 |
| 480 | Ga0451576_0025605 | 3300045051 | Bacteria | 6354 |
| 481 | Ga0451576_0071114 | 3300045051 | Bacteria | 3621 |
| 482 | Ga0451576_0232246 | 3300045051 | Bacteria | 1926 |
| 483 | Ga0451576_0258336 | 3300045051 | Bacteria | 1820 |
| 484 | Ga0451576_0458466 | 3300045051 | Bacteria | 1338 |
| 485 | Ga0451576_1028191 | 3300045051 | Bacteria | 863 |
| 486 | Ga0451576_1112381 | 3300045051 | Bacteria | 826 |
| 487 | Ga0451576_2035105 | 3300045051 | Bacteria | 591 |
| 488 | Ga0495603_0552149 | 3300046455 | Bacteria | 660 |
| 489 | Ga0495629_0000050 | 3300046459 | Bacteria | 107147 |
| 490 | Ga0495580_0005633 | 3300046472 | Bacteria | 10302 |
| 491 | Ga0495580_0057095 | 3300046472 | Bacteria | 2748 |
| 492 | Ga0495582_0007310 | 3300046473 | Bacteria | 6120 |
| 493 | Ga0495584_0301533 | 3300046491 | Bacteria | 814 |
| 494 | Ga0495594_0005225 | 3300046499 | Bacteria | 6674 |
| 495 | Ga0495618_0358146 | 3300046514 | Bacteria | 898 |
| 496 | Ga0495642_0123655 | 3300046528 | Bacteria | 1111 |
| 497 | Ga0495640_0021775 | 3300046533 | Bacteria | 4696 |
| 498 | Ga0495586_0129461 | 3300046535 | Bacteria | 1413 |
| 499 | Ga0495635_0000198 | 3300046663 | Bacteria | 37966 |
| 500 | Ga0495659_0092071 | 3300046664 | Bacteria | 1165 |
| 501 | Ga0495659_0104214 | 3300046664 | Bacteria | 1102 |
| 502 | Ga0495658_0000191 | 3300046683 | Bacteria | 35464 |
| 503 | Ga0495669_0086886 | 3300046684 | Bacteria | 1440 |
| 504 | Ga0495669_0319428 | 3300046684 | Bacteria | 749 |
| 505 | Ga0495613_0044191 | 3300046689 | Bacteria | 3296 |
| 506 | Ga0495624_0688519 | 3300046690 | Bacteria | 607 |
| 507 | Ga0495581_0000279 | 3300047315 | Bacteria | 24784 |
| 508 | Ga0495636_0244510 | 3300047318 | Bacteria | 828 |
| 509 | Ga0495676_0141288 | 3300047321 | Bacteria | 1725 |
| 510 | Ga0495680_0000465 | 3300047322 | Bacteria | 45569 |
| 511 | Ga0495593_0080010 | 3300047673 | Bacteria | 1691 |
| 512 | Ga0495614_0003921 | 3300048089 | Bacteria | 6683 |
| 513 | Ga0496102_0038621 | 3300048905 | Bacteria | 4310 |
| 514 | Ga0496102_0400327 | 3300048905 | Bacteria | 1291 |
| 515 | Ga0496104_0398697 | 3300048907 | Bacteria | 1288 |
| 516 | Ga0496106_0070068 | 3300048909 | Bacteria | 2678 |
| 517 | Ga0496107_0422369 | 3300048910 | Bacteria | 991 |
| 518 | Ga0496109_0713502 | 3300048912 | Bacteria | 940 |
| 519 | Ga0496112_0139340 | 3300048915 | Bacteria | 2395 |
| 520 | Ga0501292_029677 | 3300049515 | Bacteria | 915 |
| 521 | Ga0501298_050962 | 3300049521 | Bacteria | 859 |
| 522 | Ga0501033_0038328 | 3300049570 | Bacteria | 3585 |
| 523 | Ga0501033_0294784 | 3300049570 | Bacteria | 1143 |
| 524 | Ga0501033_0346609 | 3300049570 | Bacteria | 1041 |
| 525 | Ga0501033_0360772 | 3300049570 | Bacteria | 1017 |
| 526 | Ga0501033_0399332 | 3300049570 | Bacteria | 959 |
| 527 | Ga0501036_0008473 | 3300049572 | Bacteria | 8427 |
| 528 | Ga0501036_0029734 | 3300049572 | Bacteria | 4616 |
| 529 | Ga0501036_0137721 | 3300049572 | Bacteria | 2060 |
| 530 | Ga0501036_0143053 | 3300049572 | Bacteria | 2018 |
| 531 | Ga0501036_0289350 | 3300049572 | Bacteria | 1371 |
| 532 | Ga0501036_0503945 | 3300049572 | Bacteria | 1007 |
| 533 | Ga0501036_1683040 | 3300049572 | Bacteria | 511 |
| 534 | Ga0501037_0122149 | 3300049573 | Bacteria | 1872 |
| 535 | Ga0501037_0360271 | 3300049573 | Bacteria | 1002 |
| 536 | Ga0501037_0693477 | 3300049573 | Bacteria | 678 |
| 537 | Ga0501038_0008826 | 3300049574 | Bacteria | 9247 |
| 538 | Ga0501038_0098642 | 3300049574 | Bacteria | 2436 |
| 539 | Ga0501038_0142802 | 3300049574 | Bacteria | 1957 |
| 540 | Ga0501038_0790779 | 3300049574 | Bacteria | 705 |
| 541 | Ga0501039_0006761 | 3300049575 | Bacteria | 8728 |
| 542 | Ga0501039_0028057 | 3300049575 | Bacteria | 4330 |
| 543 | Ga0501039_0226156 | 3300049575 | Bacteria | 1471 |
| 544 | Ga0501039_0438744 | 3300049575 | Bacteria | 1025 |
| 545 | Ga0501039_0496101 | 3300049575 | Bacteria | 959 |
| 546 | Ga0501039_0859626 | 3300049575 | Bacteria | 707 |
| 547 | Ga0501039_0930980 | 3300049575 | Unclassified | 676 |
| 548 | Ga0501040_0006783 | 3300049576 | Bacteria | 7424 |
| 549 | Ga0501040_0024123 | 3300049576 | Bacteria | 4081 |
| 550 | Ga0501040_0042354 | 3300049576 | Bacteria | 3101 |
| 551 | Ga0501040_0046392 | 3300049576 | Bacteria | 2966 |
| 552 | Ga0501040_0131181 | 3300049576 | Bacteria | 1762 |
| 553 | Ga0501040_0731066 | 3300049576 | Bacteria | 716 |
| 554 | Ga0501041_0014008 | 3300049577 | Bacteria | 4758 |
| 555 | Ga0501041_0015706 | 3300049577 | Bacteria | 4497 |
| 556 | Ga0501041_0024893 | 3300049577 | Bacteria | 3595 |
| 557 | Ga0501041_0119263 | 3300049577 | Bacteria | 1639 |
| 558 | Ga0501041_0122637 | 3300049577 | Bacteria | 1616 |
| 559 | Ga0501041_0181516 | 3300049577 | Bacteria | 1317 |
| 560 | Ga0501041_0198808 | 3300049577 | Bacteria | 1256 |
| 561 | Ga0501041_0833353 | 3300049577 | Unclassified | 592 |
| 562 | Ga0501042_0007483 | 3300049578 | Bacteria | 7156 |
| 563 | Ga0501042_0055319 | 3300049578 | Bacteria | 2831 |
| 564 | Ga0501042_0102109 | 3300049578 | Bacteria | 2063 |
| 565 | Ga0501042_0175713 | 3300049578 | Bacteria | 1545 |
| 566 | Ga0501042_0542254 | 3300049578 | Bacteria | 845 |
| 567 | Ga0501042_1138061 | 3300049578 | Bacteria | 569 |
| 568 | Ga0501043_0103412 | 3300049579 | Bacteria | 2238 |
| 569 | Ga0501043_0553562 | 3300049579 | Bacteria | 854 |
| 570 | Ga0501043_1268852 | 3300049579 | Bacteria | 515 |
| 571 | Ga0501046_0006426 | 3300049580 | Bacteria | 10418 |
| 572 | Ga0501046_0018987 | 3300049580 | Bacteria | 5707 |
| 573 | Ga0501046_0078313 | 3300049580 | Bacteria | 2557 |
| 574 | Ga0501046_0100534 | 3300049580 | Bacteria | 2219 |
| 575 | Ga0501046_0213903 | 3300049580 | Bacteria | 1430 |
| 576 | Ga0501048_0021736 | 3300049582 | Bacteria | 4695 |
| 577 | Ga0501048_0078325 | 3300049582 | Bacteria | 2332 |
| 578 | Ga0501048_0130757 | 3300049582 | Bacteria | 1775 |
| 579 | Ga0501048_0133623 | 3300049582 | Bacteria | 1753 |
| 580 | Ga0501048_0292418 | 3300049582 | Bacteria | 1159 |
| 581 | Ga0501048_0674724 | 3300049582 | Bacteria | 742 |
| 582 | Ga0501048_1080280 | 3300049582 | Bacteria | 577 |
| 583 | Ga0501067_0154006 | 3300049583 | Bacteria | 1281 |
| 584 | Ga0501067_0541524 | 3300049583 | Bacteria | 652 |
| 585 | Ga0501068_0033097 | 3300049584 | Bacteria | 3077 |
| 586 | Ga0501068_0071879 | 3300049584 | Bacteria | 2112 |
| 587 | Ga0501068_0082028 | 3300049584 | Bacteria | 1980 |
| 588 | Ga0501069_0290997 | 3300049585 | Bacteria | 957 |
| 589 | Ga0501071_0107335 | 3300049587 | Bacteria | 2062 |
| 590 | Ga0501071_0124133 | 3300049587 | Bacteria | 1915 |
| 591 | Ga0501072_0018561 | 3300049588 | Bacteria | 5360 |
| 592 | Ga0501072_0028643 | 3300049588 | Bacteria | 4348 |
| 593 | Ga0501072_0045219 | 3300049588 | Bacteria | 3461 |
| 594 | Ga0501072_0101298 | 3300049588 | Bacteria | 2289 |
| 595 | Ga0501072_0128520 | 3300049588 | Bacteria | 2019 |
| 596 | Ga0501072_0359228 | 3300049588 | Bacteria | 1156 |
| 597 | Ga0501072_0360289 | 3300049588 | Bacteria | 1154 |
| 598 | Ga0501072_0437841 | 3300049588 | Bacteria | 1036 |
| 599 | Ga0501072_0484509 | 3300049588 | Bacteria | 978 |
| 600 | Ga0501072_0503136 | 3300049588 | Bacteria | 958 |
| 601 | Ga0501072_1598324 | 3300049588 | Bacteria | 502 |
| 602 | Ga0501073_0555769 | 3300049589 | Bacteria | 793 |
| 603 | Ga0501074_0010060 | 3300049590 | Bacteria | 6866 |
| 604 | Ga0501074_0089779 | 3300049590 | Bacteria | 2201 |
| 605 | Ga0501074_0684644 | 3300049590 | Bacteria | 724 |
| 606 | Ga0501075_0000122 | 3300049591 | Bacteria | 37780 |
| 607 | Ga0501075_0036490 | 3300049591 | Bacteria | 3669 |
| 608 | Ga0501075_0049544 | 3300049591 | Bacteria | 3157 |
| 609 | Ga0501075_0056627 | 3300049591 | Bacteria | 2951 |
| 610 | Ga0501075_0060695 | 3300049591 | Bacteria | 2849 |
| 611 | Ga0501075_0106630 | 3300049591 | Bacteria | 2129 |
| 612 | Ga0501075_0122974 | 3300049591 | Bacteria | 1975 |
| 613 | Ga0501075_0201147 | 3300049591 | Bacteria | 1519 |
| 614 | Ga0501075_0349403 | 3300049591 | Bacteria | 1127 |
| 615 | Ga0501075_0479799 | 3300049591 | Bacteria | 948 |
| 616 | Ga0501075_0593594 | 3300049591 | Bacteria | 845 |
| 617 | Ga0501076_0000012 | 3300049592 | Bacteria | 113396 |
| 618 | Ga0501076_0002878 | 3300049592 | Bacteria | 11918 |
| 619 | Ga0501076_0077598 | 3300049592 | Bacteria | 2665 |
| 620 | Ga0501076_0136162 | 3300049592 | Bacteria | 1994 |
| 621 | Ga0501076_0148285 | 3300049592 | Bacteria | 1908 |
| 622 | Ga0501076_0173942 | 3300049592 | Bacteria | 1755 |
| 623 | Ga0501076_0283450 | 3300049592 | Bacteria | 1357 |
| 624 | Ga0501076_0558068 | 3300049592 | Bacteria | 944 |
| 625 | Ga0501076_0611806 | 3300049592 | Bacteria | 899 |
| 626 | Ga0501076_1277826 | 3300049592 | Bacteria | 604 |
| 627 | Ga0501077_0007666 | 3300049593 | Bacteria | 6660 |
| 628 | Ga0501077_0033134 | 3300049593 | Bacteria | 3289 |
| 629 | Ga0501077_0045888 | 3300049593 | Bacteria | 2776 |
| 630 | Ga0501077_0067838 | 3300049593 | Bacteria | 2261 |
| 631 | Ga0501077_0086210 | 3300049593 | Bacteria | 1991 |
| 632 | Ga0501077_0095346 | 3300049593 | Bacteria | 1886 |
| 633 | Ga0501077_0489828 | 3300049593 | Bacteria | 788 |
| 634 | Ga0501077_0509656 | 3300049593 | Unclassified | 771 |
| 635 | Ga0501077_0887102 | 3300049593 | Bacteria | 574 |
| 636 | Ga0501079_0001408 | 3300049741 | Bacteria | 16936 |
| 637 | Ga0501079_0008164 | 3300049741 | Bacteria | 7935 |
| 638 | Ga0501079_0028593 | 3300049741 | Bacteria | 4279 |
| 639 | Ga0501079_0061478 | 3300049741 | Bacteria | 2897 |
| 640 | Ga0501079_0073083 | 3300049741 | Bacteria | 2651 |
| 641 | Ga0501079_0076362 | 3300049741 | Bacteria | 2591 |
| 642 | Ga0501079_0086560 | 3300049741 | Bacteria | 2425 |
| 643 | Ga0501079_0102595 | 3300049741 | Bacteria | 2218 |
| 644 | Ga0501079_0159600 | 3300049741 | Bacteria | 1758 |
| 645 | Ga0501079_0172787 | 3300049741 | Bacteria | 1685 |
| 646 | Ga0501079_0737754 | 3300049741 | Bacteria | 775 |
| 647 | Ga0501080_0033964 | 3300049742 | Bacteria | 4762 |
| 648 | Ga0501080_0060392 | 3300049742 | Bacteria | 3529 |
| 649 | Ga0501080_0073226 | 3300049742 | Bacteria | 3187 |
| 650 | Ga0501080_0209044 | 3300049742 | Bacteria | 1789 |
| 651 | Ga0501080_0224668 | 3300049742 | Bacteria | 1717 |
| 652 | Ga0501080_0300936 | 3300049742 | Bacteria | 1455 |
| 653 | Ga0501080_0399135 | 3300049742 | Bacteria | 1237 |
| 654 | Ga0501080_0576758 | 3300049742 | Bacteria | 1000 |
| 655 | Ga0501080_0690141 | 3300049742 | Bacteria | 901 |
| 656 | Ga0501081_0003182 | 3300049743 | Bacteria | 10436 |
| 657 | Ga0501081_0004031 | 3300049743 | Bacteria | 9420 |
| 658 | Ga0501081_0052950 | 3300049743 | Bacteria | 2801 |
| 659 | Ga0501081_0072865 | 3300049743 | Bacteria | 2395 |
| 660 | Ga0501081_0080845 | 3300049743 | Bacteria | 2275 |
| 661 | Ga0501081_0082082 | 3300049743 | Bacteria | 2258 |
| 662 | Ga0501081_0082694 | 3300049743 | Bacteria | 2250 |
| 663 | Ga0501081_0193785 | 3300049743 | Bacteria | 1472 |
| 664 | Ga0501081_1327806 | 3300049743 | Bacteria | 545 |
| 665 | Ga0501083_0040424 | 3300049744 | Bacteria | 3165 |
| 666 | Ga0501083_0459500 | 3300049744 | Bacteria | 829 |
| 667 | Ga0501270_065601 | 3300049767 | Bacteria | 691 |
| 668 | Ga0501035_0281278 | 3300049822 | Bacteria | 1406 |
| 669 | Ga0501035_0345517 | 3300049822 | Bacteria | 1246 |
| 670 | Ga0501035_0405915 | 3300049822 | Bacteria | 1133 |
| 671 | Ga0501035_1040239 | 3300049822 | Bacteria | 642 |
| 672 | Ga0501045_0000164 | 3300049824 | Bacteria | 36415 |
| 673 | Ga0501045_0011986 | 3300049824 | Bacteria | 6095 |
| 674 | Ga0501045_0042486 | 3300049824 | Bacteria | 3308 |
| 675 | Ga0501045_0119512 | 3300049824 | Bacteria | 1956 |
| 676 | Ga0501045_0141088 | 3300049824 | Bacteria | 1792 |
| 677 | Ga0501045_0234833 | 3300049824 | Bacteria | 1365 |
| 678 | Ga0501045_0879036 | 3300049824 | Bacteria | 659 |
| 679 | Ga0501045_0937593 | 3300049824 | Bacteria | 636 |
| 680 | nmdc:mga05p37_1022399_c1 | 3300050507 | Bacteria | 875 |
| 681 | nmdc:mga05p37_103698_c1 | 3300050507 | Bacteria | 3500 |
| 682 | nmdc:mga05p37_108840_c1 | 3300050507 | Bacteria | 3409 |
| 683 | nmdc:mga05p37_23238_c1 | 3300050507 | Bacteria | 7520 |
| 684 | nmdc:mga05p37_277605_c1 | 3300050507 | Bacteria | 2000 |
| 685 | nmdc:mga05p37_29115_c1 | 3300050507 | Bacteria | 6740 |
| 686 | nmdc:mga05p37_347650_c1 | 3300050507 | Bacteria | 1747 |
| 687 | nmdc:mga05p37_37550_c1 | 3300050507 | Bacteria | 5939 |
| 688 | nmdc:mga05p37_385517_c1 | 3300050507 | Bacteria | 1641 |
| 689 | nmdc:mga05p37_5092_c2 | 3300050507 | Bacteria | 15026 |
| 690 | nmdc:mga05p37_53887_c1 | 3300050507 | Bacteria | 4948 |
| 691 | nmdc:mga05p37_623076_c1 | 3300050507 | Bacteria | 1214 |
| 692 | nmdc:mga05p37_89_c1 | 3300050507 | Bacteria | 81482 |
| 693 | nmdc:mga09592_108401_c1 | 3300050508 | Bacteria | 2382 |
| 694 | nmdc:mga09592_15687_c1 | 3300050508 | Bacteria | 6190 |
| 695 | nmdc:mga09592_17102_c1 | 3300050508 | Bacteria | 5937 |
| 696 | nmdc:mga09592_2605_c1 | 3300050508 | Bacteria | 14598 |
| 697 | nmdc:mga09592_548362_c1 | 3300050508 | Bacteria | 993 |
| 698 | nmdc:mga09592_71083_c1 | 3300050508 | Bacteria | 2954 |
| 699 | nmdc:mga09592_837_c1 | 3300050508 | Bacteria | 23885 |
| 700 | nmdc:mga0qj67_10750_c1 | 3300050509 | Bacteria | 6843 |
| 701 | nmdc:mga0qj67_422069_c1 | 3300050509 | Bacteria | 1075 |
| 702 | nmdc:mga0qj67_798_c1 | 3300050509 | Bacteria | 21472 |
| 703 | nmdc:mga06r32_1241285_c1 | 3300050510 | Bacteria | 691 |
| 704 | nmdc:mga06r32_173146_c1 | 3300050510 | Bacteria | 2143 |
| 705 | nmdc:mga06r32_23011_c1 | 3300050510 | Bacteria | 5764 |
| 706 | nmdc:mga06r32_298402_c1 | 3300050510 | Bacteria | 1597 |
| 707 | nmdc:mga06r32_471585_c1 | 3300050510 | Bacteria | 1234 |
| 708 | nmdc:mga06r32_49155_c1 | 3300050510 | Bacteria | 4032 |
| 709 | nmdc:mga06r32_708379_c1 | 3300050510 | Bacteria | 972 |
| 710 | nmdc:mga06r32_978023_c1 | 3300050510 | Bacteria | 800 |
| 711 | nmdc:mga08y16_267845_c1 | 3300050511 | Bacteria | 1764 |
| 712 | nmdc:mga08y16_47030_c1 | 3300050511 | Bacteria | 4517 |
| 713 | nmdc:mga08y16_725081_c1 | 3300050511 | Bacteria | 992 |
| 714 | nmdc:mga0n895_126244_c1 | 3300050512 | Bacteria | 2582 |
| 715 | nmdc:mga0n895_1298947_c1 | 3300050512 | Bacteria | 699 |
| 716 | nmdc:mga0n895_203_c1 | 3300050512 | Bacteria | 21253 |
| 717 | nmdc:mga0n895_229431_c1 | 3300050512 | Bacteria | 1885 |
| 718 | nmdc:mga0n895_255128_c1 | 3300050512 | Bacteria | 1780 |
| 719 | nmdc:mga0n895_27710_c1 | 3300050512 | Bacteria | 5385 |
| 720 | nmdc:mga0n895_3372_c1 | 3300050512 | Bacteria | 12849 |
| 721 | nmdc:mga0n895_3902_c1 | 3300050512 | Bacteria | 12115 |
| 722 | nmdc:mga0n895_709770_c1 | 3300050512 | Bacteria | 1001 |
| 723 | nmdc:mga0n895_721271_c1 | 3300050512 | Bacteria | 992 |
| 724 | nmdc:mga0rr50_1089720_c1 | 3300050513 | Bacteria | 680 |
| 725 | nmdc:mga0rr50_1223684_c1 | 3300050513 | Bacteria | 638 |
| 726 | nmdc:mga0rr50_12498_c1 | 3300050513 | Bacteria | 5492 |
| 727 | nmdc:mga0rr50_1444_c1 | 3300050513 | Bacteria | 13081 |
| 728 | nmdc:mga0rr50_181799_c1 | 3300050513 | Bacteria | 1719 |
| 729 | nmdc:mga0rr50_2675_c1 | 3300050513 | Bacteria | 10093 |
| 730 | nmdc:mga0rr50_39170_c1 | 3300050513 | Bacteria | 3436 |
| 731 | nmdc:mga0rr50_484218_c1 | 3300050513 | Bacteria | 1051 |
| 732 | nmdc:mga0rr50_694_c1 | 3300050513 | Bacteria | 18015 |
| 733 | nmdc:mga0rr50_90198_c1 | 3300050513 | Bacteria | 2385 |
| 734 | nmdc:mga08x19_1359344_c1 | 3300050514 | Bacteria | 503 |
| 735 | nmdc:mga08x19_4220_c1 | 3300050514 | Bacteria | 8518 |
| 736 | nmdc:mga08x19_470_c1 | 3300050514 | Bacteria | 27216 |
| 737 | nmdc:mga08x19_526843_c1 | 3300050514 | Bacteria | 835 |
| 738 | nmdc:mga08x19_78615_c1 | 3300050514 | Bacteria | 2162 |
| 739 | nmdc:mga0a205_127735_c1 | 3300050515 | Bacteria | 2442 |
| 740 | nmdc:mga0a205_13883_c1 | 3300050515 | Bacteria | 7510 |
| 741 | nmdc:mga0a205_28094_c1 | 3300050515 | Bacteria | 5376 |
| 742 | nmdc:mga0a205_35751_c1 | 3300050515 | Bacteria | 4771 |
| 743 | nmdc:mga0a205_51316_c1 | 3300050515 | Bacteria | 3982 |
| 744 | nmdc:mga0a205_60390_c1 | 3300050515 | Bacteria | 3662 |
| 745 | nmdc:mga0a205_753791_c1 | 3300050515 | Bacteria | 822 |
| 746 | nmdc:mga0a205_9939_c1 | 3300050515 | Bacteria | 8729 |
| 747 | Ga0495619_0005167 | 3300053085 | Bacteria | 8284 |
| 748 | Ga0501084_0000300 | 3300054114 | Bacteria | 37454 |
| 749 | Ga0501084_0003591 | 3300054114 | Bacteria | 12591 |
| 750 | Ga0501084_0005651 | 3300054114 | Bacteria | 10267 |
| 751 | Ga0501084_0255730 | 3300054114 | Bacteria | 1478 |
| 752 | Ga0501084_0285265 | 3300054114 | Bacteria | 1394 |
| 753 | Ga0501082_0003847 | 3300060353 | Bacteria | 13126 |
| 754 | Ga0501082_0012227 | 3300060353 | Bacteria | 7376 |
| 755 | Ga0501082_0088114 | 3300060353 | Bacteria | 2678 |
| 756 | Ga0501082_0143390 | 3300060353 | Bacteria | 2073 |
| 757 | Ga0501082_0571210 | 3300060353 | Bacteria | 989 |
| 758 | Ga0501082_0598533 | 3300060353 | Bacteria | 965 |
| 759 | Ga0501082_0993473 | 3300060353 | Bacteria | 734 |
| 760 | Ga0501082_1651940 | 3300060353 | Bacteria | 559 |
| 761 | Ga0501082_1743550 | 3300060353 | Bacteria | 543 |
| 762 | Ga0530510_0000015 | 3300061734 | Bacteria | 104554 |
| 763 | Ga0530510_0007543 | 3300061734 | Bacteria | 7577 |
| 764 | Ga0530510_0010173 | 3300061734 | Bacteria | 6593 |
| 765 | Ga0530510_0010662 | 3300061734 | Bacteria | 6447 |
| 766 | Ga0530510_0011887 | 3300061734 | Bacteria | 6109 |
| 767 | Ga0530510_0021593 | 3300061734 | Bacteria | 4580 |
| 768 | Ga0530510_0059640 | 3300061734 | Bacteria | 2760 |
| 769 | Ga0530510_0124071 | 3300061734 | Bacteria | 1897 |
| 770 | Ga0530510_0467361 | 3300061734 | Bacteria | 955 |
| 771 | Ga0530510_0472423 | 3300061734 | Bacteria | 949 |
| 772 | Ga0530510_0672897 | 3300061734 | Bacteria | 788 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025908 | Ga0207643_10072224 | Ga0207643_100722242 | 125 |
| 2 | 3300025945 | Ga0207679_10358722 | Ga0207679_103587223 | 125 |
| 3 | 3300050512 | nmdc:mga0n895_229431_c1 | nmdc:mga0n895_229431_c1_11_388 | 125 |
| 4 | 3300006844 | Ga0075428_100037258 | Ga0075428_1000372584 | 127 |
| 5 | 3300006880 | Ga0075429_100455868 | Ga0075429_1004558682 | 127 |
| 6 | 3300050508 | nmdc:mga09592_548362_c1 | nmdc:mga09592_548362_c1_479_895 | 127 |
| 7 | 3300006847 | Ga0075431_100386286 | Ga0075431_1003862861 | 129 |
| 8 | 3300049573 | Ga0501037_0360271 | Ga0501037_0360271_404_814 | 135 |
| 9 | 3300049593 | Ga0501077_0067838 | Ga0501077_0067838_17_424 | 135 |
| 10 | 3300005328 | Ga0070676_10072020 | Ga0070676_100720203 | 138 |
| 11 | 3300005331 | Ga0070670_100397997 | Ga0070670_1003979972 | 138 |
| 12 | 3300005333 | Ga0070677_10176291 | Ga0070677_101762912 | 138 |
| 13 | 3300005364 | Ga0070673_100069126 | Ga0070673_1000691264 | 138 |
| 14 | 3300005365 | Ga0070688_100575453 | Ga0070688_1005754531 | 138 |
| 15 | 3300005544 | Ga0070686_100924816 | Ga0070686_1009248161 | 138 |
| 16 | 3300005618 | Ga0068864_100869366 | Ga0068864_1008693662 | 138 |
| 17 | 3300006058 | Ga0075432_10340225 | Ga0075432_103402252 | 138 |
| 18 | 3300006852 | Ga0075433_10836521 | Ga0075433_108365212 | 138 |
| 19 | 3300006871 | Ga0075434_100322773 | Ga0075434_1003227732 | 138 |
| 20 | 3300006871 | Ga0075434_100442550 | Ga0075434_1004425502 | 138 |
| 21 | 3300006871 | Ga0075434_100754702 | Ga0075434_1007547022 | 138 |
| 22 | 3300006881 | Ga0068865_100648292 | Ga0068865_1006482922 | 138 |
| 23 | 3300006914 | Ga0075436_100025186 | Ga0075436_1000251862 | 138 |
| 24 | 3300007076 | Ga0075435_100077920 | Ga0075435_1000779202 | 138 |
| 25 | 3300007076 | Ga0075435_100114033 | Ga0075435_1001140333 | 138 |
| 26 | 3300009094 | Ga0111539_10301746 | Ga0111539_103017462 | 138 |
| 27 | 3300009147 | Ga0114129_10296398 | Ga0114129_102963983 | 138 |
| 28 | 3300015262 | Ga0182007_10218446 | Ga0182007_102184462 | 138 |
| 29 | 3300025893 | Ga0207682_10160133 | Ga0207682_101601331 | 138 |
| 30 | 3300025972 | Ga0207668_10410578 | Ga0207668_104105781 | 138 |
| 31 | 3300026075 | Ga0207708_10707004 | Ga0207708_107070042 | 138 |
| 32 | 3300026095 | Ga0207676_10960199 | Ga0207676_109601992 | 138 |
| 33 | 3300031665 | Ga0316575_10093872 | Ga0316575_100938722 | 138 |
| 34 | 3300031691 | Ga0316579_10171936 | Ga0316579_101719362 | 138 |
| 35 | 3300031728 | Ga0316578_10007755 | Ga0316578_100077556 | 138 |
| 36 | 3300031733 | Ga0316577_10039459 | Ga0316577_100394592 | 138 |
| 37 | 3300032002 | Ga0307416_100977422 | Ga0307416_1009774221 | 138 |
| 38 | 3300035171 | Ga0373946_0761397 | Ga0373946_0761397_53_469 | 138 |
| 39 | 3300035692 | Ga0373935_0136475 | Ga0373935_0136475_234_650 | 138 |
| 40 | 3300041452 | Ga0451793_0606111 | Ga0451793_0606111_284_700 | 138 |
| 41 | 3300042876 | Ga0451577_0196697 | Ga0451577_0196697_738_1157 | 138 |
| 42 | 3300046455 | Ga0495603_0552149 | Ga0495603_0552149_111_533 | 138 |
| 43 | 3300046459 | Ga0495629_0000050 | Ga0495629_0000050_90343_90759 | 138 |
| 44 | 3300046473 | Ga0495582_0007310 | Ga0495582_0007310_3354_3770 | 138 |
| 45 | 3300046499 | Ga0495594_0005225 | Ga0495594_0005225_1636_2052 | 138 |
| 46 | 3300046514 | Ga0495618_0358146 | Ga0495618_0358146_439_855 | 138 |
| 47 | 3300046533 | Ga0495640_0021775 | Ga0495640_0021775_1423_1839 | 138 |
| 48 | 3300046535 | Ga0495586_0129461 | Ga0495586_0129461_378_794 | 138 |
| 49 | 3300046663 | Ga0495635_0000198 | Ga0495635_0000198_15764_16180 | 138 |
| 50 | 3300046683 | Ga0495658_0000191 | Ga0495658_0000191_26821_27237 | 138 |
| 51 | 3300046689 | Ga0495613_0044191 | Ga0495613_0044191_2533_2949 | 138 |
| 52 | 3300046690 | Ga0495624_0688519 | Ga0495624_0688519_40_456 | 138 |
| 53 | 3300047315 | Ga0495581_0000279 | Ga0495581_0000279_21250_21666 | 138 |
| 54 | 3300047321 | Ga0495676_0141288 | Ga0495676_0141288_812_1228 | 138 |
| 55 | 3300047322 | Ga0495680_0000465 | Ga0495680_0000465_20571_20987 | 138 |
| 56 | 3300047673 | Ga0495593_0080010 | Ga0495593_0080010_367_783 | 138 |
| 57 | 3300048089 | Ga0495614_0003921 | Ga0495614_0003921_2223_2639 | 138 |
| 58 | 3300049575 | Ga0501039_0496101 | Ga0501039_0496101_150_569 | 138 |
| 59 | 3300049583 | Ga0501067_0541524 | Ga0501067_0541524_187_603 | 138 |
| 60 | 3300049585 | Ga0501069_0290997 | Ga0501069_0290997_299_715 | 138 |
| 61 | 3300050507 | nmdc:mga05p37_385517_c1 | nmdc:mga05p37_385517_c1_1189_1608 | 138 |
| 62 | 3300050512 | nmdc:mga0n895_27710_c1 | nmdc:mga0n895_27710_c1_4948_5367 | 138 |
| 63 | 3300050512 | nmdc:mga0n895_721271_c1 | nmdc:mga0n895_721271_c1_369_788 | 138 |
| 64 | 3300050513 | nmdc:mga0rr50_1223684_c1 | nmdc:mga0rr50_1223684_c1_167_586 | 138 |
| 65 | 3300050513 | nmdc:mga0rr50_181799_c1 | nmdc:mga0rr50_181799_c1_514_933 | 138 |
| 66 | 3300050513 | nmdc:mga0rr50_484218_c1 | nmdc:mga0rr50_484218_c1_609_1028 | 138 |
| 67 | 3300050514 | nmdc:mga08x19_526843_c1 | nmdc:mga08x19_526843_c1_122_541 | 138 |
| 68 | 3300050515 | nmdc:mga0a205_127735_c1 | nmdc:mga0a205_127735_c1_248_667 | 138 |
| 69 | 3300053085 | Ga0495619_0005167 | Ga0495619_0005167_2964_3380 | 138 |
| 70 | 3300005364 | Ga0070673_100437437 | Ga0070673_1004374372 | 139 |
| 71 | 3300005445 | Ga0070708_101839302 | Ga0070708_1018393021 | 139 |
| 72 | 3300005467 | Ga0070706_100362363 | Ga0070706_1003623632 | 139 |
| 73 | 3300005842 | Ga0068858_100433959 | Ga0068858_1004339591 | 139 |
| 74 | 3300025893 | Ga0207682_10106879 | Ga0207682_101068792 | 139 |
| 75 | 3300025910 | Ga0207684_10314967 | Ga0207684_103149672 | 139 |
| 76 | 3300025923 | Ga0207681_11334407 | Ga0207681_113344071 | 139 |
| 77 | 3300025986 | Ga0207658_10506765 | Ga0207658_105067653 | 139 |
| 78 | 3300026035 | Ga0207703_10085583 | Ga0207703_100855833 | 139 |
| 79 | 3300041494 | Ga0451837_0530276 | Ga0451837_0530276_152_574 | 139 |
| 80 | 3300049743 | Ga0501081_1327806 | Ga0501081_1327806_70_495 | 139 |
| 81 | 3300060353 | Ga0501082_0571210 | Ga0501082_0571210_532_951 | 139 |
| 82 | 3300061734 | Ga0530510_0467361 | Ga0530510_0467361_224_643 | 139 |
| 83 | 3300003203 | JGI25406J46586_10003938 | JGI25406J46586_100039386 | 140 |
| 84 | 3300003347 | JGI26128J50194_1001745 | JGI26128J50194_10017451 | 140 |
| 85 | 3300003349 | JGI26129J50193_1002186 | JGI26129J50193_10021862 | 140 |
| 86 | 3300003371 | JGI26145J50221_1004190 | JGI26145J50221_10041902 | 140 |
| 87 | 3300005289 | Ga0065704_10300065 | Ga0065704_103000652 | 140 |
| 88 | 3300005295 | Ga0065707_10189561 | Ga0065707_101895612 | 140 |
| 89 | 3300005328 | Ga0070676_10403122 | Ga0070676_104031222 | 140 |
| 90 | 3300005330 | Ga0070690_100099974 | Ga0070690_1000999742 | 140 |
| 91 | 3300005330 | Ga0070690_100348285 | Ga0070690_1003482852 | 140 |
| 92 | 3300005331 | Ga0070670_100001558 | Ga0070670_1000015587 | 140 |
| 93 | 3300005333 | Ga0070677_10085365 | Ga0070677_100853651 | 140 |
| 94 | 3300005334 | Ga0068869_100000795 | Ga0068869_10000079510 | 140 |
| 95 | 3300005334 | Ga0068869_100002588 | Ga0068869_10000258812 | 140 |
| 96 | 3300005335 | Ga0070666_10222011 | Ga0070666_102220112 | 140 |
| 97 | 3300005336 | Ga0070680_100022284 | Ga0070680_1000222842 | 140 |
| 98 | 3300005336 | Ga0070680_100041507 | Ga0070680_1000415072 | 140 |
| 99 | 3300005337 | Ga0070682_100000179 | Ga0070682_10000017924 | 140 |
| 100 | 3300005339 | Ga0070660_100000476 | Ga0070660_10000047619 | 140 |
| 101 | 3300005340 | Ga0070689_100117769 | Ga0070689_1001177692 | 140 |
| 102 | 3300005341 | Ga0070691_10002169 | Ga0070691_100021696 | 140 |
| 103 | 3300005341 | Ga0070691_10004078 | Ga0070691_100040782 | 140 |
| 104 | 3300005341 | Ga0070691_10014775 | Ga0070691_100147756 | 140 |
| 105 | 3300005343 | Ga0070687_100053925 | Ga0070687_1000539252 | 140 |
| 106 | 3300005344 | Ga0070661_100003535 | Ga0070661_1000035353 | 140 |
| 107 | 3300005347 | Ga0070668_100647689 | Ga0070668_1006476892 | 140 |
| 108 | 3300005353 | Ga0070669_100754242 | Ga0070669_1007542421 | 140 |
| 109 | 3300005353 | Ga0070669_101400303 | Ga0070669_1014003031 | 140 |
| 110 | 3300005353 | Ga0070669_101702722 | Ga0070669_1017027221 | 140 |
| 111 | 3300005366 | Ga0070659_100000831 | Ga0070659_1000008315 | 140 |
| 112 | 3300005406 | Ga0070703_10001108 | Ga0070703_100011089 | 140 |
| 113 | 3300005406 | Ga0070703_10200434 | Ga0070703_102004341 | 140 |
| 114 | 3300005434 | Ga0070709_10239346 | Ga0070709_102393462 | 140 |
| 115 | 3300005435 | Ga0070714_100089998 | Ga0070714_1000899982 | 140 |
| 116 | 3300005436 | Ga0070713_101273668 | Ga0070713_1012736681 | 140 |
| 117 | 3300005438 | Ga0070701_10003890 | Ga0070701_100038903 | 140 |
| 118 | 3300005439 | Ga0070711_100043201 | Ga0070711_1000432015 | 140 |
| 119 | 3300005440 | Ga0070705_100020219 | Ga0070705_1000202193 | 140 |
| 120 | 3300005440 | Ga0070705_100087499 | Ga0070705_1000874992 | 140 |
| 121 | 3300005441 | Ga0070700_100282179 | Ga0070700_1002821792 | 140 |
| 122 | 3300005441 | Ga0070700_101773915 | Ga0070700_1017739151 | 140 |
| 123 | 3300005444 | Ga0070694_100009346 | Ga0070694_1000093464 | 140 |
| 124 | 3300005444 | Ga0070694_100020836 | Ga0070694_1000208361 | 140 |
| 125 | 3300005444 | Ga0070694_100161703 | Ga0070694_1001617032 | 140 |
| 126 | 3300005444 | Ga0070694_100488871 | Ga0070694_1004888712 | 140 |
| 127 | 3300005444 | Ga0070694_101007338 | Ga0070694_1010073381 | 140 |
| 128 | 3300005445 | Ga0070708_100004603 | Ga0070708_1000046035 | 140 |
| 129 | 3300005445 | Ga0070708_100006589 | Ga0070708_1000065897 | 140 |
| 130 | 3300005445 | Ga0070708_100034392 | Ga0070708_1000343922 | 140 |
| 131 | 3300005445 | Ga0070708_100085159 | Ga0070708_1000851592 | 140 |
| 132 | 3300005445 | Ga0070708_100125603 | Ga0070708_1001256033 | 140 |
| 133 | 3300005445 | Ga0070708_100131633 | Ga0070708_1001316332 | 140 |
| 134 | 3300005445 | Ga0070708_100260968 | Ga0070708_1002609682 | 140 |
| 135 | 3300005445 | Ga0070708_100266552 | Ga0070708_1002665523 | 140 |
| 136 | 3300005445 | Ga0070708_100453768 | Ga0070708_1004537683 | 140 |
| 137 | 3300005445 | Ga0070708_100503594 | Ga0070708_1005035942 | 140 |
| 138 | 3300005445 | Ga0070708_101674497 | Ga0070708_1016744971 | 140 |
| 139 | 3300005455 | Ga0070663_100004633 | Ga0070663_1000046339 | 140 |
| 140 | 3300005457 | Ga0070662_100007466 | Ga0070662_1000074668 | 140 |
| 141 | 3300005457 | Ga0070662_100019598 | Ga0070662_1000195984 | 140 |
| 142 | 3300005459 | Ga0068867_100000455 | Ga0068867_10000045519 | 140 |
| 143 | 3300005467 | Ga0070706_100044301 | Ga0070706_1000443012 | 140 |
| 144 | 3300005467 | Ga0070706_100055848 | Ga0070706_1000558482 | 140 |
| 145 | 3300005467 | Ga0070706_100061105 | Ga0070706_1000611054 | 140 |
| 146 | 3300005467 | Ga0070706_100098679 | Ga0070706_1000986793 | 140 |
| 147 | 3300005467 | Ga0070706_100231284 | Ga0070706_1002312842 | 140 |
| 148 | 3300005467 | Ga0070706_100300795 | Ga0070706_1003007952 | 140 |
| 149 | 3300005467 | Ga0070706_100311721 | Ga0070706_1003117212 | 140 |
| 150 | 3300005467 | Ga0070706_101299873 | Ga0070706_1012998731 | 140 |
| 151 | 3300005468 | Ga0070707_100000653 | Ga0070707_10000065314 | 140 |
| 152 | 3300005468 | Ga0070707_100002097 | Ga0070707_10000209710 | 140 |
| 153 | 3300005468 | Ga0070707_100007614 | Ga0070707_1000076147 | 140 |
| 154 | 3300005468 | Ga0070707_100090616 | Ga0070707_1000906164 | 140 |
| 155 | 3300005468 | Ga0070707_100160597 | Ga0070707_1001605973 | 140 |
| 156 | 3300005468 | Ga0070707_100174924 | Ga0070707_1001749243 | 140 |
| 157 | 3300005468 | Ga0070707_100188393 | Ga0070707_1001883932 | 140 |
| 158 | 3300005468 | Ga0070707_100195256 | Ga0070707_1001952563 | 140 |
| 159 | 3300005468 | Ga0070707_100901755 | Ga0070707_1009017552 | 140 |
| 160 | 3300005471 | Ga0070698_100000691 | Ga0070698_10000069124 | 140 |
| 161 | 3300005471 | Ga0070698_100004796 | Ga0070698_10000479618 | 140 |
| 162 | 3300005471 | Ga0070698_100014980 | Ga0070698_1000149809 | 140 |
| 163 | 3300005471 | Ga0070698_100055478 | Ga0070698_1000554784 | 140 |
| 164 | 3300005471 | Ga0070698_100059663 | Ga0070698_1000596635 | 140 |
| 165 | 3300005471 | Ga0070698_100203970 | Ga0070698_1002039702 | 140 |
| 166 | 3300005471 | Ga0070698_100447234 | Ga0070698_1004472341 | 140 |
| 167 | 3300005471 | Ga0070698_100911742 | Ga0070698_1009117421 | 140 |
| 168 | 3300005471 | Ga0070698_101083046 | Ga0070698_1010830462 | 140 |
| 169 | 3300005471 | Ga0070698_101723082 | Ga0070698_1017230821 | 140 |
| 170 | 3300005518 | Ga0070699_100013216 | Ga0070699_1000132163 | 140 |
| 171 | 3300005518 | Ga0070699_100030616 | Ga0070699_1000306163 | 140 |
| 172 | 3300005518 | Ga0070699_100036410 | Ga0070699_1000364105 | 140 |
| 173 | 3300005518 | Ga0070699_100045159 | Ga0070699_1000451592 | 140 |
| 174 | 3300005518 | Ga0070699_100049254 | Ga0070699_1000492543 | 140 |
| 175 | 3300005518 | Ga0070699_100337732 | Ga0070699_1003377322 | 140 |
| 176 | 3300005518 | Ga0070699_100357162 | Ga0070699_1003571622 | 140 |
| 177 | 3300005518 | Ga0070699_100841838 | Ga0070699_1008418382 | 140 |
| 178 | 3300005518 | Ga0070699_100947699 | Ga0070699_1009476992 | 140 |
| 179 | 3300005530 | Ga0070679_100037758 | Ga0070679_1000377585 | 140 |
| 180 | 3300005535 | Ga0070684_100042713 | Ga0070684_1000427137 | 140 |
| 181 | 3300005536 | Ga0070697_100016378 | Ga0070697_1000163781 | 140 |
| 182 | 3300005536 | Ga0070697_100023819 | Ga0070697_1000238194 | 140 |
| 183 | 3300005536 | Ga0070697_100095843 | Ga0070697_1000958433 | 140 |
| 184 | 3300005536 | Ga0070697_100158015 | Ga0070697_1001580153 | 140 |
| 185 | 3300005536 | Ga0070697_100251041 | Ga0070697_1002510412 | 140 |
| 186 | 3300005536 | Ga0070697_100361715 | Ga0070697_1003617152 | 140 |
| 187 | 3300005536 | Ga0070697_100385861 | Ga0070697_1003858612 | 140 |
| 188 | 3300005536 | Ga0070697_100568403 | Ga0070697_1005684032 | 140 |
| 189 | 3300005536 | Ga0070697_101304356 | Ga0070697_1013043561 | 140 |
| 190 | 3300005536 | Ga0070697_101796079 | Ga0070697_1017960791 | 140 |
| 191 | 3300005539 | Ga0068853_100003324 | Ga0068853_1000033245 | 140 |
| 192 | 3300005543 | Ga0070672_100051439 | Ga0070672_1000514395 | 140 |
| 193 | 3300005545 | Ga0070695_100001891 | Ga0070695_10000189112 | 140 |
| 194 | 3300005545 | Ga0070695_100137249 | Ga0070695_1001372492 | 140 |
| 195 | 3300005545 | Ga0070695_100277788 | Ga0070695_1002777882 | 140 |
| 196 | 3300005545 | Ga0070695_100608306 | Ga0070695_1006083062 | 140 |
| 197 | 3300005545 | Ga0070695_100827942 | Ga0070695_1008279421 | 140 |
| 198 | 3300005545 | Ga0070695_101241927 | Ga0070695_1012419271 | 140 |
| 199 | 3300005546 | Ga0070696_100007948 | Ga0070696_1000079488 | 140 |
| 200 | 3300005546 | Ga0070696_100011958 | Ga0070696_1000119585 | 140 |
| 201 | 3300005546 | Ga0070696_100061448 | Ga0070696_1000614484 | 140 |
| 202 | 3300005546 | Ga0070696_100066473 | Ga0070696_1000664733 | 140 |
| 203 | 3300005546 | Ga0070696_100317632 | Ga0070696_1003176322 | 140 |
| 204 | 3300005547 | Ga0070693_100010068 | Ga0070693_1000100682 | 140 |
| 205 | 3300005547 | Ga0070693_100015387 | Ga0070693_1000153874 | 140 |
| 206 | 3300005549 | Ga0070704_100001374 | Ga0070704_1000013746 | 140 |
| 207 | 3300005549 | Ga0070704_100081158 | Ga0070704_1000811584 | 140 |
| 208 | 3300005549 | Ga0070704_100169859 | Ga0070704_1001698593 | 140 |
| 209 | 3300005549 | Ga0070704_100261988 | Ga0070704_1002619882 | 140 |
| 210 | 3300005563 | Ga0068855_100000225 | Ga0068855_10000022563 | 140 |
| 211 | 3300005564 | Ga0070664_100207701 | Ga0070664_1002077011 | 140 |
| 212 | 3300005577 | Ga0068857_100036222 | Ga0068857_1000362223 | 140 |
| 213 | 3300005577 | Ga0068857_100117893 | Ga0068857_1001178932 | 140 |
| 214 | 3300005577 | Ga0068857_100263207 | Ga0068857_1002632073 | 140 |
| 215 | 3300005578 | Ga0068854_100007476 | Ga0068854_1000074762 | 140 |
| 216 | 3300005614 | Ga0068856_100001169 | Ga0068856_10000116919 | 140 |
| 217 | 3300005615 | Ga0070702_100062811 | Ga0070702_1000628113 | 140 |
| 218 | 3300005617 | Ga0068859_100509788 | Ga0068859_1005097881 | 140 |
| 219 | 3300005718 | Ga0068866_10163854 | Ga0068866_101638542 | 140 |
| 220 | 3300005719 | Ga0068861_100007123 | Ga0068861_1000071235 | 140 |
| 221 | 3300005840 | Ga0068870_10007719 | Ga0068870_100077195 | 140 |
| 222 | 3300005840 | Ga0068870_10272864 | Ga0068870_102728642 | 140 |
| 223 | 3300005841 | Ga0068863_100033502 | Ga0068863_1000335024 | 140 |
| 224 | 3300005842 | Ga0068858_100113125 | Ga0068858_1001131252 | 140 |
| 225 | 3300005843 | Ga0068860_100001109 | Ga0068860_1000011099 | 140 |
| 226 | 3300005843 | Ga0068860_100212652 | Ga0068860_1002126523 | 140 |
| 227 | 3300005843 | Ga0068860_100403565 | Ga0068860_1004035652 | 140 |
| 228 | 3300005844 | Ga0068862_100003750 | Ga0068862_10000375010 | 140 |
| 229 | 3300005844 | Ga0068862_100342658 | Ga0068862_1003426582 | 140 |
| 230 | 3300005844 | Ga0068862_100456991 | Ga0068862_1004569912 | 140 |
| 231 | 3300005844 | Ga0068862_100869224 | Ga0068862_1008692243 | 140 |
| 232 | 3300005937 | Ga0081455_10001810 | Ga0081455_100018107 | 140 |
| 233 | 3300005983 | Ga0081540_1024694 | Ga0081540_10246943 | 140 |
| 234 | 3300005985 | Ga0081539_10000005 | Ga0081539_10000005374 | 140 |
| 235 | 3300006058 | Ga0075432_10024616 | Ga0075432_100246162 | 140 |
| 236 | 3300006058 | Ga0075432_10134811 | Ga0075432_101348113 | 140 |
| 237 | 3300006163 | Ga0070715_10650925 | Ga0070715_106509252 | 140 |
| 238 | 3300006358 | Ga0068871_100999311 | Ga0068871_1009993112 | 140 |
| 239 | 3300006844 | Ga0075428_100000924 | Ga0075428_10000092426 | 140 |
| 240 | 3300006844 | Ga0075428_100001380 | Ga0075428_10000138019 | 140 |
| 241 | 3300006844 | Ga0075428_100005362 | Ga0075428_1000053629 | 140 |
| 242 | 3300006844 | Ga0075428_100579952 | Ga0075428_1005799522 | 140 |
| 243 | 3300006844 | Ga0075428_100884197 | Ga0075428_1008841972 | 140 |
| 244 | 3300006844 | Ga0075428_101050823 | Ga0075428_1010508232 | 140 |
| 245 | 3300006846 | Ga0075430_100000487 | Ga0075430_10000048717 | 140 |
| 246 | 3300006846 | Ga0075430_100245726 | Ga0075430_1002457263 | 140 |
| 247 | 3300006847 | Ga0075431_100002180 | Ga0075431_1000021803 | 140 |
| 248 | 3300006847 | Ga0075431_100005577 | Ga0075431_1000055774 | 140 |
| 249 | 3300006847 | Ga0075431_100044298 | Ga0075431_1000442984 | 140 |
| 250 | 3300006847 | Ga0075431_100178495 | Ga0075431_1001784952 | 140 |
| 251 | 3300006847 | Ga0075431_100198080 | Ga0075431_1001980802 | 140 |
| 252 | 3300006847 | Ga0075431_100285247 | Ga0075431_1002852473 | 140 |
| 253 | 3300006847 | Ga0075431_100431648 | Ga0075431_1004316483 | 140 |
| 254 | 3300006847 | Ga0075431_100844821 | Ga0075431_1008448212 | 140 |
| 255 | 3300006847 | Ga0075431_101266904 | Ga0075431_1012669042 | 140 |
| 256 | 3300006852 | Ga0075433_10006420 | Ga0075433_1000642011 | 140 |
| 257 | 3300006852 | Ga0075433_10019706 | Ga0075433_100197064 | 140 |
| 258 | 3300006852 | Ga0075433_10030670 | Ga0075433_100306706 | 140 |
| 259 | 3300006852 | Ga0075433_10043087 | Ga0075433_100430872 | 140 |
| 260 | 3300006852 | Ga0075433_10050068 | Ga0075433_100500683 | 140 |
| 261 | 3300006852 | Ga0075433_10799416 | Ga0075433_107994161 | 140 |
| 262 | 3300006871 | Ga0075434_100009447 | Ga0075434_10000944710 | 140 |
| 263 | 3300006871 | Ga0075434_100019775 | Ga0075434_1000197755 | 140 |
| 264 | 3300006871 | Ga0075434_100185055 | Ga0075434_1001850555 | 140 |
| 265 | 3300006871 | Ga0075434_100268238 | Ga0075434_1002682382 | 140 |
| 266 | 3300006871 | Ga0075434_100313380 | Ga0075434_1003133803 | 140 |
| 267 | 3300006871 | Ga0075434_100659998 | Ga0075434_1006599982 | 140 |
| 268 | 3300006871 | Ga0075434_100740616 | Ga0075434_1007406163 | 140 |
| 269 | 3300006871 | Ga0075434_100781872 | Ga0075434_1007818722 | 140 |
| 270 | 3300006880 | Ga0075429_100000859 | Ga0075429_10000085913 | 140 |
| 271 | 3300006880 | Ga0075429_100008092 | Ga0075429_1000080923 | 140 |
| 272 | 3300006880 | Ga0075429_100020425 | Ga0075429_1000204254 | 140 |
| 273 | 3300006880 | Ga0075429_100113445 | Ga0075429_1001134451 | 140 |
| 274 | 3300006881 | Ga0068865_100092831 | Ga0068865_1000928312 | 140 |
| 275 | 3300006881 | Ga0068865_100139728 | Ga0068865_1001397282 | 140 |
| 276 | 3300006881 | Ga0068865_100251966 | Ga0068865_1002519662 | 140 |
| 277 | 3300006914 | Ga0075436_100001157 | Ga0075436_10000115713 | 140 |
| 278 | 3300006914 | Ga0075436_100078112 | Ga0075436_1000781121 | 140 |
| 279 | 3300006914 | Ga0075436_100119904 | Ga0075436_1001199043 | 140 |
| 280 | 3300006931 | Ga0097620_100509819 | Ga0097620_1005098191 | 140 |
| 281 | 3300007076 | Ga0075435_100000661 | Ga0075435_1000006619 | 140 |
| 282 | 3300007076 | Ga0075435_100007138 | Ga0075435_1000071382 | 140 |
| 283 | 3300007076 | Ga0075435_100034638 | Ga0075435_1000346385 | 140 |
| 284 | 3300007076 | Ga0075435_100037266 | Ga0075435_1000372665 | 140 |
| 285 | 3300007076 | Ga0075435_100043704 | Ga0075435_1000437043 | 140 |
| 286 | 3300007076 | Ga0075435_100080674 | Ga0075435_1000806742 | 140 |
| 287 | 3300007076 | Ga0075435_100433984 | Ga0075435_1004339842 | 140 |
| 288 | 3300007265 | Ga0099794_10013014 | Ga0099794_100130144 | 140 |
| 289 | 3300007265 | Ga0099794_10048892 | Ga0099794_100488922 | 140 |
| 290 | 3300007788 | Ga0099795_10579111 | Ga0099795_105791112 | 140 |
| 291 | 3300009094 | Ga0111539_10018495 | Ga0111539_100184959 | 140 |
| 292 | 3300009094 | Ga0111539_10216404 | Ga0111539_102164044 | 140 |
| 293 | 3300009094 | Ga0111539_10940847 | Ga0111539_109408472 | 140 |
| 294 | 3300009094 | Ga0111539_12317347 | Ga0111539_123173471 | 140 |
| 295 | 3300009098 | Ga0105245_10200020 | Ga0105245_102000203 | 140 |
| 296 | 3300009147 | Ga0114129_10000115 | Ga0114129_1000011548 | 140 |
| 297 | 3300009147 | Ga0114129_10000606 | Ga0114129_1000060622 | 140 |
| 298 | 3300009147 | Ga0114129_10001631 | Ga0114129_100016319 | 140 |
| 299 | 3300009147 | Ga0114129_10044948 | Ga0114129_100449485 | 140 |
| 300 | 3300009147 | Ga0114129_10052378 | Ga0114129_100523786 | 140 |
| 301 | 3300009147 | Ga0114129_10099562 | Ga0114129_100995622 | 140 |
| 302 | 3300009147 | Ga0114129_10181958 | Ga0114129_101819582 | 140 |
| 303 | 3300009147 | Ga0114129_10380919 | Ga0114129_103809192 | 140 |
| 304 | 3300009147 | Ga0114129_10473394 | Ga0114129_104733943 | 140 |
| 305 | 3300009147 | Ga0114129_10543133 | Ga0114129_105431332 | 140 |
| 306 | 3300009147 | Ga0114129_10638587 | Ga0114129_106385872 | 140 |
| 307 | 3300009147 | Ga0114129_10833734 | Ga0114129_108337342 | 140 |
| 308 | 3300009147 | Ga0114129_11939752 | Ga0114129_119397522 | 140 |
| 309 | 3300009148 | Ga0105243_10007747 | Ga0105243_100077475 | 140 |
| 310 | 3300009148 | Ga0105243_10183874 | Ga0105243_101838741 | 140 |
| 311 | 3300009174 | Ga0105241_10171445 | Ga0105241_101714452 | 140 |
| 312 | 3300009174 | Ga0105241_10181111 | Ga0105241_101811113 | 140 |
| 313 | 3300009176 | Ga0105242_10144974 | Ga0105242_101449742 | 140 |
| 314 | 3300009545 | Ga0105237_10081739 | Ga0105237_100817392 | 140 |
| 315 | 3300009551 | Ga0105238_10640592 | Ga0105238_106405921 | 140 |
| 316 | 3300009553 | Ga0105249_10031638 | Ga0105249_100316383 | 140 |
| 317 | 3300009553 | Ga0105249_10328103 | Ga0105249_103281032 | 140 |
| 318 | 3300009553 | Ga0105249_10698852 | Ga0105249_106988522 | 140 |
| 319 | 3300009553 | Ga0105249_10759559 | Ga0105249_107595592 | 140 |
| 320 | 3300009553 | Ga0105249_10868964 | Ga0105249_108689642 | 140 |
| 321 | 3300009553 | Ga0105249_13085990 | Ga0105249_130859901 | 140 |
| 322 | 3300010375 | Ga0105239_11349287 | Ga0105239_113492872 | 140 |
| 323 | 3300011119 | Ga0105246_10289229 | Ga0105246_102892293 | 140 |
| 324 | 3300013100 | Ga0157373_10000388 | Ga0157373_1000038817 | 140 |
| 325 | 3300013102 | Ga0157371_10123835 | Ga0157371_101238352 | 140 |
| 326 | 3300013102 | Ga0157371_10807538 | Ga0157371_108075382 | 140 |
| 327 | 3300013105 | Ga0157369_10109413 | Ga0157369_101094133 | 140 |
| 328 | 3300013297 | Ga0157378_10537610 | Ga0157378_105376102 | 140 |
| 329 | 3300013307 | Ga0157372_10000105 | Ga0157372_1000010564 | 140 |
| 330 | 3300013307 | Ga0157372_10402152 | Ga0157372_104021524 | 140 |
| 331 | 3300013308 | Ga0157375_10295519 | Ga0157375_102955192 | 140 |
| 332 | 3300014326 | Ga0157380_10205551 | Ga0157380_102055512 | 140 |
| 333 | 3300014497 | Ga0182008_10038771 | Ga0182008_100387712 | 140 |
| 334 | 3300014745 | Ga0157377_10344437 | Ga0157377_103444372 | 140 |
| 335 | 3300014968 | Ga0157379_10126211 | Ga0157379_101262113 | 140 |
| 336 | 3300015262 | Ga0182007_10202743 | Ga0182007_102027432 | 140 |
| 337 | 3300020070 | Ga0206356_10921615 | Ga0206356_109216151 | 140 |
| 338 | 3300020082 | Ga0206353_11152683 | Ga0206353_111526831 | 140 |
| 339 | 3300025885 | Ga0207653_10062032 | Ga0207653_100620321 | 140 |
| 340 | 3300025901 | Ga0207688_10038779 | Ga0207688_100387793 | 140 |
| 341 | 3300025903 | Ga0207680_10242575 | Ga0207680_102425752 | 140 |
| 342 | 3300025904 | Ga0207647_10130297 | Ga0207647_101302972 | 140 |
| 343 | 3300025905 | Ga0207685_10240848 | Ga0207685_102408482 | 140 |
| 344 | 3300025906 | Ga0207699_10373815 | Ga0207699_103738152 | 140 |
| 345 | 3300025907 | Ga0207645_10005499 | Ga0207645_100054993 | 140 |
| 346 | 3300025908 | Ga0207643_10000329 | Ga0207643_100003295 | 140 |
| 347 | 3300025908 | Ga0207643_10058926 | Ga0207643_100589263 | 140 |
| 348 | 3300025910 | Ga0207684_10000115 | Ga0207684_100001153 | 140 |
| 349 | 3300025910 | Ga0207684_10004217 | Ga0207684_1000421715 | 140 |
| 350 | 3300025910 | Ga0207684_10012100 | Ga0207684_100121005 | 140 |
| 351 | 3300025910 | Ga0207684_10016655 | Ga0207684_100166555 | 140 |
| 352 | 3300025910 | Ga0207684_10041537 | Ga0207684_100415373 | 140 |
| 353 | 3300025910 | Ga0207684_10055055 | Ga0207684_100550555 | 140 |
| 354 | 3300025910 | Ga0207684_10075787 | Ga0207684_100757874 | 140 |
| 355 | 3300025910 | Ga0207684_10087362 | Ga0207684_100873624 | 140 |
| 356 | 3300025910 | Ga0207684_10114071 | Ga0207684_101140713 | 140 |
| 357 | 3300025910 | Ga0207684_10155793 | Ga0207684_101557932 | 140 |
| 358 | 3300025910 | Ga0207684_10320745 | Ga0207684_103207452 | 140 |
| 359 | 3300025910 | Ga0207684_11492938 | Ga0207684_114929382 | 140 |
| 360 | 3300025911 | Ga0207654_10004154 | Ga0207654_100041547 | 140 |
| 361 | 3300025911 | Ga0207654_10175934 | Ga0207654_101759343 | 140 |
| 362 | 3300025912 | Ga0207707_10000352 | Ga0207707_1000035214 | 140 |
| 363 | 3300025914 | Ga0207671_10100012 | Ga0207671_101000123 | 140 |
| 364 | 3300025917 | Ga0207660_10000334 | Ga0207660_1000033424 | 140 |
| 365 | 3300025917 | Ga0207660_10090303 | Ga0207660_100903031 | 140 |
| 366 | 3300025917 | Ga0207660_10350194 | Ga0207660_103501941 | 140 |
| 367 | 3300025918 | Ga0207662_10017645 | Ga0207662_100176456 | 140 |
| 368 | 3300025919 | Ga0207657_10002264 | Ga0207657_100022642 | 140 |
| 369 | 3300025920 | Ga0207649_10013687 | Ga0207649_100136877 | 140 |
| 370 | 3300025921 | Ga0207652_10000466 | Ga0207652_1000046626 | 140 |
| 371 | 3300025922 | Ga0207646_10000250 | Ga0207646_1000025044 | 140 |
| 372 | 3300025922 | Ga0207646_10008025 | Ga0207646_100080256 | 140 |
| 373 | 3300025922 | Ga0207646_10017586 | Ga0207646_100175864 | 140 |
| 374 | 3300025922 | Ga0207646_10030213 | Ga0207646_100302135 | 140 |
| 375 | 3300025922 | Ga0207646_10035173 | Ga0207646_100351732 | 140 |
| 376 | 3300025922 | Ga0207646_10162660 | Ga0207646_101626603 | 140 |
| 377 | 3300025922 | Ga0207646_10168402 | Ga0207646_101684023 | 140 |
| 378 | 3300025922 | Ga0207646_10201847 | Ga0207646_102018473 | 140 |
| 379 | 3300025922 | Ga0207646_10246117 | Ga0207646_102461172 | 140 |
| 380 | 3300025922 | Ga0207646_10532405 | Ga0207646_105324052 | 140 |
| 381 | 3300025922 | Ga0207646_10981408 | Ga0207646_109814082 | 140 |
| 382 | 3300025922 | Ga0207646_11206851 | Ga0207646_112068511 | 140 |
| 383 | 3300025923 | Ga0207681_10082617 | Ga0207681_100826172 | 140 |
| 384 | 3300025923 | Ga0207681_10240368 | Ga0207681_102403682 | 140 |
| 385 | 3300025923 | Ga0207681_11406862 | Ga0207681_114068622 | 140 |
| 386 | 3300025924 | Ga0207694_10355091 | Ga0207694_103550913 | 140 |
| 387 | 3300025925 | Ga0207650_10268037 | Ga0207650_102680372 | 140 |
| 388 | 3300025932 | Ga0207690_10003653 | Ga0207690_100036535 | 140 |
| 389 | 3300025933 | Ga0207706_10008780 | Ga0207706_100087809 | 140 |
| 390 | 3300025933 | Ga0207706_10038603 | Ga0207706_100386033 | 140 |
| 391 | 3300025934 | Ga0207686_10099272 | Ga0207686_100992723 | 140 |
| 392 | 3300025935 | Ga0207709_10003271 | Ga0207709_100032719 | 140 |
| 393 | 3300025935 | Ga0207709_10366549 | Ga0207709_103665491 | 140 |
| 394 | 3300025935 | Ga0207709_11077258 | Ga0207709_110772581 | 140 |
| 395 | 3300025936 | Ga0207670_10003001 | Ga0207670_100030012 | 140 |
| 396 | 3300025938 | Ga0207704_10588999 | Ga0207704_105889992 | 140 |
| 397 | 3300025939 | Ga0207665_10010689 | Ga0207665_1001068911 | 140 |
| 398 | 3300025940 | Ga0207691_10044338 | Ga0207691_100443385 | 140 |
| 399 | 3300025942 | Ga0207689_10003685 | Ga0207689_1000368510 | 140 |
| 400 | 3300025942 | Ga0207689_10011582 | Ga0207689_100115825 | 140 |
| 401 | 3300025942 | Ga0207689_10054717 | Ga0207689_100547172 | 140 |
| 402 | 3300025944 | Ga0207661_10269170 | Ga0207661_102691702 | 140 |
| 403 | 3300025945 | Ga0207679_10000878 | Ga0207679_1000087812 | 140 |
| 404 | 3300025949 | Ga0207667_10000497 | Ga0207667_1000049726 | 140 |
| 405 | 3300025960 | Ga0207651_11198234 | Ga0207651_111982342 | 140 |
| 406 | 3300025961 | Ga0207712_10044142 | Ga0207712_100441423 | 140 |
| 407 | 3300025961 | Ga0207712_10353842 | Ga0207712_103538422 | 140 |
| 408 | 3300025961 | Ga0207712_10561970 | Ga0207712_105619702 | 140 |
| 409 | 3300025961 | Ga0207712_10671043 | Ga0207712_106710432 | 140 |
| 410 | 3300025981 | Ga0207640_10009082 | Ga0207640_100090822 | 140 |
| 411 | 3300025986 | Ga0207658_11569601 | Ga0207658_115696011 | 140 |
| 412 | 3300026041 | Ga0207639_10002384 | Ga0207639_100023849 | 140 |
| 413 | 3300026067 | Ga0207678_10054455 | Ga0207678_100544553 | 140 |
| 414 | 3300026075 | Ga0207708_10217137 | Ga0207708_102171372 | 140 |
| 415 | 3300026075 | Ga0207708_10790475 | Ga0207708_107904752 | 140 |
| 416 | 3300026078 | Ga0207702_10008955 | Ga0207702_100089557 | 140 |
| 417 | 3300026089 | Ga0207648_10005839 | Ga0207648_1000583913 | 140 |
| 418 | 3300026089 | Ga0207648_10115995 | Ga0207648_101159953 | 140 |
| 419 | 3300026089 | Ga0207648_11166398 | Ga0207648_111663982 | 140 |
| 420 | 3300026095 | Ga0207676_10014367 | Ga0207676_100143673 | 140 |
| 421 | 3300026116 | Ga0207674_10000550 | Ga0207674_100005509 | 140 |
| 422 | 3300026116 | Ga0207674_10161954 | Ga0207674_101619541 | 140 |
| 423 | 3300026116 | Ga0207674_10629755 | Ga0207674_106297552 | 140 |
| 424 | 3300026118 | Ga0207675_100005709 | Ga0207675_1000057096 | 140 |
| 425 | 3300026118 | Ga0207675_100267941 | Ga0207675_1002679414 | 140 |
| 426 | 3300026118 | Ga0207675_100356310 | Ga0207675_1003563102 | 140 |
| 427 | 3300027360 | Ga0209969_1010320 | Ga0209969_10103202 | 140 |
| 428 | 3300027364 | Ga0209967_1015709 | Ga0209967_10157092 | 140 |
| 429 | 3300027378 | Ga0209981_1012710 | Ga0209981_10127102 | 140 |
| 430 | 3300027395 | Ga0209996_1000987 | Ga0209996_10009873 | 140 |
| 431 | 3300027462 | Ga0210000_1001288 | Ga0210000_10012884 | 140 |
| 432 | 3300027471 | Ga0209995_1001479 | Ga0209995_10014792 | 140 |
| 433 | 3300027526 | Ga0209968_1005623 | Ga0209968_10056232 | 140 |
| 434 | 3300027526 | Ga0209968_1058298 | Ga0209968_10582981 | 140 |
| 435 | 3300027543 | Ga0209999_1000243 | Ga0209999_10002434 | 140 |
| 436 | 3300027552 | Ga0209982_1000487 | Ga0209982_10004873 | 140 |
| 437 | 3300027614 | Ga0209970_1017224 | Ga0209970_10172242 | 140 |
| 438 | 3300027617 | Ga0210002_1033995 | Ga0210002_10339952 | 140 |
| 439 | 3300027665 | Ga0209983_1000034 | Ga0209983_10000342 | 140 |
| 440 | 3300027671 | Ga0209588_1041569 | Ga0209588_10415693 | 140 |
| 441 | 3300027671 | Ga0209588_1111984 | Ga0209588_11119842 | 140 |
| 442 | 3300027671 | Ga0209588_1156985 | Ga0209588_11569852 | 140 |
| 443 | 3300027682 | Ga0209971_1000028 | Ga0209971_100002819 | 140 |
| 444 | 3300027682 | Ga0209971_1020061 | Ga0209971_10200612 | 140 |
| 445 | 3300027695 | Ga0209966_1000073 | Ga0209966_100007311 | 140 |
| 446 | 3300027717 | Ga0209998_10000001 | Ga0209998_10000001159 | 140 |
| 447 | 3300027717 | Ga0209998_10017838 | Ga0209998_100178382 | 140 |
| 448 | 3300027717 | Ga0209998_10085113 | Ga0209998_100851131 | 140 |
| 449 | 3300027876 | Ga0209974_10000369 | Ga0209974_100003692 | 140 |
| 450 | 3300027907 | Ga0207428_10355343 | Ga0207428_103553432 | 140 |
| 451 | 3300028380 | Ga0268265_10002923 | Ga0268265_1000292310 | 140 |
| 452 | 3300028380 | Ga0268265_10136227 | Ga0268265_101362272 | 140 |
| 453 | 3300028380 | Ga0268265_10196008 | Ga0268265_101960083 | 140 |
| 454 | 3300028380 | Ga0268265_11144355 | Ga0268265_111443552 | 140 |
| 455 | 3300028381 | Ga0268264_10182259 | Ga0268264_101822593 | 140 |
| 456 | 3300028381 | Ga0268264_10342083 | Ga0268264_103420832 | 140 |
| 457 | 3300028381 | Ga0268264_10758437 | Ga0268264_107584372 | 140 |
| 458 | 3300031548 | Ga0307408_100049624 | Ga0307408_1000496243 | 140 |
| 459 | 3300031548 | Ga0307408_100058377 | Ga0307408_1000583774 | 140 |
| 460 | 3300031548 | Ga0307408_100105981 | Ga0307408_1001059812 | 140 |
| 461 | 3300031548 | Ga0307408_100409067 | Ga0307408_1004090672 | 140 |
| 462 | 3300031548 | Ga0307408_100685699 | Ga0307408_1006856992 | 140 |
| 463 | 3300031548 | Ga0307408_101107260 | Ga0307408_1011072602 | 140 |
| 464 | 3300031731 | Ga0307405_10778720 | Ga0307405_107787202 | 140 |
| 465 | 3300031824 | Ga0307413_11716277 | Ga0307413_117162771 | 140 |
| 466 | 3300031901 | Ga0307406_10423026 | Ga0307406_104230261 | 140 |
| 467 | 3300031901 | Ga0307406_10522711 | Ga0307406_105227112 | 140 |
| 468 | 3300031903 | Ga0307407_10924550 | Ga0307407_109245502 | 140 |
| 469 | 3300031911 | Ga0307412_10067622 | Ga0307412_100676222 | 140 |
| 470 | 3300031995 | Ga0307409_100055052 | Ga0307409_1000550522 | 140 |
| 471 | 3300031995 | Ga0307409_100249842 | Ga0307409_1002498423 | 140 |
| 472 | 3300031995 | Ga0307409_101084352 | Ga0307409_1010843522 | 140 |
| 473 | 3300031995 | Ga0307409_101402134 | Ga0307409_1014021342 | 140 |
| 474 | 3300032002 | Ga0307416_100116219 | Ga0307416_1001162193 | 140 |
| 475 | 3300032002 | Ga0307416_100117613 | Ga0307416_1001176133 | 140 |
| 476 | 3300032002 | Ga0307416_100364315 | Ga0307416_1003643153 | 140 |
| 477 | 3300032005 | Ga0307411_10501390 | Ga0307411_105013902 | 140 |
| 478 | 3300034816 | Ga0373930_0025476 | Ga0373930_0025476_730_1155 | 140 |
| 479 | 3300035085 | Ga0373929_0019492 | Ga0373929_0019492_52_477 | 140 |
| 480 | 3300035092 | Ga0373952_0012443 | Ga0373952_0012443_757_1182 | 140 |
| 481 | 3300035114 | Ga0373939_0008845 | Ga0373939_0008845_1293_1718 | 140 |
| 482 | 3300035114 | Ga0373939_0121915 | Ga0373939_0121915_229_654 | 140 |
| 483 | 3300035115 | Ga0373941_0137792 | Ga0373941_0137792_443_868 | 140 |
| 484 | 3300035121 | Ga0373960_0017235 | Ga0373960_0017235_1072_1497 | 140 |
| 485 | 3300035207 | Ga0373942_0126126 | Ga0373942_0126126_166_591 | 140 |
| 486 | 3300035241 | Ga0373961_0136875 | Ga0373961_0136875_372_797 | 140 |
| 487 | 3300035691 | Ga0373931_0168586 | Ga0373931_0168586_295_720 | 140 |
| 488 | 3300037312 | Ga0395899_0098186 | Ga0395899_0098186_18_443 | 140 |
| 489 | 3300037418 | Ga0395900_0158493 | Ga0395900_0158493_169_594 | 140 |
| 490 | 3300037418 | Ga0395900_0262037 | Ga0395900_0262037_917_1339 | 140 |
| 491 | 3300037466 | Ga0395898_0068101 | Ga0395898_0068101_1327_1752 | 140 |
| 492 | 3300037466 | Ga0395898_0754785 | Ga0395898_0754785_257_679 | 140 |
| 493 | 3300037471 | Ga0395905_0032845 | Ga0395905_0032845_4018_4440 | 140 |
| 494 | 3300038443 | Ga0395901_0003553 | Ga0395901_0003553_15270_15695 | 140 |
| 495 | 3300038443 | Ga0395901_0316283 | Ga0395901_0316283_570_992 | 140 |
| 496 | 3300038742 | Ga0400486_00771 | Ga0400486_00771_3278_3712 | 140 |
| 497 | 3300042001 | Ga0439441_014767 | Ga0439441_014767_834_1271 | 140 |
| 498 | 3300042005 | Ga0439448_0001340 | Ga0439448_0001340_2271_2696 | 140 |
| 499 | 3300042005 | Ga0439448_0050970 | Ga0439448_0050970_414_839 | 140 |
| 500 | 3300042008 | Ga0439450_014251 | Ga0439450_014251_569_994 | 140 |
| 501 | 3300042012 | Ga0439455_0010262 | Ga0439455_0010262_31_456 | 140 |
| 502 | 3300042013 | Ga0439456_006513 | Ga0439456_006513_1674_2099 | 140 |
| 503 | 3300042144 | Ga0450889_016641 | Ga0450889_016641_303_728 | 140 |
| 504 | 3300042438 | Ga0439459_0000265 | Ga0439459_0000265_5077_5502 | 140 |
| 505 | 3300042439 | Ga0439464_0001792 | Ga0439464_0001792_1415_1840 | 140 |
| 506 | 3300042461 | Ga0439460_0000935 | Ga0439460_0000935_2084_2509 | 140 |
| 507 | 3300042876 | Ga0451577_0005206 | Ga0451577_0005206_5985_6410 | 140 |
| 508 | 3300042876 | Ga0451577_0010038 | Ga0451577_0010038_6654_7079 | 140 |
| 509 | 3300044673 | Ga0453683_0003008 | Ga0453683_0003008_11951_12376 | 140 |
| 510 | 3300044673 | Ga0453683_0013004 | Ga0453683_0013004_4079_4504 | 140 |
| 511 | 3300044712 | Ga0453684_0019511 | Ga0453684_0019511_642_1097 | 140 |
| 512 | 3300044712 | Ga0453684_0202154 | Ga0453684_0202154_926_1351 | 140 |
| 513 | 3300044712 | Ga0453684_1231168 | Ga0453684_1231168_59_484 | 140 |
| 514 | 3300044712 | Ga0453684_1268941 | Ga0453684_1268941_252_677 | 140 |
| 515 | 3300045051 | Ga0451576_0025605 | Ga0451576_0025605_869_1294 | 140 |
| 516 | 3300045051 | Ga0451576_0071114 | Ga0451576_0071114_2395_2820 | 140 |
| 517 | 3300045051 | Ga0451576_0232246 | Ga0451576_0232246_56_481 | 140 |
| 518 | 3300045051 | Ga0451576_0258336 | Ga0451576_0258336_1383_1808 | 140 |
| 519 | 3300045051 | Ga0451576_0458466 | Ga0451576_0458466_573_998 | 140 |
| 520 | 3300045051 | Ga0451576_1028191 | Ga0451576_1028191_239_664 | 140 |
| 521 | 3300045051 | Ga0451576_1112381 | Ga0451576_1112381_391_816 | 140 |
| 522 | 3300045051 | Ga0451576_2035105 | Ga0451576_2035105_23_448 | 140 |
| 523 | 3300046472 | Ga0495580_0005633 | Ga0495580_0005633_4520_4945 | 140 |
| 524 | 3300046472 | Ga0495580_0057095 | Ga0495580_0057095_339_764 | 140 |
| 525 | 3300046491 | Ga0495584_0301533 | Ga0495584_0301533_152_577 | 140 |
| 526 | 3300046528 | Ga0495642_0123655 | Ga0495642_0123655_16_441 | 140 |
| 527 | 3300046664 | Ga0495659_0092071 | Ga0495659_0092071_199_624 | 140 |
| 528 | 3300046664 | Ga0495659_0104214 | Ga0495659_0104214_264_689 | 140 |
| 529 | 3300046684 | Ga0495669_0086886 | Ga0495669_0086886_283_705 | 140 |
| 530 | 3300046684 | Ga0495669_0319428 | Ga0495669_0319428_144_569 | 140 |
| 531 | 3300047318 | Ga0495636_0244510 | Ga0495636_0244510_65_490 | 140 |
| 532 | 3300048905 | Ga0496102_0038621 | Ga0496102_0038621_2266_2691 | 140 |
| 533 | 3300048905 | Ga0496102_0400327 | Ga0496102_0400327_659_1084 | 140 |
| 534 | 3300048907 | Ga0496104_0398697 | Ga0496104_0398697_627_1052 | 140 |
| 535 | 3300048909 | Ga0496106_0070068 | Ga0496106_0070068_1642_2067 | 140 |
| 536 | 3300048910 | Ga0496107_0422369 | Ga0496107_0422369_149_574 | 140 |
| 537 | 3300048912 | Ga0496109_0713502 | Ga0496109_0713502_85_510 | 140 |
| 538 | 3300048915 | Ga0496112_0139340 | Ga0496112_0139340_1036_1461 | 140 |
| 539 | 3300049515 | Ga0501292_029677 | Ga0501292_029677_471_893 | 140 |
| 540 | 3300049521 | Ga0501298_050962 | Ga0501298_050962_203_625 | 140 |
| 541 | 3300049570 | Ga0501033_0038328 | Ga0501033_0038328_3070_3495 | 140 |
| 542 | 3300049570 | Ga0501033_0294784 | Ga0501033_0294784_70_495 | 140 |
| 543 | 3300049570 | Ga0501033_0346609 | Ga0501033_0346609_558_1028 | 140 |
| 544 | 3300049570 | Ga0501033_0360772 | Ga0501033_0360772_138_563 | 140 |
| 545 | 3300049570 | Ga0501033_0399332 | Ga0501033_0399332_107_532 | 140 |
| 546 | 3300049572 | Ga0501036_0008473 | Ga0501036_0008473_5470_5895 | 140 |
| 547 | 3300049572 | Ga0501036_0029734 | Ga0501036_0029734_359_784 | 140 |
| 548 | 3300049572 | Ga0501036_0137721 | Ga0501036_0137721_1590_2015 | 140 |
| 549 | 3300049572 | Ga0501036_0143053 | Ga0501036_0143053_624_1049 | 140 |
| 550 | 3300049572 | Ga0501036_0289350 | Ga0501036_0289350_210_635 | 140 |
| 551 | 3300049572 | Ga0501036_0503945 | Ga0501036_0503945_544_969 | 140 |
| 552 | 3300049572 | Ga0501036_1683040 | Ga0501036_1683040_69_494 | 140 |
| 553 | 3300049573 | Ga0501037_0122149 | Ga0501037_0122149_1209_1634 | 140 |
| 554 | 3300049573 | Ga0501037_0693477 | Ga0501037_0693477_171_596 | 140 |
| 555 | 3300049574 | Ga0501038_0008826 | Ga0501038_0008826_5108_5533 | 140 |
| 556 | 3300049574 | Ga0501038_0098642 | Ga0501038_0098642_547_972 | 140 |
| 557 | 3300049574 | Ga0501038_0142802 | Ga0501038_0142802_522_947 | 140 |
| 558 | 3300049574 | Ga0501038_0790779 | Ga0501038_0790779_249_674 | 140 |
| 559 | 3300049575 | Ga0501039_0006761 | Ga0501039_0006761_7163_7588 | 140 |
| 560 | 3300049575 | Ga0501039_0028057 | Ga0501039_0028057_2380_2805 | 140 |
| 561 | 3300049575 | Ga0501039_0226156 | Ga0501039_0226156_291_713 | 140 |
| 562 | 3300049575 | Ga0501039_0438744 | Ga0501039_0438744_488_913 | 140 |
| 563 | 3300049575 | Ga0501039_0859626 | Ga0501039_0859626_267_692 | 140 |
| 564 | 3300049575 | Ga0501039_0930980 | Ga0501039_0930980_123_548 | 140 |
| 565 | 3300049576 | Ga0501040_0006783 | Ga0501040_0006783_958_1383 | 140 |
| 566 | 3300049576 | Ga0501040_0024123 | Ga0501040_0024123_1197_1622 | 140 |
| 567 | 3300049576 | Ga0501040_0042354 | Ga0501040_0042354_2350_2775 | 140 |
| 568 | 3300049576 | Ga0501040_0046392 | Ga0501040_0046392_315_740 | 140 |
| 569 | 3300049576 | Ga0501040_0131181 | Ga0501040_0131181_402_827 | 140 |
| 570 | 3300049576 | Ga0501040_0731066 | Ga0501040_0731066_279_704 | 140 |
| 571 | 3300049577 | Ga0501041_0014008 | Ga0501041_0014008_1634_2059 | 140 |
| 572 | 3300049577 | Ga0501041_0015706 | Ga0501041_0015706_2373_2798 | 140 |
| 573 | 3300049577 | Ga0501041_0024893 | Ga0501041_0024893_511_936 | 140 |
| 574 | 3300049577 | Ga0501041_0119263 | Ga0501041_0119263_1028_1450 | 140 |
| 575 | 3300049577 | Ga0501041_0122637 | Ga0501041_0122637_102_527 | 140 |
| 576 | 3300049577 | Ga0501041_0181516 | Ga0501041_0181516_338_763 | 140 |
| 577 | 3300049577 | Ga0501041_0198808 | Ga0501041_0198808_718_1143 | 140 |
| 578 | 3300049577 | Ga0501041_0833353 | Ga0501041_0833353_87_557 | 140 |
| 579 | 3300049578 | Ga0501042_0007483 | Ga0501042_0007483_6565_6990 | 140 |
| 580 | 3300049578 | Ga0501042_0055319 | Ga0501042_0055319_1334_1759 | 140 |
| 581 | 3300049578 | Ga0501042_0102109 | Ga0501042_0102109_173_598 | 140 |
| 582 | 3300049578 | Ga0501042_0175713 | Ga0501042_0175713_537_962 | 140 |
| 583 | 3300049578 | Ga0501042_0542254 | Ga0501042_0542254_283_708 | 140 |
| 584 | 3300049578 | Ga0501042_1138061 | Ga0501042_1138061_119_544 | 140 |
| 585 | 3300049579 | Ga0501043_0103412 | Ga0501043_0103412_1064_1489 | 140 |
| 586 | 3300049579 | Ga0501043_0553562 | Ga0501043_0553562_307_732 | 140 |
| 587 | 3300049579 | Ga0501043_1268852 | Ga0501043_1268852_19_441 | 140 |
| 588 | 3300049580 | Ga0501046_0006426 | Ga0501046_0006426_4058_4483 | 140 |
| 589 | 3300049580 | Ga0501046_0018987 | Ga0501046_0018987_2548_2973 | 140 |
| 590 | 3300049580 | Ga0501046_0078313 | Ga0501046_0078313_2011_2436 | 140 |
| 591 | 3300049580 | Ga0501046_0100534 | Ga0501046_0100534_182_607 | 140 |
| 592 | 3300049580 | Ga0501046_0213903 | Ga0501046_0213903_724_1149 | 140 |
| 593 | 3300049582 | Ga0501048_0021736 | Ga0501048_0021736_825_1250 | 140 |
| 594 | 3300049582 | Ga0501048_0078325 | Ga0501048_0078325_1265_1690 | 140 |
| 595 | 3300049582 | Ga0501048_0130757 | Ga0501048_0130757_281_706 | 140 |
| 596 | 3300049582 | Ga0501048_0133623 | Ga0501048_0133623_1060_1485 | 140 |
| 597 | 3300049582 | Ga0501048_0292418 | Ga0501048_0292418_195_617 | 140 |
| 598 | 3300049582 | Ga0501048_0674724 | Ga0501048_0674724_217_639 | 140 |
| 599 | 3300049582 | Ga0501048_1080280 | Ga0501048_1080280_23_451 | 140 |
| 600 | 3300049583 | Ga0501067_0154006 | Ga0501067_0154006_329_754 | 140 |
| 601 | 3300049584 | Ga0501068_0033097 | Ga0501068_0033097_2083_2508 | 140 |
| 602 | 3300049584 | Ga0501068_0071879 | Ga0501068_0071879_622_1047 | 140 |
| 603 | 3300049584 | Ga0501068_0082028 | Ga0501068_0082028_590_1015 | 140 |
| 604 | 3300049587 | Ga0501071_0107335 | Ga0501071_0107335_1425_1850 | 140 |
| 605 | 3300049587 | Ga0501071_0124133 | Ga0501071_0124133_883_1308 | 140 |
| 606 | 3300049588 | Ga0501072_0018561 | Ga0501072_0018561_2371_2796 | 140 |
| 607 | 3300049588 | Ga0501072_0028643 | Ga0501072_0028643_198_623 | 140 |
| 608 | 3300049588 | Ga0501072_0045219 | Ga0501072_0045219_2521_2943 | 140 |
| 609 | 3300049588 | Ga0501072_0101298 | Ga0501072_0101298_1125_1550 | 140 |
| 610 | 3300049588 | Ga0501072_0128520 | Ga0501072_0128520_1401_1826 | 140 |
| 611 | 3300049588 | Ga0501072_0359228 | Ga0501072_0359228_346_771 | 140 |
| 612 | 3300049588 | Ga0501072_0360289 | Ga0501072_0360289_212_634 | 140 |
| 613 | 3300049588 | Ga0501072_0437841 | Ga0501072_0437841_147_572 | 140 |
| 614 | 3300049588 | Ga0501072_0484509 | Ga0501072_0484509_49_474 | 140 |
| 615 | 3300049588 | Ga0501072_0503136 | Ga0501072_0503136_193_618 | 140 |
| 616 | 3300049588 | Ga0501072_1598324 | Ga0501072_1598324_49_474 | 140 |
| 617 | 3300049589 | Ga0501073_0555769 | Ga0501073_0555769_124_549 | 140 |
| 618 | 3300049590 | Ga0501074_0010060 | Ga0501074_0010060_781_1206 | 140 |
| 619 | 3300049590 | Ga0501074_0089779 | Ga0501074_0089779_1716_2141 | 140 |
| 620 | 3300049590 | Ga0501074_0684644 | Ga0501074_0684644_212_637 | 140 |
| 621 | 3300049591 | Ga0501075_0000122 | Ga0501075_0000122_10720_11145 | 140 |
| 622 | 3300049591 | Ga0501075_0036490 | Ga0501075_0036490_1466_1891 | 140 |
| 623 | 3300049591 | Ga0501075_0049544 | Ga0501075_0049544_1140_1565 | 140 |
| 624 | 3300049591 | Ga0501075_0056627 | Ga0501075_0056627_765_1190 | 140 |
| 625 | 3300049591 | Ga0501075_0060695 | Ga0501075_0060695_743_1168 | 140 |
| 626 | 3300049591 | Ga0501075_0106630 | Ga0501075_0106630_865_1287 | 140 |
| 627 | 3300049591 | Ga0501075_0122974 | Ga0501075_0122974_1219_1644 | 140 |
| 628 | 3300049591 | Ga0501075_0201147 | Ga0501075_0201147_170_595 | 140 |
| 629 | 3300049591 | Ga0501075_0349403 | Ga0501075_0349403_392_850 | 140 |
| 630 | 3300049591 | Ga0501075_0479799 | Ga0501075_0479799_296_721 | 140 |
| 631 | 3300049591 | Ga0501075_0593594 | Ga0501075_0593594_371_796 | 140 |
| 632 | 3300049592 | Ga0501076_0000012 | Ga0501076_0000012_43344_43769 | 140 |
| 633 | 3300049592 | Ga0501076_0002878 | Ga0501076_0002878_6933_7358 | 140 |
| 634 | 3300049592 | Ga0501076_0077598 | Ga0501076_0077598_898_1320 | 140 |
| 635 | 3300049592 | Ga0501076_0136162 | Ga0501076_0136162_98_568 | 140 |
| 636 | 3300049592 | Ga0501076_0148285 | Ga0501076_0148285_304_726 | 140 |
| 637 | 3300049592 | Ga0501076_0173942 | Ga0501076_0173942_537_962 | 140 |
| 638 | 3300049592 | Ga0501076_0283450 | Ga0501076_0283450_836_1261 | 140 |
| 639 | 3300049592 | Ga0501076_0558068 | Ga0501076_0558068_192_617 | 140 |
| 640 | 3300049592 | Ga0501076_0611806 | Ga0501076_0611806_154_579 | 140 |
| 641 | 3300049592 | Ga0501076_1277826 | Ga0501076_1277826_10_435 | 140 |
| 642 | 3300049593 | Ga0501077_0007666 | Ga0501077_0007666_1823_2248 | 140 |
| 643 | 3300049593 | Ga0501077_0033134 | Ga0501077_0033134_284_709 | 140 |
| 644 | 3300049593 | Ga0501077_0045888 | Ga0501077_0045888_1607_2032 | 140 |
| 645 | 3300049593 | Ga0501077_0086210 | Ga0501077_0086210_959_1381 | 140 |
| 646 | 3300049593 | Ga0501077_0095346 | Ga0501077_0095346_541_966 | 140 |
| 647 | 3300049593 | Ga0501077_0489828 | Ga0501077_0489828_251_676 | 140 |
| 648 | 3300049593 | Ga0501077_0509656 | Ga0501077_0509656_337_759 | 140 |
| 649 | 3300049593 | Ga0501077_0887102 | Ga0501077_0887102_55_477 | 140 |
| 650 | 3300049741 | Ga0501079_0001408 | Ga0501079_0001408_14095_14520 | 140 |
| 651 | 3300049741 | Ga0501079_0008164 | Ga0501079_0008164_1704_2129 | 140 |
| 652 | 3300049741 | Ga0501079_0028593 | Ga0501079_0028593_1179_1604 | 140 |
| 653 | 3300049741 | Ga0501079_0061478 | Ga0501079_0061478_56_481 | 140 |
| 654 | 3300049741 | Ga0501079_0073083 | Ga0501079_0073083_1275_1697 | 140 |
| 655 | 3300049741 | Ga0501079_0076362 | Ga0501079_0076362_2118_2543 | 140 |
| 656 | 3300049741 | Ga0501079_0086560 | Ga0501079_0086560_1345_1770 | 140 |
| 657 | 3300049741 | Ga0501079_0102595 | Ga0501079_0102595_1747_2172 | 140 |
| 658 | 3300049741 | Ga0501079_0159600 | Ga0501079_0159600_436_861 | 140 |
| 659 | 3300049741 | Ga0501079_0172787 | Ga0501079_0172787_282_704 | 140 |
| 660 | 3300049741 | Ga0501079_0737754 | Ga0501079_0737754_201_626 | 140 |
| 661 | 3300049742 | Ga0501080_0033964 | Ga0501080_0033964_371_796 | 140 |
| 662 | 3300049742 | Ga0501080_0060392 | Ga0501080_0060392_793_1218 | 140 |
| 663 | 3300049742 | Ga0501080_0073226 | Ga0501080_0073226_177_602 | 140 |
| 664 | 3300049742 | Ga0501080_0209044 | Ga0501080_0209044_1182_1604 | 140 |
| 665 | 3300049742 | Ga0501080_0224668 | Ga0501080_0224668_1233_1658 | 140 |
| 666 | 3300049742 | Ga0501080_0300936 | Ga0501080_0300936_194_619 | 140 |
| 667 | 3300049742 | Ga0501080_0399135 | Ga0501080_0399135_653_1078 | 140 |
| 668 | 3300049742 | Ga0501080_0576758 | Ga0501080_0576758_390_815 | 140 |
| 669 | 3300049742 | Ga0501080_0690141 | Ga0501080_0690141_214_636 | 140 |
| 670 | 3300049743 | Ga0501081_0003182 | Ga0501081_0003182_8368_8793 | 140 |
| 671 | 3300049743 | Ga0501081_0004031 | Ga0501081_0004031_6694_7119 | 140 |
| 672 | 3300049743 | Ga0501081_0052950 | Ga0501081_0052950_834_1259 | 140 |
| 673 | 3300049743 | Ga0501081_0072865 | Ga0501081_0072865_904_1326 | 140 |
| 674 | 3300049743 | Ga0501081_0080845 | Ga0501081_0080845_1299_1724 | 140 |
| 675 | 3300049743 | Ga0501081_0082082 | Ga0501081_0082082_454_888 | 140 |
| 676 | 3300049743 | Ga0501081_0082694 | Ga0501081_0082694_375_797 | 140 |
| 677 | 3300049743 | Ga0501081_0193785 | Ga0501081_0193785_962_1387 | 140 |
| 678 | 3300049744 | Ga0501083_0040424 | Ga0501083_0040424_1605_2030 | 140 |
| 679 | 3300049744 | Ga0501083_0459500 | Ga0501083_0459500_319_741 | 140 |
| 680 | 3300049767 | Ga0501270_065601 | Ga0501270_065601_150_572 | 140 |
| 681 | 3300049822 | Ga0501035_0281278 | Ga0501035_0281278_19_444 | 140 |
| 682 | 3300049822 | Ga0501035_0345517 | Ga0501035_0345517_51_476 | 140 |
| 683 | 3300049822 | Ga0501035_0405915 | Ga0501035_0405915_385_810 | 140 |
| 684 | 3300049822 | Ga0501035_1040239 | Ga0501035_1040239_122_544 | 140 |
| 685 | 3300049824 | Ga0501045_0000164 | Ga0501045_0000164_2762_3187 | 140 |
| 686 | 3300049824 | Ga0501045_0011986 | Ga0501045_0011986_3596_4021 | 140 |
| 687 | 3300049824 | Ga0501045_0042486 | Ga0501045_0042486_491_916 | 140 |
| 688 | 3300049824 | Ga0501045_0119512 | Ga0501045_0119512_10_432 | 140 |
| 689 | 3300049824 | Ga0501045_0141088 | Ga0501045_0141088_1238_1663 | 140 |
| 690 | 3300049824 | Ga0501045_0234833 | Ga0501045_0234833_194_619 | 140 |
| 691 | 3300049824 | Ga0501045_0879036 | Ga0501045_0879036_125_547 | 140 |
| 692 | 3300049824 | Ga0501045_0937593 | Ga0501045_0937593_171_596 | 140 |
| 693 | 3300050507 | nmdc:mga05p37_1022399_c1 | nmdc:mga05p37_1022399_c1_395_820 | 140 |
| 694 | 3300050507 | nmdc:mga05p37_103698_c1 | nmdc:mga05p37_103698_c1_258_683 | 140 |
| 695 | 3300050507 | nmdc:mga05p37_108840_c1 | nmdc:mga05p37_108840_c1_799_1224 | 140 |
| 696 | 3300050507 | nmdc:mga05p37_23238_c1 | nmdc:mga05p37_23238_c1_7017_7439 | 140 |
| 697 | 3300050507 | nmdc:mga05p37_277605_c1 | nmdc:mga05p37_277605_c1_1031_1453 | 140 |
| 698 | 3300050507 | nmdc:mga05p37_29115_c1 | nmdc:mga05p37_29115_c1_4215_4640 | 140 |
| 699 | 3300050507 | nmdc:mga05p37_347650_c1 | nmdc:mga05p37_347650_c1_736_1158 | 140 |
| 700 | 3300050507 | nmdc:mga05p37_37550_c1 | nmdc:mga05p37_37550_c1_4348_4773 | 140 |
| 701 | 3300050507 | nmdc:mga05p37_5092_c2 | nmdc:mga05p37_5092_c2_12815_13240 | 140 |
| 702 | 3300050507 | nmdc:mga05p37_53887_c1 | nmdc:mga05p37_53887_c1_340_765 | 140 |
| 703 | 3300050507 | nmdc:mga05p37_623076_c1 | nmdc:mga05p37_623076_c1_155_580 | 140 |
| 704 | 3300050507 | nmdc:mga05p37_89_c1 | nmdc:mga05p37_89_c1_53521_53943 | 140 |
| 705 | 3300050508 | nmdc:mga09592_108401_c1 | nmdc:mga09592_108401_c1_1877_2302 | 140 |
| 706 | 3300050508 | nmdc:mga09592_15687_c1 | nmdc:mga09592_15687_c1_4059_4484 | 140 |
| 707 | 3300050508 | nmdc:mga09592_17102_c1 | nmdc:mga09592_17102_c1_4371_4796 | 140 |
| 708 | 3300050508 | nmdc:mga09592_2605_c1 | nmdc:mga09592_2605_c1_10230_10652 | 140 |
| 709 | 3300050508 | nmdc:mga09592_71083_c1 | nmdc:mga09592_71083_c1_2263_2685 | 140 |
| 710 | 3300050508 | nmdc:mga09592_837_c1 | nmdc:mga09592_837_c1_10161_10586 | 140 |
| 711 | 3300050509 | nmdc:mga0qj67_10750_c1 | nmdc:mga0qj67_10750_c1_4330_4755 | 140 |
| 712 | 3300050509 | nmdc:mga0qj67_422069_c1 | nmdc:mga0qj67_422069_c1_426_848 | 140 |
| 713 | 3300050509 | nmdc:mga0qj67_798_c1 | nmdc:mga0qj67_798_c1_1329_1754 | 140 |
| 714 | 3300050510 | nmdc:mga06r32_1241285_c1 | nmdc:mga06r32_1241285_c1_218_643 | 140 |
| 715 | 3300050510 | nmdc:mga06r32_173146_c1 | nmdc:mga06r32_173146_c1_899_1321 | 140 |
| 716 | 3300050510 | nmdc:mga06r32_23011_c1 | nmdc:mga06r32_23011_c1_1085_1510 | 140 |
| 717 | 3300050510 | nmdc:mga06r32_298402_c1 | nmdc:mga06r32_298402_c1_663_1085 | 140 |
| 718 | 3300050510 | nmdc:mga06r32_471585_c1 | nmdc:mga06r32_471585_c1_638_1063 | 140 |
| 719 | 3300050510 | nmdc:mga06r32_49155_c1 | nmdc:mga06r32_49155_c1_1294_1716 | 140 |
| 720 | 3300050510 | nmdc:mga06r32_708379_c1 | nmdc:mga06r32_708379_c1_202_624 | 140 |
| 721 | 3300050510 | nmdc:mga06r32_978023_c1 | nmdc:mga06r32_978023_c1_118_543 | 140 |
| 722 | 3300050511 | nmdc:mga08y16_267845_c1 | nmdc:mga08y16_267845_c1_1312_1737 | 140 |
| 723 | 3300050511 | nmdc:mga08y16_47030_c1 | nmdc:mga08y16_47030_c1_68_490 | 140 |
| 724 | 3300050511 | nmdc:mga08y16_725081_c1 | nmdc:mga08y16_725081_c1_444_869 | 140 |
| 725 | 3300050512 | nmdc:mga0n895_126244_c1 | nmdc:mga0n895_126244_c1_71_505 | 140 |
| 726 | 3300050512 | nmdc:mga0n895_1298947_c1 | nmdc:mga0n895_1298947_c1_15_440 | 140 |
| 727 | 3300050512 | nmdc:mga0n895_203_c1 | nmdc:mga0n895_203_c1_14297_14719 | 140 |
| 728 | 3300050512 | nmdc:mga0n895_255128_c1 | nmdc:mga0n895_255128_c1_1103_1525 | 140 |
| 729 | 3300050512 | nmdc:mga0n895_3372_c1 | nmdc:mga0n895_3372_c1_3247_3672 | 140 |
| 730 | 3300050512 | nmdc:mga0n895_3902_c1 | nmdc:mga0n895_3902_c1_4114_4539 | 140 |
| 731 | 3300050512 | nmdc:mga0n895_709770_c1 | nmdc:mga0n895_709770_c1_348_773 | 140 |
| 732 | 3300050513 | nmdc:mga0rr50_1089720_c1 | nmdc:mga0rr50_1089720_c1_63_497 | 140 |
| 733 | 3300050513 | nmdc:mga0rr50_12498_c1 | nmdc:mga0rr50_12498_c1_4328_4750 | 140 |
| 734 | 3300050513 | nmdc:mga0rr50_1444_c1 | nmdc:mga0rr50_1444_c1_4908_5333 | 140 |
| 735 | 3300050513 | nmdc:mga0rr50_2675_c1 | nmdc:mga0rr50_2675_c1_8133_8558 | 140 |
| 736 | 3300050513 | nmdc:mga0rr50_39170_c1 | nmdc:mga0rr50_39170_c1_1959_2384 | 140 |
| 737 | 3300050513 | nmdc:mga0rr50_694_c1 | nmdc:mga0rr50_694_c1_7655_8077 | 140 |
| 738 | 3300050513 | nmdc:mga0rr50_90198_c1 | nmdc:mga0rr50_90198_c1_125_550 | 140 |
| 739 | 3300050514 | nmdc:mga08x19_1359344_c1 | nmdc:mga08x19_1359344_c1_10_444 | 140 |
| 740 | 3300050514 | nmdc:mga08x19_4220_c1 | nmdc:mga08x19_4220_c1_8046_8471 | 140 |
| 741 | 3300050514 | nmdc:mga08x19_470_c1 | nmdc:mga08x19_470_c1_19945_20367 | 140 |
| 742 | 3300050514 | nmdc:mga08x19_78615_c1 | nmdc:mga08x19_78615_c1_1643_2068 | 140 |
| 743 | 3300050515 | nmdc:mga0a205_13883_c1 | nmdc:mga0a205_13883_c1_3839_4264 | 140 |
| 744 | 3300050515 | nmdc:mga0a205_28094_c1 | nmdc:mga0a205_28094_c1_4408_4833 | 140 |
| 745 | 3300050515 | nmdc:mga0a205_35751_c1 | nmdc:mga0a205_35751_c1_3513_3935 | 140 |
| 746 | 3300050515 | nmdc:mga0a205_51316_c1 | nmdc:mga0a205_51316_c1_2586_3008 | 140 |
| 747 | 3300050515 | nmdc:mga0a205_60390_c1 | nmdc:mga0a205_60390_c1_2604_3029 | 140 |
| 748 | 3300050515 | nmdc:mga0a205_753791_c1 | nmdc:mga0a205_753791_c1_268_693 | 140 |
| 749 | 3300050515 | nmdc:mga0a205_9939_c1 | nmdc:mga0a205_9939_c1_3175_3597 | 140 |
| 750 | 3300054114 | Ga0501084_0000300 | Ga0501084_0000300_31082_31507 | 140 |
| 751 | 3300054114 | Ga0501084_0003591 | Ga0501084_0003591_1064_1489 | 140 |
| 752 | 3300054114 | Ga0501084_0005651 | Ga0501084_0005651_3780_4205 | 140 |
| 753 | 3300054114 | Ga0501084_0255730 | Ga0501084_0255730_11_436 | 140 |
| 754 | 3300054114 | Ga0501084_0285265 | Ga0501084_0285265_737_1162 | 140 |
| 755 | 3300060353 | Ga0501082_0003847 | Ga0501082_0003847_8895_9320 | 140 |
| 756 | 3300060353 | Ga0501082_0012227 | Ga0501082_0012227_5089_5514 | 140 |
| 757 | 3300060353 | Ga0501082_0088114 | Ga0501082_0088114_1816_2241 | 140 |
| 758 | 3300060353 | Ga0501082_0143390 | Ga0501082_0143390_1297_1719 | 140 |
| 759 | 3300060353 | Ga0501082_0598533 | Ga0501082_0598533_503_925 | 140 |
| 760 | 3300060353 | Ga0501082_0993473 | Ga0501082_0993473_55_480 | 140 |
| 761 | 3300060353 | Ga0501082_1651940 | Ga0501082_1651940_59_484 | 140 |
| 762 | 3300060353 | Ga0501082_1743550 | Ga0501082_1743550_29_457 | 140 |
| 763 | 3300061734 | Ga0530510_0000015 | Ga0530510_0000015_73944_74369 | 140 |
| 764 | 3300061734 | Ga0530510_0007543 | Ga0530510_0007543_4896_5321 | 140 |
| 765 | 3300061734 | Ga0530510_0010173 | Ga0530510_0010173_1996_2424 | 140 |
| 766 | 3300061734 | Ga0530510_0010662 | Ga0530510_0010662_4481_4906 | 140 |
| 767 | 3300061734 | Ga0530510_0011887 | Ga0530510_0011887_3868_4293 | 140 |
| 768 | 3300061734 | Ga0530510_0021593 | Ga0530510_0021593_1444_1866 | 140 |
| 769 | 3300061734 | Ga0530510_0059640 | Ga0530510_0059640_954_1379 | 140 |
| 770 | 3300061734 | Ga0530510_0124071 | Ga0530510_0124071_608_1033 | 140 |
| 771 | 3300061734 | Ga0530510_0472423 | Ga0530510_0472423_329_754 | 140 |
| 772 | 3300061734 | Ga0530510_0672897 | Ga0530510_0672897_255_680 | 140 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ay1-assembly5.cif.gz_E | crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori | 0.9921 | 3 | 137 |
| 6ay1-assembly8.cif.gz_H | crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori | 0.9877 | 1 | 137 |
| 6ay1-assembly7.cif.gz_G | crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori | 0.9852 | 3 | 137 |
| 6aes-assembly2.cif.gz_B | crystal structure of nucleoside diphosphate kinase from pseudomonas aeruginosa at 3.55 a resolution. | 0.9839 | 1 | 140 |
| 3zto-assembly1.cif.gz_A | orthorhombic crystal form c222 of the aquifex aeolicus nucleoside diphosphate kinase | 0.9831 | 1 | 137 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6ay1G00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9852 | 3 | 137 | 3.30.70.141 |
| af_O88425_6_161_3.30.70.141 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.978 | 2 | 132 | 3.30.70.141 |
| 4w98A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9764 | 1 | 140 | 3.30.70.141 |
| af_A0A0G2L2L7_25_106_3.30.70.141 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9733 | 3 | 78 | 3.30.70.141 |
| af_C6T4F9_81_235_3.30.70.141 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9728 | 3 | 140 | 3.30.70.141 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N6EU76-F1-model_v4 | Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) | 1.002 | 3 | 137 |
GO:0004550
GO:0005524 GO:0005737 GO:0006183 GO:0006228 GO:0006241 GO:0046872 |
| AF-A0A3M2CU60-F1-model_v4 | Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) | 1.002 | 3 | 137 |
GO:0004550
GO:0005524 GO:0005737 GO:0006183 GO:0006228 GO:0006241 GO:0046872 |
| AF-A0A2V8JZB2-F1-model_v4 | Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) | 1.001 | 3 | 137 |
GO:0004550
GO:0005524 GO:0005737 GO:0006183 GO:0006228 GO:0006241 GO:0046872 |
| AF-A0A2V9HHJ3-F1-model_v4 | Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) | 1.001 | 1 | 137 |
GO:0004550
GO:0005524 GO:0005737 GO:0006183 GO:0006228 GO:0006241 GO:0046872 |
| AF-A0A3M1S670-F1-model_v4 | Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) | 1.001 | 3 | 137 |
GO:0004550
GO:0005524 GO:0005737 GO:0006183 GO:0006228 GO:0006241 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar