F480133

General Info

Members Datasets Scaffolds Average Seq Length
772 292 772 141

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0346609|Ga0501033_0346609_558_1028
Length 156
Sequence MAVERTLTIIKPDAVAKGVIGRIISRFEEAGLTIVAAQLVHLTAAQAAGFYVVHRDRPFYASLCAFMTQGPCLPMVLEGDNAIARLRELMGATNPAQAAPGTIRRDFASSIEANAVHGSDSPASAAFEIPYFFAAIDLGARPFTLDNPASRGSDLA

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
3 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
4 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
107 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
179 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
180 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
191 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
192 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
193 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
194 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
197 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
198 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
207 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
208 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
209 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
210 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
211 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
212 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
213 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
214 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
215 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
216 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
217 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
220 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
227 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
228 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
229 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
240 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
241 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
242 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
243 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
251 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
252 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
264 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
265 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
266 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
267 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
268 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
269 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
270 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
271 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
272 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
273 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
274 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
275 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
276 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
277 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
278 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
290 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
291 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
292 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.04
Rhizosphere 98.7
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10003938 3300003203 Bacteria 6941
2 JGI26128J50194_1001745 3300003347 Bacteria 1401
3 JGI26129J50193_1002186 3300003349 Bacteria 1370
4 JGI26145J50221_1004190 3300003371 Bacteria 1164
5 Ga0065704_10300065 3300005289 Bacteria 870
6 Ga0065707_10189561 3300005295 Bacteria 1369
7 Ga0070676_10072020 3300005328 Bacteria 2077
8 Ga0070676_10403122 3300005328 Bacteria 952
9 Ga0070690_100099974 3300005330 Bacteria 1922
10 Ga0070690_100348285 3300005330 Bacteria 1075
11 Ga0070670_100001558 3300005331 Bacteria 18473
12 Ga0070670_100397997 3300005331 Bacteria 1215
13 Ga0070677_10085365 3300005333 Bacteria 1361
14 Ga0070677_10176291 3300005333 Bacteria 1015
15 Ga0068869_100000795 3300005334 Bacteria 18019
16 Ga0068869_100002588 3300005334 Bacteria 10924
17 Ga0070666_10222011 3300005335 Bacteria 1333
18 Ga0070680_100022284 3300005336 Bacteria 5043
19 Ga0070680_100041507 3300005336 Bacteria 3730
20 Ga0070682_100000179 3300005337 Bacteria 47429
21 Ga0070660_100000476 3300005339 Bacteria 26750
22 Ga0070689_100117769 3300005340 Bacteria 2119
23 Ga0070691_10002169 3300005341 Bacteria 8686
24 Ga0070691_10004078 3300005341 Bacteria 6624
25 Ga0070691_10014775 3300005341 Bacteria 3584
26 Ga0070687_100053925 3300005343 Bacteria 2093
27 Ga0070661_100003535 3300005344 Bacteria 10766
28 Ga0070668_100647689 3300005347 Bacteria 928
29 Ga0070669_100754242 3300005353 Bacteria 825
30 Ga0070669_101400303 3300005353 Bacteria 607
31 Ga0070669_101702722 3300005353 Bacteria 550
32 Ga0070673_100069126 3300005364 Bacteria 2830
33 Ga0070673_100437437 3300005364 Bacteria 1175
34 Ga0070688_100575453 3300005365 Bacteria 859
35 Ga0070659_100000831 3300005366 Bacteria 22519
36 Ga0070703_10001108 3300005406 Bacteria 8360
37 Ga0070703_10200434 3300005406 Bacteria 783
38 Ga0070709_10239346 3300005434 Bacteria 1303
39 Ga0070714_100089998 3300005435 Bacteria 2687
40 Ga0070713_101273668 3300005436 Bacteria 712
41 Ga0070701_10003890 3300005438 Bacteria 5963
42 Ga0070711_100043201 3300005439 Bacteria 3051
43 Ga0070705_100020219 3300005440 Bacteria 3519
44 Ga0070705_100087499 3300005440 Bacteria 1931
45 Ga0070700_100282179 3300005441 Bacteria 1204
46 Ga0070700_101773915 3300005441 Bacteria 531
47 Ga0070694_100009346 3300005444 Bacteria 6017
48 Ga0070694_100020836 3300005444 Bacteria 4184
49 Ga0070694_100161703 3300005444 Bacteria 1643
50 Ga0070694_100488871 3300005444 Bacteria 978
51 Ga0070694_101007338 3300005444 Bacteria 692
52 Ga0070708_100004603 3300005445 Bacteria 10860
53 Ga0070708_100006589 3300005445 Bacteria 9242
54 Ga0070708_100034392 3300005445 Bacteria 4409
55 Ga0070708_100085159 3300005445 Bacteria 2868
56 Ga0070708_100125603 3300005445 Bacteria 2371
57 Ga0070708_100131633 3300005445 Bacteria 2315
58 Ga0070708_100260968 3300005445 Bacteria 1628
59 Ga0070708_100266552 3300005445 Bacteria 1610
60 Ga0070708_100453768 3300005445 Bacteria 1209
61 Ga0070708_100503594 3300005445 Bacteria 1142
62 Ga0070708_101674497 3300005445 Bacteria 591
63 Ga0070708_101839302 3300005445 Unclassified 562
64 Ga0070663_100004633 3300005455 Bacteria 8098
65 Ga0070662_100007466 3300005457 Bacteria 7087
66 Ga0070662_100019598 3300005457 Bacteria 4594
67 Ga0068867_100000455 3300005459 Bacteria 27140
68 Ga0070706_100044301 3300005467 Bacteria 4110
69 Ga0070706_100055848 3300005467 Bacteria 3645
70 Ga0070706_100061105 3300005467 Bacteria 3479
71 Ga0070706_100098679 3300005467 Bacteria 2714
72 Ga0070706_100231284 3300005467 Bacteria 1726
73 Ga0070706_100300795 3300005467 Bacteria 1497
74 Ga0070706_100311721 3300005467 Bacteria 1468
75 Ga0070706_100362363 3300005467 Bacteria 1351
76 Ga0070706_101299873 3300005467 Bacteria 667
77 Ga0070707_100000653 3300005468 Bacteria 34576
78 Ga0070707_100002097 3300005468 Bacteria 19110
79 Ga0070707_100007614 3300005468 Bacteria 10056
80 Ga0070707_100090616 3300005468 Bacteria 2959
81 Ga0070707_100160597 3300005468 Bacteria 2190
82 Ga0070707_100174924 3300005468 Bacteria 2092
83 Ga0070707_100188393 3300005468 Bacteria 2011
84 Ga0070707_100195256 3300005468 Bacteria 1973
85 Ga0070707_100901755 3300005468 Bacteria 848
86 Ga0070698_100000691 3300005471 Bacteria 36018
87 Ga0070698_100004796 3300005471 Bacteria 14846
88 Ga0070698_100014980 3300005471 Bacteria 8196
89 Ga0070698_100055478 3300005471 Bacteria 4017
90 Ga0070698_100059663 3300005471 Bacteria 3852
91 Ga0070698_100203970 3300005471 Bacteria 1912
92 Ga0070698_100447234 3300005471 Bacteria 1228
93 Ga0070698_100911742 3300005471 Bacteria 824
94 Ga0070698_101083046 3300005471 Bacteria 750
95 Ga0070698_101723082 3300005471 Bacteria 579
96 Ga0070699_100013216 3300005518 Bacteria 7118
97 Ga0070699_100030616 3300005518 Bacteria 4646
98 Ga0070699_100036410 3300005518 Bacteria 4257
99 Ga0070699_100045159 3300005518 Bacteria 3813
100 Ga0070699_100049254 3300005518 Bacteria 3647
101 Ga0070699_100337732 3300005518 Bacteria 1355
102 Ga0070699_100357162 3300005518 Bacteria 1317
103 Ga0070699_100841838 3300005518 Bacteria 840
104 Ga0070699_100947699 3300005518 Bacteria 789
105 Ga0070679_100037758 3300005530 Bacteria 4799
106 Ga0070684_100042713 3300005535 Bacteria 3915
107 Ga0070697_100016378 3300005536 Bacteria 5829
108 Ga0070697_100023819 3300005536 Bacteria 4873
109 Ga0070697_100095843 3300005536 Bacteria 2461
110 Ga0070697_100158015 3300005536 Bacteria 1914
111 Ga0070697_100251041 3300005536 Bacteria 1513
112 Ga0070697_100361715 3300005536 Bacteria 1254
113 Ga0070697_100385861 3300005536 Bacteria 1214
114 Ga0070697_100568403 3300005536 Bacteria 995
115 Ga0070697_101304356 3300005536 Bacteria 648
116 Ga0070697_101796079 3300005536 Bacteria 548
117 Ga0068853_100003324 3300005539 Bacteria 12308
118 Ga0070672_100051439 3300005543 Bacteria 3213
119 Ga0070686_100924816 3300005544 Bacteria 711
120 Ga0070695_100001891 3300005545 Bacteria 11838
121 Ga0070695_100137249 3300005545 Bacteria 1692
122 Ga0070695_100277788 3300005545 Bacteria 1229
123 Ga0070695_100608306 3300005545 Bacteria 859
124 Ga0070695_100827942 3300005545 Bacteria 743
125 Ga0070695_101241927 3300005545 Bacteria 614
126 Ga0070696_100007948 3300005546 Bacteria 7082
127 Ga0070696_100011958 3300005546 Bacteria 5817
128 Ga0070696_100061448 3300005546 Bacteria 2628
129 Ga0070696_100066473 3300005546 Bacteria 2528
130 Ga0070696_100317632 3300005546 Bacteria 1198
131 Ga0070693_100010068 3300005547 Bacteria 4720
132 Ga0070693_100015387 3300005547 Bacteria 3938
133 Ga0070704_100001374 3300005549 Bacteria 12913
134 Ga0070704_100081158 3300005549 Bacteria 2388
135 Ga0070704_100169859 3300005549 Bacteria 1733
136 Ga0070704_100261988 3300005549 Bacteria 1425
137 Ga0068855_100000225 3300005563 Bacteria 72196
138 Ga0070664_100207701 3300005564 Bacteria 1749
139 Ga0068857_100036222 3300005577 Bacteria 4372
140 Ga0068857_100117893 3300005577 Bacteria 2389
141 Ga0068857_100263207 3300005577 Bacteria 1583
142 Ga0068854_100007476 3300005578 Bacteria 6981
143 Ga0068856_100001169 3300005614 Bacteria 27611
144 Ga0070702_100062811 3300005615 Bacteria 2166
145 Ga0068859_100509788 3300005617 Bacteria 1298
146 Ga0068864_100869366 3300005618 Bacteria 889
147 Ga0068866_10163854 3300005718 Bacteria 1299
148 Ga0068861_100007123 3300005719 Bacteria 7655
149 Ga0068870_10007719 3300005840 Bacteria 4809
150 Ga0068870_10272864 3300005840 Bacteria 1057
151 Ga0068863_100033502 3300005841 Bacteria 4894
152 Ga0068858_100113125 3300005842 Bacteria 2535
153 Ga0068858_100433959 3300005842 Bacteria 1264
154 Ga0068860_100001109 3300005843 Bacteria 29627
155 Ga0068860_100212652 3300005843 Bacteria 1876
156 Ga0068860_100403565 3300005843 Bacteria 1352
157 Ga0068862_100003750 3300005844 Bacteria 12958
158 Ga0068862_100342658 3300005844 Bacteria 1385
159 Ga0068862_100456991 3300005844 Bacteria 1205
160 Ga0068862_100869224 3300005844 Bacteria 885
161 Ga0081455_10001810 3300005937 Bacteria 25776
162 Ga0081540_1024694 3300005983 Bacteria 3481
163 Ga0081539_10000005 3300005985 Bacteria 549026
164 Ga0075432_10024616 3300006058 Bacteria 2064
165 Ga0075432_10134811 3300006058 Bacteria 938
166 Ga0075432_10340225 3300006058 Bacteria 633
167 Ga0070715_10650925 3300006163 Bacteria 624
168 Ga0068871_100999311 3300006358 Bacteria 779
169 Ga0075428_100000924 3300006844 Bacteria 31024
170 Ga0075428_100001380 3300006844 Bacteria 25833
171 Ga0075428_100005362 3300006844 Bacteria 14256
172 Ga0075428_100037258 3300006844 Bacteria 5355
173 Ga0075428_100579952 3300006844 Bacteria 1198
174 Ga0075428_100884197 3300006844 Bacteria 948
175 Ga0075428_101050823 3300006844 Bacteria 861
176 Ga0075430_100000487 3300006846 Bacteria 29740
177 Ga0075430_100245726 3300006846 Bacteria 1483
178 Ga0075431_100002180 3300006847 Bacteria 18719
179 Ga0075431_100005577 3300006847 Bacteria 12425
180 Ga0075431_100044298 3300006847 Bacteria 4590
181 Ga0075431_100178495 3300006847 Bacteria 2180
182 Ga0075431_100198080 3300006847 Bacteria 2056
183 Ga0075431_100285247 3300006847 Bacteria 1671
184 Ga0075431_100386286 3300006847 Bacteria 1403
185 Ga0075431_100431648 3300006847 Bacteria 1315
186 Ga0075431_100844821 3300006847 Bacteria 887
187 Ga0075431_101266904 3300006847 Bacteria 699
188 Ga0075433_10006420 3300006852 Bacteria 9298
189 Ga0075433_10019706 3300006852 Bacteria 5627
190 Ga0075433_10030670 3300006852 Bacteria 4589
191 Ga0075433_10043087 3300006852 Bacteria 3917
192 Ga0075433_10050068 3300006852 Bacteria 3636
193 Ga0075433_10799416 3300006852 Bacteria 824
194 Ga0075433_10836521 3300006852 Bacteria 804
195 Ga0075434_100009447 3300006871 Bacteria 9091
196 Ga0075434_100019775 3300006871 Bacteria 6519
197 Ga0075434_100185055 3300006871 Bacteria 2103
198 Ga0075434_100268238 3300006871 Bacteria 1726
199 Ga0075434_100313380 3300006871 Bacteria 1589
200 Ga0075434_100322773 3300006871 Bacteria 1564
201 Ga0075434_100442550 3300006871 Bacteria 1321
202 Ga0075434_100659998 3300006871 Bacteria 1064
203 Ga0075434_100740616 3300006871 Bacteria 1000
204 Ga0075434_100754702 3300006871 Bacteria 990
205 Ga0075434_100781872 3300006871 Bacteria 971
206 Ga0075429_100000859 3300006880 Bacteria 23924
207 Ga0075429_100008092 3300006880 Bacteria 9139
208 Ga0075429_100020425 3300006880 Bacteria 5747
209 Ga0075429_100113445 3300006880 Bacteria 2369
210 Ga0075429_100455868 3300006880 Bacteria 1120
211 Ga0068865_100092831 3300006881 Bacteria 2194
212 Ga0068865_100139728 3300006881 Bacteria 1825
213 Ga0068865_100251966 3300006881 Bacteria 1394
214 Ga0068865_100648292 3300006881 Bacteria 897
215 Ga0075436_100001157 3300006914 Bacteria 17854
216 Ga0075436_100025186 3300006914 Bacteria 4092
217 Ga0075436_100078112 3300006914 Bacteria 2293
218 Ga0075436_100119904 3300006914 Bacteria 1840
219 Ga0097620_100509819 3300006931 Bacteria 1298
220 Ga0075435_100000661 3300007076 Bacteria 21221
221 Ga0075435_100007138 3300007076 Bacteria 7939
222 Ga0075435_100034638 3300007076 Bacteria 4002
223 Ga0075435_100037266 3300007076 Bacteria 3870
224 Ga0075435_100043704 3300007076 Bacteria 3587
225 Ga0075435_100077920 3300007076 Bacteria 2717
226 Ga0075435_100080674 3300007076 Bacteria 2672
227 Ga0075435_100114033 3300007076 Bacteria 2250
228 Ga0075435_100433984 3300007076 Bacteria 1132
229 Ga0099794_10013014 3300007265 Bacteria 3610
230 Ga0099794_10048892 3300007265 Bacteria 2031
231 Ga0099795_10579111 3300007788 Bacteria 532
232 Ga0111539_10018495 3300009094 Bacteria 8631
233 Ga0111539_10216404 3300009094 Bacteria 2231
234 Ga0111539_10301746 3300009094 Bacteria 1864
235 Ga0111539_10940847 3300009094 Bacteria 1005
236 Ga0111539_12317347 3300009094 Bacteria 623
237 Ga0105245_10200020 3300009098 Bacteria 1918
238 Ga0114129_10000115 3300009147 Bacteria 80576
239 Ga0114129_10000606 3300009147 Bacteria 44322
240 Ga0114129_10001631 3300009147 Bacteria 30466
241 Ga0114129_10044948 3300009147 Bacteria 6211
242 Ga0114129_10052378 3300009147 Bacteria 5727
243 Ga0114129_10099562 3300009147 Bacteria 4023
244 Ga0114129_10181958 3300009147 Bacteria 2859
245 Ga0114129_10296398 3300009147 Bacteria 2157
246 Ga0114129_10380919 3300009147 Bacteria 1863
247 Ga0114129_10473394 3300009147 Bacteria 1640
248 Ga0114129_10543133 3300009147 Bacteria 1512
249 Ga0114129_10638587 3300009147 Bacteria 1375
250 Ga0114129_10833734 3300009147 Bacteria 1174
251 Ga0114129_11939752 3300009147 Bacteria 713
252 Ga0105243_10007747 3300009148 Bacteria 8258
253 Ga0105243_10183874 3300009148 Bacteria 1820
254 Ga0105241_10171445 3300009174 Bacteria 1793
255 Ga0105241_10181111 3300009174 Bacteria 1748
256 Ga0105242_10144974 3300009176 Bacteria 2065
257 Ga0105237_10081739 3300009545 Bacteria 3222
258 Ga0105238_10640592 3300009551 Bacteria 1072
259 Ga0105249_10031638 3300009553 Bacteria 4786
260 Ga0105249_10328103 3300009553 Bacteria 1543
261 Ga0105249_10698852 3300009553 Bacteria 1074
262 Ga0105249_10759559 3300009553 Bacteria 1032
263 Ga0105249_10868964 3300009553 Bacteria 968
264 Ga0105249_13085990 3300009553 Bacteria 535
265 Ga0105239_11349287 3300010375 Bacteria 823
266 Ga0105246_10289229 3300011119 Bacteria 1318
267 Ga0157373_10000388 3300013100 Bacteria 35150
268 Ga0157371_10123835 3300013102 Bacteria 1839
269 Ga0157371_10807538 3300013102 Bacteria 707
270 Ga0157369_10109413 3300013105 Bacteria 2938
271 Ga0157378_10537610 3300013297 Bacteria 1172
272 Ga0157372_10000105 3300013307 Bacteria 88007
273 Ga0157372_10402152 3300013307 Bacteria 1596
274 Ga0157375_10295519 3300013308 Bacteria 1783
275 Ga0157380_10205551 3300014326 Bacteria 1751
276 Ga0182008_10038771 3300014497 Bacteria 2382
277 Ga0157377_10344437 3300014745 Bacteria 998
278 Ga0157379_10126211 3300014968 Bacteria 2302
279 Ga0182007_10202743 3300015262 Bacteria 694
280 Ga0182007_10218446 3300015262 Bacteria 673
281 Ga0206356_10921615 3300020070 Bacteria 851
282 Ga0206353_11152683 3300020082 Bacteria 1108
283 Ga0207653_10062032 3300025885 Bacteria 1263
284 Ga0207682_10106879 3300025893 Bacteria 1228
285 Ga0207682_10160133 3300025893 Bacteria 1019
286 Ga0207688_10038779 3300025901 Bacteria 2645
287 Ga0207680_10242575 3300025903 Bacteria 1242
288 Ga0207647_10130297 3300025904 Bacteria 1478
289 Ga0207685_10240848 3300025905 Bacteria 870
290 Ga0207699_10373815 3300025906 Bacteria 1010
291 Ga0207645_10005499 3300025907 Bacteria 9176
292 Ga0207643_10000329 3300025908 Bacteria 32532
293 Ga0207643_10058926 3300025908 Bacteria 2190
294 Ga0207643_10072224 3300025908 Bacteria 1987
295 Ga0207684_10000115 3300025910 Bacteria 149762
296 Ga0207684_10004217 3300025910 Bacteria 13644
297 Ga0207684_10012100 3300025910 Bacteria 7513
298 Ga0207684_10016655 3300025910 Bacteria 6312
299 Ga0207684_10041537 3300025910 Bacteria 3899
300 Ga0207684_10055055 3300025910 Bacteria 3375
301 Ga0207684_10075787 3300025910 Bacteria 2859
302 Ga0207684_10087362 3300025910 Bacteria 2657
303 Ga0207684_10114071 3300025910 Bacteria 2314
304 Ga0207684_10155793 3300025910 Bacteria 1966
305 Ga0207684_10314967 3300025910 Bacteria 1349
306 Ga0207684_10320745 3300025910 Bacteria 1335
307 Ga0207684_11492938 3300025910 Bacteria 550
308 Ga0207654_10004154 3300025911 Bacteria 7301
309 Ga0207654_10175934 3300025911 Bacteria 1393
310 Ga0207707_10000352 3300025912 Bacteria 48248
311 Ga0207671_10100012 3300025914 Bacteria 2195
312 Ga0207660_10000334 3300025917 Bacteria 30356
313 Ga0207660_10090303 3300025917 Bacteria 2269
314 Ga0207660_10350194 3300025917 Bacteria 1184
315 Ga0207662_10017645 3300025918 Bacteria 4039
316 Ga0207657_10002264 3300025919 Bacteria 20869
317 Ga0207649_10013687 3300025920 Bacteria 4533
318 Ga0207652_10000466 3300025921 Bacteria 41482
319 Ga0207646_10000250 3300025922 Bacteria 73162
320 Ga0207646_10008025 3300025922 Bacteria 10643
321 Ga0207646_10017586 3300025922 Bacteria 6683
322 Ga0207646_10030213 3300025922 Bacteria 4915
323 Ga0207646_10035173 3300025922 Bacteria 4525
324 Ga0207646_10162660 3300025922 Bacteria 2014
325 Ga0207646_10168402 3300025922 Bacteria 1978
326 Ga0207646_10201847 3300025922 Bacteria 1796
327 Ga0207646_10246117 3300025922 Bacteria 1615
328 Ga0207646_10532405 3300025922 Bacteria 1057
329 Ga0207646_10981408 3300025922 Bacteria 747
330 Ga0207646_11206851 3300025922 Unclassified 663
331 Ga0207681_10082617 3300025923 Bacteria 2271
332 Ga0207681_10240368 3300025923 Bacteria 1409
333 Ga0207681_11334407 3300025923 Bacteria 602
334 Ga0207681_11406862 3300025923 Bacteria 585
335 Ga0207694_10355091 3300025924 Bacteria 1214
336 Ga0207650_10268037 3300025925 Bacteria 1387
337 Ga0207690_10003653 3300025932 Bacteria 9163
338 Ga0207706_10008780 3300025933 Bacteria 9302
339 Ga0207706_10038603 3300025933 Bacteria 4236
340 Ga0207686_10099272 3300025934 Bacteria 1940
341 Ga0207709_10003271 3300025935 Bacteria 9720
342 Ga0207709_10366549 3300025935 Bacteria 1092
343 Ga0207709_11077258 3300025935 Bacteria 659
344 Ga0207670_10003001 3300025936 Bacteria 8909
345 Ga0207704_10588999 3300025938 Bacteria 909
346 Ga0207665_10010689 3300025939 Bacteria 6028
347 Ga0207691_10044338 3300025940 Bacteria 4095
348 Ga0207689_10003685 3300025942 Bacteria 13959
349 Ga0207689_10011582 3300025942 Bacteria 7556
350 Ga0207689_10054717 3300025942 Bacteria 3285
351 Ga0207661_10269170 3300025944 Bacteria 1520
352 Ga0207679_10000878 3300025945 Bacteria 19200
353 Ga0207679_10358722 3300025945 Bacteria 1272
354 Ga0207667_10000497 3300025949 Bacteria 51927
355 Ga0207651_11198234 3300025960 Bacteria 682
356 Ga0207712_10044142 3300025961 Bacteria 3079
357 Ga0207712_10353842 3300025961 Bacteria 1222
358 Ga0207712_10561970 3300025961 Bacteria 983
359 Ga0207712_10671043 3300025961 Bacteria 902
360 Ga0207668_10410578 3300025972 Bacteria 1147
361 Ga0207640_10009082 3300025981 Bacteria 5550
362 Ga0207658_10506765 3300025986 Bacteria 1076
363 Ga0207658_11569601 3300025986 Bacteria 602
364 Ga0207703_10085583 3300026035 Unclassified 2638
365 Ga0207639_10002384 3300026041 Bacteria 12612
366 Ga0207678_10054455 3300026067 Bacteria 3445
367 Ga0207708_10217137 3300026075 Bacteria 1531
368 Ga0207708_10707004 3300026075 Bacteria 862
369 Ga0207708_10790475 3300026075 Bacteria 816
370 Ga0207702_10008955 3300026078 Bacteria 8434
371 Ga0207648_10005839 3300026089 Bacteria 12327
372 Ga0207648_10115995 3300026089 Bacteria 2354
373 Ga0207648_11166398 3300026089 Bacteria 723
374 Ga0207676_10014367 3300026095 Bacteria 5695
375 Ga0207676_10960199 3300026095 Bacteria 841
376 Ga0207674_10000550 3300026116 Bacteria 49205
377 Ga0207674_10161954 3300026116 Bacteria 2191
378 Ga0207674_10629755 3300026116 Bacteria 1036
379 Ga0207675_100005709 3300026118 Bacteria 11909
380 Ga0207675_100267941 3300026118 Bacteria 1657
381 Ga0207675_100356310 3300026118 Bacteria 1434
382 Ga0209969_1010320 3300027360 Bacteria 1336
383 Ga0209967_1015709 3300027364 Bacteria 1084
384 Ga0209981_1012710 3300027378 Bacteria 1167
385 Ga0209996_1000987 3300027395 Bacteria 3383
386 Ga0210000_1001288 3300027462 Bacteria 3530
387 Ga0209995_1001479 3300027471 Bacteria 3625
388 Ga0209968_1005623 3300027526 Bacteria 1884
389 Ga0209968_1058298 3300027526 Bacteria 678
390 Ga0209999_1000243 3300027543 Bacteria 7873
391 Ga0209982_1000487 3300027552 Bacteria 4921
392 Ga0209970_1017224 3300027614 Bacteria 1209
393 Ga0210002_1033995 3300027617 Bacteria 854
394 Ga0209983_1000034 3300027665 Bacteria 19527
395 Ga0209588_1041569 3300027671 Bacteria 1484
396 Ga0209588_1111984 3300027671 Bacteria 876
397 Ga0209588_1156985 3300027671 Bacteria 719
398 Ga0209971_1000028 3300027682 Bacteria 53458
399 Ga0209971_1020061 3300027682 Bacteria 1588
400 Ga0209966_1000073 3300027695 Bacteria 44067
401 Ga0209998_10000001 3300027717 Bacteria 203589
402 Ga0209998_10017838 3300027717 Bacteria 1503
403 Ga0209998_10085113 3300027717 Bacteria 770
404 Ga0209974_10000369 3300027876 Bacteria 14852
405 Ga0207428_10355343 3300027907 Bacteria 1077
406 Ga0268265_10002923 3300028380 Bacteria 12524
407 Ga0268265_10136227 3300028380 Bacteria 2049
408 Ga0268265_10196008 3300028380 Bacteria 1748
409 Ga0268265_11144355 3300028380 Bacteria 774
410 Ga0268264_10182259 3300028381 Bacteria 1908
411 Ga0268264_10342083 3300028381 Bacteria 1421
412 Ga0268264_10758437 3300028381 Bacteria 967
413 Ga0307408_100049624 3300031548 Bacteria 3015
414 Ga0307408_100058377 3300031548 Bacteria 2805
415 Ga0307408_100105981 3300031548 Bacteria 2150
416 Ga0307408_100409067 3300031548 Bacteria 1167
417 Ga0307408_100685699 3300031548 Bacteria 919
418 Ga0307408_101107260 3300031548 Bacteria 735
419 Ga0316575_10093872 3300031665 Bacteria 1217
420 Ga0316579_10171936 3300031691 Bacteria 1047
421 Ga0316578_10007755 3300031728 Bacteria 5412
422 Ga0307405_10778720 3300031731 Bacteria 799
423 Ga0316577_10039459 3300031733 Bacteria 2641
424 Ga0307413_11716277 3300031824 Bacteria 560
425 Ga0307406_10423026 3300031901 Bacteria 1062
426 Ga0307406_10522711 3300031901 Bacteria 966
427 Ga0307407_10924550 3300031903 Bacteria 670
428 Ga0307412_10067622 3300031911 Bacteria 2427
429 Ga0307409_100055052 3300031995 Bacteria 3069
430 Ga0307409_100249842 3300031995 Bacteria 1621
431 Ga0307409_101084352 3300031995 Bacteria 822
432 Ga0307409_101402134 3300031995 Bacteria 725
433 Ga0307416_100116219 3300032002 Bacteria 2371
434 Ga0307416_100117613 3300032002 Bacteria 2360
435 Ga0307416_100364315 3300032002 Bacteria 1469
436 Ga0307416_100977422 3300032002 Bacteria 949
437 Ga0307411_10501390 3300032005 Bacteria 1026
438 Ga0373930_0025476 3300034816 Bacteria 1187
439 Ga0373929_0019492 3300035085 Bacteria 1359
440 Ga0373952_0012443 3300035092 Bacteria 1674
441 Ga0373939_0008845 3300035114 Bacteria 2480
442 Ga0373939_0121915 3300035114 Bacteria 921
443 Ga0373941_0137792 3300035115 Bacteria 885
444 Ga0373960_0017235 3300035121 Bacteria 1869
445 Ga0373946_0761397 3300035171 Bacteria 509
446 Ga0373942_0126126 3300035207 Bacteria 804
447 Ga0373961_0136875 3300035241 Bacteria 824
448 Ga0373931_0168586 3300035691 Bacteria 1288
449 Ga0373935_0136475 3300035692 Bacteria 1653
450 Ga0395899_0098186 3300037312 Bacteria 2116
451 Ga0395900_0158493 3300037418 Bacteria 2310
452 Ga0395900_0262037 3300037418 Bacteria 1726
453 Ga0395898_0068101 3300037466 Bacteria 3445
454 Ga0395898_0754785 3300037466 Bacteria 914
455 Ga0395905_0032845 3300037471 Bacteria 4879
456 Ga0395901_0003553 3300038443 Bacteria 15718
457 Ga0395901_0316283 3300038443 Bacteria 1616
458 Ga0400486_00771 3300038742 Bacteria 4504
459 Ga0451793_0606111 3300041452 Unclassified 711
460 Ga0451837_0530276 3300041494 Bacteria 1279
461 Ga0439441_014767 3300042001 Bacteria 1374
462 Ga0439448_0001340 3300042005 Bacteria 6305
463 Ga0439448_0050970 3300042005 Bacteria 1355
464 Ga0439450_014251 3300042008 Bacteria 1610
465 Ga0439455_0010262 3300042012 Bacteria 2056
466 Ga0439456_006513 3300042013 Bacteria 2386
467 Ga0450889_016641 3300042144 Bacteria 795
468 Ga0439459_0000265 3300042438 Bacteria 6158
469 Ga0439464_0001792 3300042439 Bacteria 5179
470 Ga0439460_0000935 3300042461 Bacteria 6679
471 Ga0451577_0005206 3300042876 Bacteria 13385
472 Ga0451577_0010038 3300042876 Bacteria 9071
473 Ga0451577_0196697 3300042876 Bacteria 1820
474 Ga0453683_0003008 3300044673 Bacteria 12624
475 Ga0453683_0013004 3300044673 Bacteria 5442
476 Ga0453684_0019511 3300044712 Bacteria 10315
477 Ga0453684_0202154 3300044712 Bacteria 2315
478 Ga0453684_1231168 3300044712 Bacteria 784
479 Ga0453684_1268941 3300044712 Bacteria 770
480 Ga0451576_0025605 3300045051 Bacteria 6354
481 Ga0451576_0071114 3300045051 Bacteria 3621
482 Ga0451576_0232246 3300045051 Bacteria 1926
483 Ga0451576_0258336 3300045051 Bacteria 1820
484 Ga0451576_0458466 3300045051 Bacteria 1338
485 Ga0451576_1028191 3300045051 Bacteria 863
486 Ga0451576_1112381 3300045051 Bacteria 826
487 Ga0451576_2035105 3300045051 Bacteria 591
488 Ga0495603_0552149 3300046455 Bacteria 660
489 Ga0495629_0000050 3300046459 Bacteria 107147
490 Ga0495580_0005633 3300046472 Bacteria 10302
491 Ga0495580_0057095 3300046472 Bacteria 2748
492 Ga0495582_0007310 3300046473 Bacteria 6120
493 Ga0495584_0301533 3300046491 Bacteria 814
494 Ga0495594_0005225 3300046499 Bacteria 6674
495 Ga0495618_0358146 3300046514 Bacteria 898
496 Ga0495642_0123655 3300046528 Bacteria 1111
497 Ga0495640_0021775 3300046533 Bacteria 4696
498 Ga0495586_0129461 3300046535 Bacteria 1413
499 Ga0495635_0000198 3300046663 Bacteria 37966
500 Ga0495659_0092071 3300046664 Bacteria 1165
501 Ga0495659_0104214 3300046664 Bacteria 1102
502 Ga0495658_0000191 3300046683 Bacteria 35464
503 Ga0495669_0086886 3300046684 Bacteria 1440
504 Ga0495669_0319428 3300046684 Bacteria 749
505 Ga0495613_0044191 3300046689 Bacteria 3296
506 Ga0495624_0688519 3300046690 Bacteria 607
507 Ga0495581_0000279 3300047315 Bacteria 24784
508 Ga0495636_0244510 3300047318 Bacteria 828
509 Ga0495676_0141288 3300047321 Bacteria 1725
510 Ga0495680_0000465 3300047322 Bacteria 45569
511 Ga0495593_0080010 3300047673 Bacteria 1691
512 Ga0495614_0003921 3300048089 Bacteria 6683
513 Ga0496102_0038621 3300048905 Bacteria 4310
514 Ga0496102_0400327 3300048905 Bacteria 1291
515 Ga0496104_0398697 3300048907 Bacteria 1288
516 Ga0496106_0070068 3300048909 Bacteria 2678
517 Ga0496107_0422369 3300048910 Bacteria 991
518 Ga0496109_0713502 3300048912 Bacteria 940
519 Ga0496112_0139340 3300048915 Bacteria 2395
520 Ga0501292_029677 3300049515 Bacteria 915
521 Ga0501298_050962 3300049521 Bacteria 859
522 Ga0501033_0038328 3300049570 Bacteria 3585
523 Ga0501033_0294784 3300049570 Bacteria 1143
524 Ga0501033_0346609 3300049570 Bacteria 1041
525 Ga0501033_0360772 3300049570 Bacteria 1017
526 Ga0501033_0399332 3300049570 Bacteria 959
527 Ga0501036_0008473 3300049572 Bacteria 8427
528 Ga0501036_0029734 3300049572 Bacteria 4616
529 Ga0501036_0137721 3300049572 Bacteria 2060
530 Ga0501036_0143053 3300049572 Bacteria 2018
531 Ga0501036_0289350 3300049572 Bacteria 1371
532 Ga0501036_0503945 3300049572 Bacteria 1007
533 Ga0501036_1683040 3300049572 Bacteria 511
534 Ga0501037_0122149 3300049573 Bacteria 1872
535 Ga0501037_0360271 3300049573 Bacteria 1002
536 Ga0501037_0693477 3300049573 Bacteria 678
537 Ga0501038_0008826 3300049574 Bacteria 9247
538 Ga0501038_0098642 3300049574 Bacteria 2436
539 Ga0501038_0142802 3300049574 Bacteria 1957
540 Ga0501038_0790779 3300049574 Bacteria 705
541 Ga0501039_0006761 3300049575 Bacteria 8728
542 Ga0501039_0028057 3300049575 Bacteria 4330
543 Ga0501039_0226156 3300049575 Bacteria 1471
544 Ga0501039_0438744 3300049575 Bacteria 1025
545 Ga0501039_0496101 3300049575 Bacteria 959
546 Ga0501039_0859626 3300049575 Bacteria 707
547 Ga0501039_0930980 3300049575 Unclassified 676
548 Ga0501040_0006783 3300049576 Bacteria 7424
549 Ga0501040_0024123 3300049576 Bacteria 4081
550 Ga0501040_0042354 3300049576 Bacteria 3101
551 Ga0501040_0046392 3300049576 Bacteria 2966
552 Ga0501040_0131181 3300049576 Bacteria 1762
553 Ga0501040_0731066 3300049576 Bacteria 716
554 Ga0501041_0014008 3300049577 Bacteria 4758
555 Ga0501041_0015706 3300049577 Bacteria 4497
556 Ga0501041_0024893 3300049577 Bacteria 3595
557 Ga0501041_0119263 3300049577 Bacteria 1639
558 Ga0501041_0122637 3300049577 Bacteria 1616
559 Ga0501041_0181516 3300049577 Bacteria 1317
560 Ga0501041_0198808 3300049577 Bacteria 1256
561 Ga0501041_0833353 3300049577 Unclassified 592
562 Ga0501042_0007483 3300049578 Bacteria 7156
563 Ga0501042_0055319 3300049578 Bacteria 2831
564 Ga0501042_0102109 3300049578 Bacteria 2063
565 Ga0501042_0175713 3300049578 Bacteria 1545
566 Ga0501042_0542254 3300049578 Bacteria 845
567 Ga0501042_1138061 3300049578 Bacteria 569
568 Ga0501043_0103412 3300049579 Bacteria 2238
569 Ga0501043_0553562 3300049579 Bacteria 854
570 Ga0501043_1268852 3300049579 Bacteria 515
571 Ga0501046_0006426 3300049580 Bacteria 10418
572 Ga0501046_0018987 3300049580 Bacteria 5707
573 Ga0501046_0078313 3300049580 Bacteria 2557
574 Ga0501046_0100534 3300049580 Bacteria 2219
575 Ga0501046_0213903 3300049580 Bacteria 1430
576 Ga0501048_0021736 3300049582 Bacteria 4695
577 Ga0501048_0078325 3300049582 Bacteria 2332
578 Ga0501048_0130757 3300049582 Bacteria 1775
579 Ga0501048_0133623 3300049582 Bacteria 1753
580 Ga0501048_0292418 3300049582 Bacteria 1159
581 Ga0501048_0674724 3300049582 Bacteria 742
582 Ga0501048_1080280 3300049582 Bacteria 577
583 Ga0501067_0154006 3300049583 Bacteria 1281
584 Ga0501067_0541524 3300049583 Bacteria 652
585 Ga0501068_0033097 3300049584 Bacteria 3077
586 Ga0501068_0071879 3300049584 Bacteria 2112
587 Ga0501068_0082028 3300049584 Bacteria 1980
588 Ga0501069_0290997 3300049585 Bacteria 957
589 Ga0501071_0107335 3300049587 Bacteria 2062
590 Ga0501071_0124133 3300049587 Bacteria 1915
591 Ga0501072_0018561 3300049588 Bacteria 5360
592 Ga0501072_0028643 3300049588 Bacteria 4348
593 Ga0501072_0045219 3300049588 Bacteria 3461
594 Ga0501072_0101298 3300049588 Bacteria 2289
595 Ga0501072_0128520 3300049588 Bacteria 2019
596 Ga0501072_0359228 3300049588 Bacteria 1156
597 Ga0501072_0360289 3300049588 Bacteria 1154
598 Ga0501072_0437841 3300049588 Bacteria 1036
599 Ga0501072_0484509 3300049588 Bacteria 978
600 Ga0501072_0503136 3300049588 Bacteria 958
601 Ga0501072_1598324 3300049588 Bacteria 502
602 Ga0501073_0555769 3300049589 Bacteria 793
603 Ga0501074_0010060 3300049590 Bacteria 6866
604 Ga0501074_0089779 3300049590 Bacteria 2201
605 Ga0501074_0684644 3300049590 Bacteria 724
606 Ga0501075_0000122 3300049591 Bacteria 37780
607 Ga0501075_0036490 3300049591 Bacteria 3669
608 Ga0501075_0049544 3300049591 Bacteria 3157
609 Ga0501075_0056627 3300049591 Bacteria 2951
610 Ga0501075_0060695 3300049591 Bacteria 2849
611 Ga0501075_0106630 3300049591 Bacteria 2129
612 Ga0501075_0122974 3300049591 Bacteria 1975
613 Ga0501075_0201147 3300049591 Bacteria 1519
614 Ga0501075_0349403 3300049591 Bacteria 1127
615 Ga0501075_0479799 3300049591 Bacteria 948
616 Ga0501075_0593594 3300049591 Bacteria 845
617 Ga0501076_0000012 3300049592 Bacteria 113396
618 Ga0501076_0002878 3300049592 Bacteria 11918
619 Ga0501076_0077598 3300049592 Bacteria 2665
620 Ga0501076_0136162 3300049592 Bacteria 1994
621 Ga0501076_0148285 3300049592 Bacteria 1908
622 Ga0501076_0173942 3300049592 Bacteria 1755
623 Ga0501076_0283450 3300049592 Bacteria 1357
624 Ga0501076_0558068 3300049592 Bacteria 944
625 Ga0501076_0611806 3300049592 Bacteria 899
626 Ga0501076_1277826 3300049592 Bacteria 604
627 Ga0501077_0007666 3300049593 Bacteria 6660
628 Ga0501077_0033134 3300049593 Bacteria 3289
629 Ga0501077_0045888 3300049593 Bacteria 2776
630 Ga0501077_0067838 3300049593 Bacteria 2261
631 Ga0501077_0086210 3300049593 Bacteria 1991
632 Ga0501077_0095346 3300049593 Bacteria 1886
633 Ga0501077_0489828 3300049593 Bacteria 788
634 Ga0501077_0509656 3300049593 Unclassified 771
635 Ga0501077_0887102 3300049593 Bacteria 574
636 Ga0501079_0001408 3300049741 Bacteria 16936
637 Ga0501079_0008164 3300049741 Bacteria 7935
638 Ga0501079_0028593 3300049741 Bacteria 4279
639 Ga0501079_0061478 3300049741 Bacteria 2897
640 Ga0501079_0073083 3300049741 Bacteria 2651
641 Ga0501079_0076362 3300049741 Bacteria 2591
642 Ga0501079_0086560 3300049741 Bacteria 2425
643 Ga0501079_0102595 3300049741 Bacteria 2218
644 Ga0501079_0159600 3300049741 Bacteria 1758
645 Ga0501079_0172787 3300049741 Bacteria 1685
646 Ga0501079_0737754 3300049741 Bacteria 775
647 Ga0501080_0033964 3300049742 Bacteria 4762
648 Ga0501080_0060392 3300049742 Bacteria 3529
649 Ga0501080_0073226 3300049742 Bacteria 3187
650 Ga0501080_0209044 3300049742 Bacteria 1789
651 Ga0501080_0224668 3300049742 Bacteria 1717
652 Ga0501080_0300936 3300049742 Bacteria 1455
653 Ga0501080_0399135 3300049742 Bacteria 1237
654 Ga0501080_0576758 3300049742 Bacteria 1000
655 Ga0501080_0690141 3300049742 Bacteria 901
656 Ga0501081_0003182 3300049743 Bacteria 10436
657 Ga0501081_0004031 3300049743 Bacteria 9420
658 Ga0501081_0052950 3300049743 Bacteria 2801
659 Ga0501081_0072865 3300049743 Bacteria 2395
660 Ga0501081_0080845 3300049743 Bacteria 2275
661 Ga0501081_0082082 3300049743 Bacteria 2258
662 Ga0501081_0082694 3300049743 Bacteria 2250
663 Ga0501081_0193785 3300049743 Bacteria 1472
664 Ga0501081_1327806 3300049743 Bacteria 545
665 Ga0501083_0040424 3300049744 Bacteria 3165
666 Ga0501083_0459500 3300049744 Bacteria 829
667 Ga0501270_065601 3300049767 Bacteria 691
668 Ga0501035_0281278 3300049822 Bacteria 1406
669 Ga0501035_0345517 3300049822 Bacteria 1246
670 Ga0501035_0405915 3300049822 Bacteria 1133
671 Ga0501035_1040239 3300049822 Bacteria 642
672 Ga0501045_0000164 3300049824 Bacteria 36415
673 Ga0501045_0011986 3300049824 Bacteria 6095
674 Ga0501045_0042486 3300049824 Bacteria 3308
675 Ga0501045_0119512 3300049824 Bacteria 1956
676 Ga0501045_0141088 3300049824 Bacteria 1792
677 Ga0501045_0234833 3300049824 Bacteria 1365
678 Ga0501045_0879036 3300049824 Bacteria 659
679 Ga0501045_0937593 3300049824 Bacteria 636
680 nmdc:mga05p37_1022399_c1 3300050507 Bacteria 875
681 nmdc:mga05p37_103698_c1 3300050507 Bacteria 3500
682 nmdc:mga05p37_108840_c1 3300050507 Bacteria 3409
683 nmdc:mga05p37_23238_c1 3300050507 Bacteria 7520
684 nmdc:mga05p37_277605_c1 3300050507 Bacteria 2000
685 nmdc:mga05p37_29115_c1 3300050507 Bacteria 6740
686 nmdc:mga05p37_347650_c1 3300050507 Bacteria 1747
687 nmdc:mga05p37_37550_c1 3300050507 Bacteria 5939
688 nmdc:mga05p37_385517_c1 3300050507 Bacteria 1641
689 nmdc:mga05p37_5092_c2 3300050507 Bacteria 15026
690 nmdc:mga05p37_53887_c1 3300050507 Bacteria 4948
691 nmdc:mga05p37_623076_c1 3300050507 Bacteria 1214
692 nmdc:mga05p37_89_c1 3300050507 Bacteria 81482
693 nmdc:mga09592_108401_c1 3300050508 Bacteria 2382
694 nmdc:mga09592_15687_c1 3300050508 Bacteria 6190
695 nmdc:mga09592_17102_c1 3300050508 Bacteria 5937
696 nmdc:mga09592_2605_c1 3300050508 Bacteria 14598
697 nmdc:mga09592_548362_c1 3300050508 Bacteria 993
698 nmdc:mga09592_71083_c1 3300050508 Bacteria 2954
699 nmdc:mga09592_837_c1 3300050508 Bacteria 23885
700 nmdc:mga0qj67_10750_c1 3300050509 Bacteria 6843
701 nmdc:mga0qj67_422069_c1 3300050509 Bacteria 1075
702 nmdc:mga0qj67_798_c1 3300050509 Bacteria 21472
703 nmdc:mga06r32_1241285_c1 3300050510 Bacteria 691
704 nmdc:mga06r32_173146_c1 3300050510 Bacteria 2143
705 nmdc:mga06r32_23011_c1 3300050510 Bacteria 5764
706 nmdc:mga06r32_298402_c1 3300050510 Bacteria 1597
707 nmdc:mga06r32_471585_c1 3300050510 Bacteria 1234
708 nmdc:mga06r32_49155_c1 3300050510 Bacteria 4032
709 nmdc:mga06r32_708379_c1 3300050510 Bacteria 972
710 nmdc:mga06r32_978023_c1 3300050510 Bacteria 800
711 nmdc:mga08y16_267845_c1 3300050511 Bacteria 1764
712 nmdc:mga08y16_47030_c1 3300050511 Bacteria 4517
713 nmdc:mga08y16_725081_c1 3300050511 Bacteria 992
714 nmdc:mga0n895_126244_c1 3300050512 Bacteria 2582
715 nmdc:mga0n895_1298947_c1 3300050512 Bacteria 699
716 nmdc:mga0n895_203_c1 3300050512 Bacteria 21253
717 nmdc:mga0n895_229431_c1 3300050512 Bacteria 1885
718 nmdc:mga0n895_255128_c1 3300050512 Bacteria 1780
719 nmdc:mga0n895_27710_c1 3300050512 Bacteria 5385
720 nmdc:mga0n895_3372_c1 3300050512 Bacteria 12849
721 nmdc:mga0n895_3902_c1 3300050512 Bacteria 12115
722 nmdc:mga0n895_709770_c1 3300050512 Bacteria 1001
723 nmdc:mga0n895_721271_c1 3300050512 Bacteria 992
724 nmdc:mga0rr50_1089720_c1 3300050513 Bacteria 680
725 nmdc:mga0rr50_1223684_c1 3300050513 Bacteria 638
726 nmdc:mga0rr50_12498_c1 3300050513 Bacteria 5492
727 nmdc:mga0rr50_1444_c1 3300050513 Bacteria 13081
728 nmdc:mga0rr50_181799_c1 3300050513 Bacteria 1719
729 nmdc:mga0rr50_2675_c1 3300050513 Bacteria 10093
730 nmdc:mga0rr50_39170_c1 3300050513 Bacteria 3436
731 nmdc:mga0rr50_484218_c1 3300050513 Bacteria 1051
732 nmdc:mga0rr50_694_c1 3300050513 Bacteria 18015
733 nmdc:mga0rr50_90198_c1 3300050513 Bacteria 2385
734 nmdc:mga08x19_1359344_c1 3300050514 Bacteria 503
735 nmdc:mga08x19_4220_c1 3300050514 Bacteria 8518
736 nmdc:mga08x19_470_c1 3300050514 Bacteria 27216
737 nmdc:mga08x19_526843_c1 3300050514 Bacteria 835
738 nmdc:mga08x19_78615_c1 3300050514 Bacteria 2162
739 nmdc:mga0a205_127735_c1 3300050515 Bacteria 2442
740 nmdc:mga0a205_13883_c1 3300050515 Bacteria 7510
741 nmdc:mga0a205_28094_c1 3300050515 Bacteria 5376
742 nmdc:mga0a205_35751_c1 3300050515 Bacteria 4771
743 nmdc:mga0a205_51316_c1 3300050515 Bacteria 3982
744 nmdc:mga0a205_60390_c1 3300050515 Bacteria 3662
745 nmdc:mga0a205_753791_c1 3300050515 Bacteria 822
746 nmdc:mga0a205_9939_c1 3300050515 Bacteria 8729
747 Ga0495619_0005167 3300053085 Bacteria 8284
748 Ga0501084_0000300 3300054114 Bacteria 37454
749 Ga0501084_0003591 3300054114 Bacteria 12591
750 Ga0501084_0005651 3300054114 Bacteria 10267
751 Ga0501084_0255730 3300054114 Bacteria 1478
752 Ga0501084_0285265 3300054114 Bacteria 1394
753 Ga0501082_0003847 3300060353 Bacteria 13126
754 Ga0501082_0012227 3300060353 Bacteria 7376
755 Ga0501082_0088114 3300060353 Bacteria 2678
756 Ga0501082_0143390 3300060353 Bacteria 2073
757 Ga0501082_0571210 3300060353 Bacteria 989
758 Ga0501082_0598533 3300060353 Bacteria 965
759 Ga0501082_0993473 3300060353 Bacteria 734
760 Ga0501082_1651940 3300060353 Bacteria 559
761 Ga0501082_1743550 3300060353 Bacteria 543
762 Ga0530510_0000015 3300061734 Bacteria 104554
763 Ga0530510_0007543 3300061734 Bacteria 7577
764 Ga0530510_0010173 3300061734 Bacteria 6593
765 Ga0530510_0010662 3300061734 Bacteria 6447
766 Ga0530510_0011887 3300061734 Bacteria 6109
767 Ga0530510_0021593 3300061734 Bacteria 4580
768 Ga0530510_0059640 3300061734 Bacteria 2760
769 Ga0530510_0124071 3300061734 Bacteria 1897
770 Ga0530510_0467361 3300061734 Bacteria 955
771 Ga0530510_0472423 3300061734 Bacteria 949
772 Ga0530510_0672897 3300061734 Bacteria 788

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025908 Ga0207643_10072224 Ga0207643_100722242 125
2 3300025945 Ga0207679_10358722 Ga0207679_103587223 125
3 3300050512 nmdc:mga0n895_229431_c1 nmdc:mga0n895_229431_c1_11_388 125
4 3300006844 Ga0075428_100037258 Ga0075428_1000372584 127
5 3300006880 Ga0075429_100455868 Ga0075429_1004558682 127
6 3300050508 nmdc:mga09592_548362_c1 nmdc:mga09592_548362_c1_479_895 127
7 3300006847 Ga0075431_100386286 Ga0075431_1003862861 129
8 3300049573 Ga0501037_0360271 Ga0501037_0360271_404_814 135
9 3300049593 Ga0501077_0067838 Ga0501077_0067838_17_424 135
10 3300005328 Ga0070676_10072020 Ga0070676_100720203 138
11 3300005331 Ga0070670_100397997 Ga0070670_1003979972 138
12 3300005333 Ga0070677_10176291 Ga0070677_101762912 138
13 3300005364 Ga0070673_100069126 Ga0070673_1000691264 138
14 3300005365 Ga0070688_100575453 Ga0070688_1005754531 138
15 3300005544 Ga0070686_100924816 Ga0070686_1009248161 138
16 3300005618 Ga0068864_100869366 Ga0068864_1008693662 138
17 3300006058 Ga0075432_10340225 Ga0075432_103402252 138
18 3300006852 Ga0075433_10836521 Ga0075433_108365212 138
19 3300006871 Ga0075434_100322773 Ga0075434_1003227732 138
20 3300006871 Ga0075434_100442550 Ga0075434_1004425502 138
21 3300006871 Ga0075434_100754702 Ga0075434_1007547022 138
22 3300006881 Ga0068865_100648292 Ga0068865_1006482922 138
23 3300006914 Ga0075436_100025186 Ga0075436_1000251862 138
24 3300007076 Ga0075435_100077920 Ga0075435_1000779202 138
25 3300007076 Ga0075435_100114033 Ga0075435_1001140333 138
26 3300009094 Ga0111539_10301746 Ga0111539_103017462 138
27 3300009147 Ga0114129_10296398 Ga0114129_102963983 138
28 3300015262 Ga0182007_10218446 Ga0182007_102184462 138
29 3300025893 Ga0207682_10160133 Ga0207682_101601331 138
30 3300025972 Ga0207668_10410578 Ga0207668_104105781 138
31 3300026075 Ga0207708_10707004 Ga0207708_107070042 138
32 3300026095 Ga0207676_10960199 Ga0207676_109601992 138
33 3300031665 Ga0316575_10093872 Ga0316575_100938722 138
34 3300031691 Ga0316579_10171936 Ga0316579_101719362 138
35 3300031728 Ga0316578_10007755 Ga0316578_100077556 138
36 3300031733 Ga0316577_10039459 Ga0316577_100394592 138
37 3300032002 Ga0307416_100977422 Ga0307416_1009774221 138
38 3300035171 Ga0373946_0761397 Ga0373946_0761397_53_469 138
39 3300035692 Ga0373935_0136475 Ga0373935_0136475_234_650 138
40 3300041452 Ga0451793_0606111 Ga0451793_0606111_284_700 138
41 3300042876 Ga0451577_0196697 Ga0451577_0196697_738_1157 138
42 3300046455 Ga0495603_0552149 Ga0495603_0552149_111_533 138
43 3300046459 Ga0495629_0000050 Ga0495629_0000050_90343_90759 138
44 3300046473 Ga0495582_0007310 Ga0495582_0007310_3354_3770 138
45 3300046499 Ga0495594_0005225 Ga0495594_0005225_1636_2052 138
46 3300046514 Ga0495618_0358146 Ga0495618_0358146_439_855 138
47 3300046533 Ga0495640_0021775 Ga0495640_0021775_1423_1839 138
48 3300046535 Ga0495586_0129461 Ga0495586_0129461_378_794 138
49 3300046663 Ga0495635_0000198 Ga0495635_0000198_15764_16180 138
50 3300046683 Ga0495658_0000191 Ga0495658_0000191_26821_27237 138
51 3300046689 Ga0495613_0044191 Ga0495613_0044191_2533_2949 138
52 3300046690 Ga0495624_0688519 Ga0495624_0688519_40_456 138
53 3300047315 Ga0495581_0000279 Ga0495581_0000279_21250_21666 138
54 3300047321 Ga0495676_0141288 Ga0495676_0141288_812_1228 138
55 3300047322 Ga0495680_0000465 Ga0495680_0000465_20571_20987 138
56 3300047673 Ga0495593_0080010 Ga0495593_0080010_367_783 138
57 3300048089 Ga0495614_0003921 Ga0495614_0003921_2223_2639 138
58 3300049575 Ga0501039_0496101 Ga0501039_0496101_150_569 138
59 3300049583 Ga0501067_0541524 Ga0501067_0541524_187_603 138
60 3300049585 Ga0501069_0290997 Ga0501069_0290997_299_715 138
61 3300050507 nmdc:mga05p37_385517_c1 nmdc:mga05p37_385517_c1_1189_1608 138
62 3300050512 nmdc:mga0n895_27710_c1 nmdc:mga0n895_27710_c1_4948_5367 138
63 3300050512 nmdc:mga0n895_721271_c1 nmdc:mga0n895_721271_c1_369_788 138
64 3300050513 nmdc:mga0rr50_1223684_c1 nmdc:mga0rr50_1223684_c1_167_586 138
65 3300050513 nmdc:mga0rr50_181799_c1 nmdc:mga0rr50_181799_c1_514_933 138
66 3300050513 nmdc:mga0rr50_484218_c1 nmdc:mga0rr50_484218_c1_609_1028 138
67 3300050514 nmdc:mga08x19_526843_c1 nmdc:mga08x19_526843_c1_122_541 138
68 3300050515 nmdc:mga0a205_127735_c1 nmdc:mga0a205_127735_c1_248_667 138
69 3300053085 Ga0495619_0005167 Ga0495619_0005167_2964_3380 138
70 3300005364 Ga0070673_100437437 Ga0070673_1004374372 139
71 3300005445 Ga0070708_101839302 Ga0070708_1018393021 139
72 3300005467 Ga0070706_100362363 Ga0070706_1003623632 139
73 3300005842 Ga0068858_100433959 Ga0068858_1004339591 139
74 3300025893 Ga0207682_10106879 Ga0207682_101068792 139
75 3300025910 Ga0207684_10314967 Ga0207684_103149672 139
76 3300025923 Ga0207681_11334407 Ga0207681_113344071 139
77 3300025986 Ga0207658_10506765 Ga0207658_105067653 139
78 3300026035 Ga0207703_10085583 Ga0207703_100855833 139
79 3300041494 Ga0451837_0530276 Ga0451837_0530276_152_574 139
80 3300049743 Ga0501081_1327806 Ga0501081_1327806_70_495 139
81 3300060353 Ga0501082_0571210 Ga0501082_0571210_532_951 139
82 3300061734 Ga0530510_0467361 Ga0530510_0467361_224_643 139
83 3300003203 JGI25406J46586_10003938 JGI25406J46586_100039386 140
84 3300003347 JGI26128J50194_1001745 JGI26128J50194_10017451 140
85 3300003349 JGI26129J50193_1002186 JGI26129J50193_10021862 140
86 3300003371 JGI26145J50221_1004190 JGI26145J50221_10041902 140
87 3300005289 Ga0065704_10300065 Ga0065704_103000652 140
88 3300005295 Ga0065707_10189561 Ga0065707_101895612 140
89 3300005328 Ga0070676_10403122 Ga0070676_104031222 140
90 3300005330 Ga0070690_100099974 Ga0070690_1000999742 140
91 3300005330 Ga0070690_100348285 Ga0070690_1003482852 140
92 3300005331 Ga0070670_100001558 Ga0070670_1000015587 140
93 3300005333 Ga0070677_10085365 Ga0070677_100853651 140
94 3300005334 Ga0068869_100000795 Ga0068869_10000079510 140
95 3300005334 Ga0068869_100002588 Ga0068869_10000258812 140
96 3300005335 Ga0070666_10222011 Ga0070666_102220112 140
97 3300005336 Ga0070680_100022284 Ga0070680_1000222842 140
98 3300005336 Ga0070680_100041507 Ga0070680_1000415072 140
99 3300005337 Ga0070682_100000179 Ga0070682_10000017924 140
100 3300005339 Ga0070660_100000476 Ga0070660_10000047619 140
101 3300005340 Ga0070689_100117769 Ga0070689_1001177692 140
102 3300005341 Ga0070691_10002169 Ga0070691_100021696 140
103 3300005341 Ga0070691_10004078 Ga0070691_100040782 140
104 3300005341 Ga0070691_10014775 Ga0070691_100147756 140
105 3300005343 Ga0070687_100053925 Ga0070687_1000539252 140
106 3300005344 Ga0070661_100003535 Ga0070661_1000035353 140
107 3300005347 Ga0070668_100647689 Ga0070668_1006476892 140
108 3300005353 Ga0070669_100754242 Ga0070669_1007542421 140
109 3300005353 Ga0070669_101400303 Ga0070669_1014003031 140
110 3300005353 Ga0070669_101702722 Ga0070669_1017027221 140
111 3300005366 Ga0070659_100000831 Ga0070659_1000008315 140
112 3300005406 Ga0070703_10001108 Ga0070703_100011089 140
113 3300005406 Ga0070703_10200434 Ga0070703_102004341 140
114 3300005434 Ga0070709_10239346 Ga0070709_102393462 140
115 3300005435 Ga0070714_100089998 Ga0070714_1000899982 140
116 3300005436 Ga0070713_101273668 Ga0070713_1012736681 140
117 3300005438 Ga0070701_10003890 Ga0070701_100038903 140
118 3300005439 Ga0070711_100043201 Ga0070711_1000432015 140
119 3300005440 Ga0070705_100020219 Ga0070705_1000202193 140
120 3300005440 Ga0070705_100087499 Ga0070705_1000874992 140
121 3300005441 Ga0070700_100282179 Ga0070700_1002821792 140
122 3300005441 Ga0070700_101773915 Ga0070700_1017739151 140
123 3300005444 Ga0070694_100009346 Ga0070694_1000093464 140
124 3300005444 Ga0070694_100020836 Ga0070694_1000208361 140
125 3300005444 Ga0070694_100161703 Ga0070694_1001617032 140
126 3300005444 Ga0070694_100488871 Ga0070694_1004888712 140
127 3300005444 Ga0070694_101007338 Ga0070694_1010073381 140
128 3300005445 Ga0070708_100004603 Ga0070708_1000046035 140
129 3300005445 Ga0070708_100006589 Ga0070708_1000065897 140
130 3300005445 Ga0070708_100034392 Ga0070708_1000343922 140
131 3300005445 Ga0070708_100085159 Ga0070708_1000851592 140
132 3300005445 Ga0070708_100125603 Ga0070708_1001256033 140
133 3300005445 Ga0070708_100131633 Ga0070708_1001316332 140
134 3300005445 Ga0070708_100260968 Ga0070708_1002609682 140
135 3300005445 Ga0070708_100266552 Ga0070708_1002665523 140
136 3300005445 Ga0070708_100453768 Ga0070708_1004537683 140
137 3300005445 Ga0070708_100503594 Ga0070708_1005035942 140
138 3300005445 Ga0070708_101674497 Ga0070708_1016744971 140
139 3300005455 Ga0070663_100004633 Ga0070663_1000046339 140
140 3300005457 Ga0070662_100007466 Ga0070662_1000074668 140
141 3300005457 Ga0070662_100019598 Ga0070662_1000195984 140
142 3300005459 Ga0068867_100000455 Ga0068867_10000045519 140
143 3300005467 Ga0070706_100044301 Ga0070706_1000443012 140
144 3300005467 Ga0070706_100055848 Ga0070706_1000558482 140
145 3300005467 Ga0070706_100061105 Ga0070706_1000611054 140
146 3300005467 Ga0070706_100098679 Ga0070706_1000986793 140
147 3300005467 Ga0070706_100231284 Ga0070706_1002312842 140
148 3300005467 Ga0070706_100300795 Ga0070706_1003007952 140
149 3300005467 Ga0070706_100311721 Ga0070706_1003117212 140
150 3300005467 Ga0070706_101299873 Ga0070706_1012998731 140
151 3300005468 Ga0070707_100000653 Ga0070707_10000065314 140
152 3300005468 Ga0070707_100002097 Ga0070707_10000209710 140
153 3300005468 Ga0070707_100007614 Ga0070707_1000076147 140
154 3300005468 Ga0070707_100090616 Ga0070707_1000906164 140
155 3300005468 Ga0070707_100160597 Ga0070707_1001605973 140
156 3300005468 Ga0070707_100174924 Ga0070707_1001749243 140
157 3300005468 Ga0070707_100188393 Ga0070707_1001883932 140
158 3300005468 Ga0070707_100195256 Ga0070707_1001952563 140
159 3300005468 Ga0070707_100901755 Ga0070707_1009017552 140
160 3300005471 Ga0070698_100000691 Ga0070698_10000069124 140
161 3300005471 Ga0070698_100004796 Ga0070698_10000479618 140
162 3300005471 Ga0070698_100014980 Ga0070698_1000149809 140
163 3300005471 Ga0070698_100055478 Ga0070698_1000554784 140
164 3300005471 Ga0070698_100059663 Ga0070698_1000596635 140
165 3300005471 Ga0070698_100203970 Ga0070698_1002039702 140
166 3300005471 Ga0070698_100447234 Ga0070698_1004472341 140
167 3300005471 Ga0070698_100911742 Ga0070698_1009117421 140
168 3300005471 Ga0070698_101083046 Ga0070698_1010830462 140
169 3300005471 Ga0070698_101723082 Ga0070698_1017230821 140
170 3300005518 Ga0070699_100013216 Ga0070699_1000132163 140
171 3300005518 Ga0070699_100030616 Ga0070699_1000306163 140
172 3300005518 Ga0070699_100036410 Ga0070699_1000364105 140
173 3300005518 Ga0070699_100045159 Ga0070699_1000451592 140
174 3300005518 Ga0070699_100049254 Ga0070699_1000492543 140
175 3300005518 Ga0070699_100337732 Ga0070699_1003377322 140
176 3300005518 Ga0070699_100357162 Ga0070699_1003571622 140
177 3300005518 Ga0070699_100841838 Ga0070699_1008418382 140
178 3300005518 Ga0070699_100947699 Ga0070699_1009476992 140
179 3300005530 Ga0070679_100037758 Ga0070679_1000377585 140
180 3300005535 Ga0070684_100042713 Ga0070684_1000427137 140
181 3300005536 Ga0070697_100016378 Ga0070697_1000163781 140
182 3300005536 Ga0070697_100023819 Ga0070697_1000238194 140
183 3300005536 Ga0070697_100095843 Ga0070697_1000958433 140
184 3300005536 Ga0070697_100158015 Ga0070697_1001580153 140
185 3300005536 Ga0070697_100251041 Ga0070697_1002510412 140
186 3300005536 Ga0070697_100361715 Ga0070697_1003617152 140
187 3300005536 Ga0070697_100385861 Ga0070697_1003858612 140
188 3300005536 Ga0070697_100568403 Ga0070697_1005684032 140
189 3300005536 Ga0070697_101304356 Ga0070697_1013043561 140
190 3300005536 Ga0070697_101796079 Ga0070697_1017960791 140
191 3300005539 Ga0068853_100003324 Ga0068853_1000033245 140
192 3300005543 Ga0070672_100051439 Ga0070672_1000514395 140
193 3300005545 Ga0070695_100001891 Ga0070695_10000189112 140
194 3300005545 Ga0070695_100137249 Ga0070695_1001372492 140
195 3300005545 Ga0070695_100277788 Ga0070695_1002777882 140
196 3300005545 Ga0070695_100608306 Ga0070695_1006083062 140
197 3300005545 Ga0070695_100827942 Ga0070695_1008279421 140
198 3300005545 Ga0070695_101241927 Ga0070695_1012419271 140
199 3300005546 Ga0070696_100007948 Ga0070696_1000079488 140
200 3300005546 Ga0070696_100011958 Ga0070696_1000119585 140
201 3300005546 Ga0070696_100061448 Ga0070696_1000614484 140
202 3300005546 Ga0070696_100066473 Ga0070696_1000664733 140
203 3300005546 Ga0070696_100317632 Ga0070696_1003176322 140
204 3300005547 Ga0070693_100010068 Ga0070693_1000100682 140
205 3300005547 Ga0070693_100015387 Ga0070693_1000153874 140
206 3300005549 Ga0070704_100001374 Ga0070704_1000013746 140
207 3300005549 Ga0070704_100081158 Ga0070704_1000811584 140
208 3300005549 Ga0070704_100169859 Ga0070704_1001698593 140
209 3300005549 Ga0070704_100261988 Ga0070704_1002619882 140
210 3300005563 Ga0068855_100000225 Ga0068855_10000022563 140
211 3300005564 Ga0070664_100207701 Ga0070664_1002077011 140
212 3300005577 Ga0068857_100036222 Ga0068857_1000362223 140
213 3300005577 Ga0068857_100117893 Ga0068857_1001178932 140
214 3300005577 Ga0068857_100263207 Ga0068857_1002632073 140
215 3300005578 Ga0068854_100007476 Ga0068854_1000074762 140
216 3300005614 Ga0068856_100001169 Ga0068856_10000116919 140
217 3300005615 Ga0070702_100062811 Ga0070702_1000628113 140
218 3300005617 Ga0068859_100509788 Ga0068859_1005097881 140
219 3300005718 Ga0068866_10163854 Ga0068866_101638542 140
220 3300005719 Ga0068861_100007123 Ga0068861_1000071235 140
221 3300005840 Ga0068870_10007719 Ga0068870_100077195 140
222 3300005840 Ga0068870_10272864 Ga0068870_102728642 140
223 3300005841 Ga0068863_100033502 Ga0068863_1000335024 140
224 3300005842 Ga0068858_100113125 Ga0068858_1001131252 140
225 3300005843 Ga0068860_100001109 Ga0068860_1000011099 140
226 3300005843 Ga0068860_100212652 Ga0068860_1002126523 140
227 3300005843 Ga0068860_100403565 Ga0068860_1004035652 140
228 3300005844 Ga0068862_100003750 Ga0068862_10000375010 140
229 3300005844 Ga0068862_100342658 Ga0068862_1003426582 140
230 3300005844 Ga0068862_100456991 Ga0068862_1004569912 140
231 3300005844 Ga0068862_100869224 Ga0068862_1008692243 140
232 3300005937 Ga0081455_10001810 Ga0081455_100018107 140
233 3300005983 Ga0081540_1024694 Ga0081540_10246943 140
234 3300005985 Ga0081539_10000005 Ga0081539_10000005374 140
235 3300006058 Ga0075432_10024616 Ga0075432_100246162 140
236 3300006058 Ga0075432_10134811 Ga0075432_101348113 140
237 3300006163 Ga0070715_10650925 Ga0070715_106509252 140
238 3300006358 Ga0068871_100999311 Ga0068871_1009993112 140
239 3300006844 Ga0075428_100000924 Ga0075428_10000092426 140
240 3300006844 Ga0075428_100001380 Ga0075428_10000138019 140
241 3300006844 Ga0075428_100005362 Ga0075428_1000053629 140
242 3300006844 Ga0075428_100579952 Ga0075428_1005799522 140
243 3300006844 Ga0075428_100884197 Ga0075428_1008841972 140
244 3300006844 Ga0075428_101050823 Ga0075428_1010508232 140
245 3300006846 Ga0075430_100000487 Ga0075430_10000048717 140
246 3300006846 Ga0075430_100245726 Ga0075430_1002457263 140
247 3300006847 Ga0075431_100002180 Ga0075431_1000021803 140
248 3300006847 Ga0075431_100005577 Ga0075431_1000055774 140
249 3300006847 Ga0075431_100044298 Ga0075431_1000442984 140
250 3300006847 Ga0075431_100178495 Ga0075431_1001784952 140
251 3300006847 Ga0075431_100198080 Ga0075431_1001980802 140
252 3300006847 Ga0075431_100285247 Ga0075431_1002852473 140
253 3300006847 Ga0075431_100431648 Ga0075431_1004316483 140
254 3300006847 Ga0075431_100844821 Ga0075431_1008448212 140
255 3300006847 Ga0075431_101266904 Ga0075431_1012669042 140
256 3300006852 Ga0075433_10006420 Ga0075433_1000642011 140
257 3300006852 Ga0075433_10019706 Ga0075433_100197064 140
258 3300006852 Ga0075433_10030670 Ga0075433_100306706 140
259 3300006852 Ga0075433_10043087 Ga0075433_100430872 140
260 3300006852 Ga0075433_10050068 Ga0075433_100500683 140
261 3300006852 Ga0075433_10799416 Ga0075433_107994161 140
262 3300006871 Ga0075434_100009447 Ga0075434_10000944710 140
263 3300006871 Ga0075434_100019775 Ga0075434_1000197755 140
264 3300006871 Ga0075434_100185055 Ga0075434_1001850555 140
265 3300006871 Ga0075434_100268238 Ga0075434_1002682382 140
266 3300006871 Ga0075434_100313380 Ga0075434_1003133803 140
267 3300006871 Ga0075434_100659998 Ga0075434_1006599982 140
268 3300006871 Ga0075434_100740616 Ga0075434_1007406163 140
269 3300006871 Ga0075434_100781872 Ga0075434_1007818722 140
270 3300006880 Ga0075429_100000859 Ga0075429_10000085913 140
271 3300006880 Ga0075429_100008092 Ga0075429_1000080923 140
272 3300006880 Ga0075429_100020425 Ga0075429_1000204254 140
273 3300006880 Ga0075429_100113445 Ga0075429_1001134451 140
274 3300006881 Ga0068865_100092831 Ga0068865_1000928312 140
275 3300006881 Ga0068865_100139728 Ga0068865_1001397282 140
276 3300006881 Ga0068865_100251966 Ga0068865_1002519662 140
277 3300006914 Ga0075436_100001157 Ga0075436_10000115713 140
278 3300006914 Ga0075436_100078112 Ga0075436_1000781121 140
279 3300006914 Ga0075436_100119904 Ga0075436_1001199043 140
280 3300006931 Ga0097620_100509819 Ga0097620_1005098191 140
281 3300007076 Ga0075435_100000661 Ga0075435_1000006619 140
282 3300007076 Ga0075435_100007138 Ga0075435_1000071382 140
283 3300007076 Ga0075435_100034638 Ga0075435_1000346385 140
284 3300007076 Ga0075435_100037266 Ga0075435_1000372665 140
285 3300007076 Ga0075435_100043704 Ga0075435_1000437043 140
286 3300007076 Ga0075435_100080674 Ga0075435_1000806742 140
287 3300007076 Ga0075435_100433984 Ga0075435_1004339842 140
288 3300007265 Ga0099794_10013014 Ga0099794_100130144 140
289 3300007265 Ga0099794_10048892 Ga0099794_100488922 140
290 3300007788 Ga0099795_10579111 Ga0099795_105791112 140
291 3300009094 Ga0111539_10018495 Ga0111539_100184959 140
292 3300009094 Ga0111539_10216404 Ga0111539_102164044 140
293 3300009094 Ga0111539_10940847 Ga0111539_109408472 140
294 3300009094 Ga0111539_12317347 Ga0111539_123173471 140
295 3300009098 Ga0105245_10200020 Ga0105245_102000203 140
296 3300009147 Ga0114129_10000115 Ga0114129_1000011548 140
297 3300009147 Ga0114129_10000606 Ga0114129_1000060622 140
298 3300009147 Ga0114129_10001631 Ga0114129_100016319 140
299 3300009147 Ga0114129_10044948 Ga0114129_100449485 140
300 3300009147 Ga0114129_10052378 Ga0114129_100523786 140
301 3300009147 Ga0114129_10099562 Ga0114129_100995622 140
302 3300009147 Ga0114129_10181958 Ga0114129_101819582 140
303 3300009147 Ga0114129_10380919 Ga0114129_103809192 140
304 3300009147 Ga0114129_10473394 Ga0114129_104733943 140
305 3300009147 Ga0114129_10543133 Ga0114129_105431332 140
306 3300009147 Ga0114129_10638587 Ga0114129_106385872 140
307 3300009147 Ga0114129_10833734 Ga0114129_108337342 140
308 3300009147 Ga0114129_11939752 Ga0114129_119397522 140
309 3300009148 Ga0105243_10007747 Ga0105243_100077475 140
310 3300009148 Ga0105243_10183874 Ga0105243_101838741 140
311 3300009174 Ga0105241_10171445 Ga0105241_101714452 140
312 3300009174 Ga0105241_10181111 Ga0105241_101811113 140
313 3300009176 Ga0105242_10144974 Ga0105242_101449742 140
314 3300009545 Ga0105237_10081739 Ga0105237_100817392 140
315 3300009551 Ga0105238_10640592 Ga0105238_106405921 140
316 3300009553 Ga0105249_10031638 Ga0105249_100316383 140
317 3300009553 Ga0105249_10328103 Ga0105249_103281032 140
318 3300009553 Ga0105249_10698852 Ga0105249_106988522 140
319 3300009553 Ga0105249_10759559 Ga0105249_107595592 140
320 3300009553 Ga0105249_10868964 Ga0105249_108689642 140
321 3300009553 Ga0105249_13085990 Ga0105249_130859901 140
322 3300010375 Ga0105239_11349287 Ga0105239_113492872 140
323 3300011119 Ga0105246_10289229 Ga0105246_102892293 140
324 3300013100 Ga0157373_10000388 Ga0157373_1000038817 140
325 3300013102 Ga0157371_10123835 Ga0157371_101238352 140
326 3300013102 Ga0157371_10807538 Ga0157371_108075382 140
327 3300013105 Ga0157369_10109413 Ga0157369_101094133 140
328 3300013297 Ga0157378_10537610 Ga0157378_105376102 140
329 3300013307 Ga0157372_10000105 Ga0157372_1000010564 140
330 3300013307 Ga0157372_10402152 Ga0157372_104021524 140
331 3300013308 Ga0157375_10295519 Ga0157375_102955192 140
332 3300014326 Ga0157380_10205551 Ga0157380_102055512 140
333 3300014497 Ga0182008_10038771 Ga0182008_100387712 140
334 3300014745 Ga0157377_10344437 Ga0157377_103444372 140
335 3300014968 Ga0157379_10126211 Ga0157379_101262113 140
336 3300015262 Ga0182007_10202743 Ga0182007_102027432 140
337 3300020070 Ga0206356_10921615 Ga0206356_109216151 140
338 3300020082 Ga0206353_11152683 Ga0206353_111526831 140
339 3300025885 Ga0207653_10062032 Ga0207653_100620321 140
340 3300025901 Ga0207688_10038779 Ga0207688_100387793 140
341 3300025903 Ga0207680_10242575 Ga0207680_102425752 140
342 3300025904 Ga0207647_10130297 Ga0207647_101302972 140
343 3300025905 Ga0207685_10240848 Ga0207685_102408482 140
344 3300025906 Ga0207699_10373815 Ga0207699_103738152 140
345 3300025907 Ga0207645_10005499 Ga0207645_100054993 140
346 3300025908 Ga0207643_10000329 Ga0207643_100003295 140
347 3300025908 Ga0207643_10058926 Ga0207643_100589263 140
348 3300025910 Ga0207684_10000115 Ga0207684_100001153 140
349 3300025910 Ga0207684_10004217 Ga0207684_1000421715 140
350 3300025910 Ga0207684_10012100 Ga0207684_100121005 140
351 3300025910 Ga0207684_10016655 Ga0207684_100166555 140
352 3300025910 Ga0207684_10041537 Ga0207684_100415373 140
353 3300025910 Ga0207684_10055055 Ga0207684_100550555 140
354 3300025910 Ga0207684_10075787 Ga0207684_100757874 140
355 3300025910 Ga0207684_10087362 Ga0207684_100873624 140
356 3300025910 Ga0207684_10114071 Ga0207684_101140713 140
357 3300025910 Ga0207684_10155793 Ga0207684_101557932 140
358 3300025910 Ga0207684_10320745 Ga0207684_103207452 140
359 3300025910 Ga0207684_11492938 Ga0207684_114929382 140
360 3300025911 Ga0207654_10004154 Ga0207654_100041547 140
361 3300025911 Ga0207654_10175934 Ga0207654_101759343 140
362 3300025912 Ga0207707_10000352 Ga0207707_1000035214 140
363 3300025914 Ga0207671_10100012 Ga0207671_101000123 140
364 3300025917 Ga0207660_10000334 Ga0207660_1000033424 140
365 3300025917 Ga0207660_10090303 Ga0207660_100903031 140
366 3300025917 Ga0207660_10350194 Ga0207660_103501941 140
367 3300025918 Ga0207662_10017645 Ga0207662_100176456 140
368 3300025919 Ga0207657_10002264 Ga0207657_100022642 140
369 3300025920 Ga0207649_10013687 Ga0207649_100136877 140
370 3300025921 Ga0207652_10000466 Ga0207652_1000046626 140
371 3300025922 Ga0207646_10000250 Ga0207646_1000025044 140
372 3300025922 Ga0207646_10008025 Ga0207646_100080256 140
373 3300025922 Ga0207646_10017586 Ga0207646_100175864 140
374 3300025922 Ga0207646_10030213 Ga0207646_100302135 140
375 3300025922 Ga0207646_10035173 Ga0207646_100351732 140
376 3300025922 Ga0207646_10162660 Ga0207646_101626603 140
377 3300025922 Ga0207646_10168402 Ga0207646_101684023 140
378 3300025922 Ga0207646_10201847 Ga0207646_102018473 140
379 3300025922 Ga0207646_10246117 Ga0207646_102461172 140
380 3300025922 Ga0207646_10532405 Ga0207646_105324052 140
381 3300025922 Ga0207646_10981408 Ga0207646_109814082 140
382 3300025922 Ga0207646_11206851 Ga0207646_112068511 140
383 3300025923 Ga0207681_10082617 Ga0207681_100826172 140
384 3300025923 Ga0207681_10240368 Ga0207681_102403682 140
385 3300025923 Ga0207681_11406862 Ga0207681_114068622 140
386 3300025924 Ga0207694_10355091 Ga0207694_103550913 140
387 3300025925 Ga0207650_10268037 Ga0207650_102680372 140
388 3300025932 Ga0207690_10003653 Ga0207690_100036535 140
389 3300025933 Ga0207706_10008780 Ga0207706_100087809 140
390 3300025933 Ga0207706_10038603 Ga0207706_100386033 140
391 3300025934 Ga0207686_10099272 Ga0207686_100992723 140
392 3300025935 Ga0207709_10003271 Ga0207709_100032719 140
393 3300025935 Ga0207709_10366549 Ga0207709_103665491 140
394 3300025935 Ga0207709_11077258 Ga0207709_110772581 140
395 3300025936 Ga0207670_10003001 Ga0207670_100030012 140
396 3300025938 Ga0207704_10588999 Ga0207704_105889992 140
397 3300025939 Ga0207665_10010689 Ga0207665_1001068911 140
398 3300025940 Ga0207691_10044338 Ga0207691_100443385 140
399 3300025942 Ga0207689_10003685 Ga0207689_1000368510 140
400 3300025942 Ga0207689_10011582 Ga0207689_100115825 140
401 3300025942 Ga0207689_10054717 Ga0207689_100547172 140
402 3300025944 Ga0207661_10269170 Ga0207661_102691702 140
403 3300025945 Ga0207679_10000878 Ga0207679_1000087812 140
404 3300025949 Ga0207667_10000497 Ga0207667_1000049726 140
405 3300025960 Ga0207651_11198234 Ga0207651_111982342 140
406 3300025961 Ga0207712_10044142 Ga0207712_100441423 140
407 3300025961 Ga0207712_10353842 Ga0207712_103538422 140
408 3300025961 Ga0207712_10561970 Ga0207712_105619702 140
409 3300025961 Ga0207712_10671043 Ga0207712_106710432 140
410 3300025981 Ga0207640_10009082 Ga0207640_100090822 140
411 3300025986 Ga0207658_11569601 Ga0207658_115696011 140
412 3300026041 Ga0207639_10002384 Ga0207639_100023849 140
413 3300026067 Ga0207678_10054455 Ga0207678_100544553 140
414 3300026075 Ga0207708_10217137 Ga0207708_102171372 140
415 3300026075 Ga0207708_10790475 Ga0207708_107904752 140
416 3300026078 Ga0207702_10008955 Ga0207702_100089557 140
417 3300026089 Ga0207648_10005839 Ga0207648_1000583913 140
418 3300026089 Ga0207648_10115995 Ga0207648_101159953 140
419 3300026089 Ga0207648_11166398 Ga0207648_111663982 140
420 3300026095 Ga0207676_10014367 Ga0207676_100143673 140
421 3300026116 Ga0207674_10000550 Ga0207674_100005509 140
422 3300026116 Ga0207674_10161954 Ga0207674_101619541 140
423 3300026116 Ga0207674_10629755 Ga0207674_106297552 140
424 3300026118 Ga0207675_100005709 Ga0207675_1000057096 140
425 3300026118 Ga0207675_100267941 Ga0207675_1002679414 140
426 3300026118 Ga0207675_100356310 Ga0207675_1003563102 140
427 3300027360 Ga0209969_1010320 Ga0209969_10103202 140
428 3300027364 Ga0209967_1015709 Ga0209967_10157092 140
429 3300027378 Ga0209981_1012710 Ga0209981_10127102 140
430 3300027395 Ga0209996_1000987 Ga0209996_10009873 140
431 3300027462 Ga0210000_1001288 Ga0210000_10012884 140
432 3300027471 Ga0209995_1001479 Ga0209995_10014792 140
433 3300027526 Ga0209968_1005623 Ga0209968_10056232 140
434 3300027526 Ga0209968_1058298 Ga0209968_10582981 140
435 3300027543 Ga0209999_1000243 Ga0209999_10002434 140
436 3300027552 Ga0209982_1000487 Ga0209982_10004873 140
437 3300027614 Ga0209970_1017224 Ga0209970_10172242 140
438 3300027617 Ga0210002_1033995 Ga0210002_10339952 140
439 3300027665 Ga0209983_1000034 Ga0209983_10000342 140
440 3300027671 Ga0209588_1041569 Ga0209588_10415693 140
441 3300027671 Ga0209588_1111984 Ga0209588_11119842 140
442 3300027671 Ga0209588_1156985 Ga0209588_11569852 140
443 3300027682 Ga0209971_1000028 Ga0209971_100002819 140
444 3300027682 Ga0209971_1020061 Ga0209971_10200612 140
445 3300027695 Ga0209966_1000073 Ga0209966_100007311 140
446 3300027717 Ga0209998_10000001 Ga0209998_10000001159 140
447 3300027717 Ga0209998_10017838 Ga0209998_100178382 140
448 3300027717 Ga0209998_10085113 Ga0209998_100851131 140
449 3300027876 Ga0209974_10000369 Ga0209974_100003692 140
450 3300027907 Ga0207428_10355343 Ga0207428_103553432 140
451 3300028380 Ga0268265_10002923 Ga0268265_1000292310 140
452 3300028380 Ga0268265_10136227 Ga0268265_101362272 140
453 3300028380 Ga0268265_10196008 Ga0268265_101960083 140
454 3300028380 Ga0268265_11144355 Ga0268265_111443552 140
455 3300028381 Ga0268264_10182259 Ga0268264_101822593 140
456 3300028381 Ga0268264_10342083 Ga0268264_103420832 140
457 3300028381 Ga0268264_10758437 Ga0268264_107584372 140
458 3300031548 Ga0307408_100049624 Ga0307408_1000496243 140
459 3300031548 Ga0307408_100058377 Ga0307408_1000583774 140
460 3300031548 Ga0307408_100105981 Ga0307408_1001059812 140
461 3300031548 Ga0307408_100409067 Ga0307408_1004090672 140
462 3300031548 Ga0307408_100685699 Ga0307408_1006856992 140
463 3300031548 Ga0307408_101107260 Ga0307408_1011072602 140
464 3300031731 Ga0307405_10778720 Ga0307405_107787202 140
465 3300031824 Ga0307413_11716277 Ga0307413_117162771 140
466 3300031901 Ga0307406_10423026 Ga0307406_104230261 140
467 3300031901 Ga0307406_10522711 Ga0307406_105227112 140
468 3300031903 Ga0307407_10924550 Ga0307407_109245502 140
469 3300031911 Ga0307412_10067622 Ga0307412_100676222 140
470 3300031995 Ga0307409_100055052 Ga0307409_1000550522 140
471 3300031995 Ga0307409_100249842 Ga0307409_1002498423 140
472 3300031995 Ga0307409_101084352 Ga0307409_1010843522 140
473 3300031995 Ga0307409_101402134 Ga0307409_1014021342 140
474 3300032002 Ga0307416_100116219 Ga0307416_1001162193 140
475 3300032002 Ga0307416_100117613 Ga0307416_1001176133 140
476 3300032002 Ga0307416_100364315 Ga0307416_1003643153 140
477 3300032005 Ga0307411_10501390 Ga0307411_105013902 140
478 3300034816 Ga0373930_0025476 Ga0373930_0025476_730_1155 140
479 3300035085 Ga0373929_0019492 Ga0373929_0019492_52_477 140
480 3300035092 Ga0373952_0012443 Ga0373952_0012443_757_1182 140
481 3300035114 Ga0373939_0008845 Ga0373939_0008845_1293_1718 140
482 3300035114 Ga0373939_0121915 Ga0373939_0121915_229_654 140
483 3300035115 Ga0373941_0137792 Ga0373941_0137792_443_868 140
484 3300035121 Ga0373960_0017235 Ga0373960_0017235_1072_1497 140
485 3300035207 Ga0373942_0126126 Ga0373942_0126126_166_591 140
486 3300035241 Ga0373961_0136875 Ga0373961_0136875_372_797 140
487 3300035691 Ga0373931_0168586 Ga0373931_0168586_295_720 140
488 3300037312 Ga0395899_0098186 Ga0395899_0098186_18_443 140
489 3300037418 Ga0395900_0158493 Ga0395900_0158493_169_594 140
490 3300037418 Ga0395900_0262037 Ga0395900_0262037_917_1339 140
491 3300037466 Ga0395898_0068101 Ga0395898_0068101_1327_1752 140
492 3300037466 Ga0395898_0754785 Ga0395898_0754785_257_679 140
493 3300037471 Ga0395905_0032845 Ga0395905_0032845_4018_4440 140
494 3300038443 Ga0395901_0003553 Ga0395901_0003553_15270_15695 140
495 3300038443 Ga0395901_0316283 Ga0395901_0316283_570_992 140
496 3300038742 Ga0400486_00771 Ga0400486_00771_3278_3712 140
497 3300042001 Ga0439441_014767 Ga0439441_014767_834_1271 140
498 3300042005 Ga0439448_0001340 Ga0439448_0001340_2271_2696 140
499 3300042005 Ga0439448_0050970 Ga0439448_0050970_414_839 140
500 3300042008 Ga0439450_014251 Ga0439450_014251_569_994 140
501 3300042012 Ga0439455_0010262 Ga0439455_0010262_31_456 140
502 3300042013 Ga0439456_006513 Ga0439456_006513_1674_2099 140
503 3300042144 Ga0450889_016641 Ga0450889_016641_303_728 140
504 3300042438 Ga0439459_0000265 Ga0439459_0000265_5077_5502 140
505 3300042439 Ga0439464_0001792 Ga0439464_0001792_1415_1840 140
506 3300042461 Ga0439460_0000935 Ga0439460_0000935_2084_2509 140
507 3300042876 Ga0451577_0005206 Ga0451577_0005206_5985_6410 140
508 3300042876 Ga0451577_0010038 Ga0451577_0010038_6654_7079 140
509 3300044673 Ga0453683_0003008 Ga0453683_0003008_11951_12376 140
510 3300044673 Ga0453683_0013004 Ga0453683_0013004_4079_4504 140
511 3300044712 Ga0453684_0019511 Ga0453684_0019511_642_1097 140
512 3300044712 Ga0453684_0202154 Ga0453684_0202154_926_1351 140
513 3300044712 Ga0453684_1231168 Ga0453684_1231168_59_484 140
514 3300044712 Ga0453684_1268941 Ga0453684_1268941_252_677 140
515 3300045051 Ga0451576_0025605 Ga0451576_0025605_869_1294 140
516 3300045051 Ga0451576_0071114 Ga0451576_0071114_2395_2820 140
517 3300045051 Ga0451576_0232246 Ga0451576_0232246_56_481 140
518 3300045051 Ga0451576_0258336 Ga0451576_0258336_1383_1808 140
519 3300045051 Ga0451576_0458466 Ga0451576_0458466_573_998 140
520 3300045051 Ga0451576_1028191 Ga0451576_1028191_239_664 140
521 3300045051 Ga0451576_1112381 Ga0451576_1112381_391_816 140
522 3300045051 Ga0451576_2035105 Ga0451576_2035105_23_448 140
523 3300046472 Ga0495580_0005633 Ga0495580_0005633_4520_4945 140
524 3300046472 Ga0495580_0057095 Ga0495580_0057095_339_764 140
525 3300046491 Ga0495584_0301533 Ga0495584_0301533_152_577 140
526 3300046528 Ga0495642_0123655 Ga0495642_0123655_16_441 140
527 3300046664 Ga0495659_0092071 Ga0495659_0092071_199_624 140
528 3300046664 Ga0495659_0104214 Ga0495659_0104214_264_689 140
529 3300046684 Ga0495669_0086886 Ga0495669_0086886_283_705 140
530 3300046684 Ga0495669_0319428 Ga0495669_0319428_144_569 140
531 3300047318 Ga0495636_0244510 Ga0495636_0244510_65_490 140
532 3300048905 Ga0496102_0038621 Ga0496102_0038621_2266_2691 140
533 3300048905 Ga0496102_0400327 Ga0496102_0400327_659_1084 140
534 3300048907 Ga0496104_0398697 Ga0496104_0398697_627_1052 140
535 3300048909 Ga0496106_0070068 Ga0496106_0070068_1642_2067 140
536 3300048910 Ga0496107_0422369 Ga0496107_0422369_149_574 140
537 3300048912 Ga0496109_0713502 Ga0496109_0713502_85_510 140
538 3300048915 Ga0496112_0139340 Ga0496112_0139340_1036_1461 140
539 3300049515 Ga0501292_029677 Ga0501292_029677_471_893 140
540 3300049521 Ga0501298_050962 Ga0501298_050962_203_625 140
541 3300049570 Ga0501033_0038328 Ga0501033_0038328_3070_3495 140
542 3300049570 Ga0501033_0294784 Ga0501033_0294784_70_495 140
543 3300049570 Ga0501033_0346609 Ga0501033_0346609_558_1028 140
544 3300049570 Ga0501033_0360772 Ga0501033_0360772_138_563 140
545 3300049570 Ga0501033_0399332 Ga0501033_0399332_107_532 140
546 3300049572 Ga0501036_0008473 Ga0501036_0008473_5470_5895 140
547 3300049572 Ga0501036_0029734 Ga0501036_0029734_359_784 140
548 3300049572 Ga0501036_0137721 Ga0501036_0137721_1590_2015 140
549 3300049572 Ga0501036_0143053 Ga0501036_0143053_624_1049 140
550 3300049572 Ga0501036_0289350 Ga0501036_0289350_210_635 140
551 3300049572 Ga0501036_0503945 Ga0501036_0503945_544_969 140
552 3300049572 Ga0501036_1683040 Ga0501036_1683040_69_494 140
553 3300049573 Ga0501037_0122149 Ga0501037_0122149_1209_1634 140
554 3300049573 Ga0501037_0693477 Ga0501037_0693477_171_596 140
555 3300049574 Ga0501038_0008826 Ga0501038_0008826_5108_5533 140
556 3300049574 Ga0501038_0098642 Ga0501038_0098642_547_972 140
557 3300049574 Ga0501038_0142802 Ga0501038_0142802_522_947 140
558 3300049574 Ga0501038_0790779 Ga0501038_0790779_249_674 140
559 3300049575 Ga0501039_0006761 Ga0501039_0006761_7163_7588 140
560 3300049575 Ga0501039_0028057 Ga0501039_0028057_2380_2805 140
561 3300049575 Ga0501039_0226156 Ga0501039_0226156_291_713 140
562 3300049575 Ga0501039_0438744 Ga0501039_0438744_488_913 140
563 3300049575 Ga0501039_0859626 Ga0501039_0859626_267_692 140
564 3300049575 Ga0501039_0930980 Ga0501039_0930980_123_548 140
565 3300049576 Ga0501040_0006783 Ga0501040_0006783_958_1383 140
566 3300049576 Ga0501040_0024123 Ga0501040_0024123_1197_1622 140
567 3300049576 Ga0501040_0042354 Ga0501040_0042354_2350_2775 140
568 3300049576 Ga0501040_0046392 Ga0501040_0046392_315_740 140
569 3300049576 Ga0501040_0131181 Ga0501040_0131181_402_827 140
570 3300049576 Ga0501040_0731066 Ga0501040_0731066_279_704 140
571 3300049577 Ga0501041_0014008 Ga0501041_0014008_1634_2059 140
572 3300049577 Ga0501041_0015706 Ga0501041_0015706_2373_2798 140
573 3300049577 Ga0501041_0024893 Ga0501041_0024893_511_936 140
574 3300049577 Ga0501041_0119263 Ga0501041_0119263_1028_1450 140
575 3300049577 Ga0501041_0122637 Ga0501041_0122637_102_527 140
576 3300049577 Ga0501041_0181516 Ga0501041_0181516_338_763 140
577 3300049577 Ga0501041_0198808 Ga0501041_0198808_718_1143 140
578 3300049577 Ga0501041_0833353 Ga0501041_0833353_87_557 140
579 3300049578 Ga0501042_0007483 Ga0501042_0007483_6565_6990 140
580 3300049578 Ga0501042_0055319 Ga0501042_0055319_1334_1759 140
581 3300049578 Ga0501042_0102109 Ga0501042_0102109_173_598 140
582 3300049578 Ga0501042_0175713 Ga0501042_0175713_537_962 140
583 3300049578 Ga0501042_0542254 Ga0501042_0542254_283_708 140
584 3300049578 Ga0501042_1138061 Ga0501042_1138061_119_544 140
585 3300049579 Ga0501043_0103412 Ga0501043_0103412_1064_1489 140
586 3300049579 Ga0501043_0553562 Ga0501043_0553562_307_732 140
587 3300049579 Ga0501043_1268852 Ga0501043_1268852_19_441 140
588 3300049580 Ga0501046_0006426 Ga0501046_0006426_4058_4483 140
589 3300049580 Ga0501046_0018987 Ga0501046_0018987_2548_2973 140
590 3300049580 Ga0501046_0078313 Ga0501046_0078313_2011_2436 140
591 3300049580 Ga0501046_0100534 Ga0501046_0100534_182_607 140
592 3300049580 Ga0501046_0213903 Ga0501046_0213903_724_1149 140
593 3300049582 Ga0501048_0021736 Ga0501048_0021736_825_1250 140
594 3300049582 Ga0501048_0078325 Ga0501048_0078325_1265_1690 140
595 3300049582 Ga0501048_0130757 Ga0501048_0130757_281_706 140
596 3300049582 Ga0501048_0133623 Ga0501048_0133623_1060_1485 140
597 3300049582 Ga0501048_0292418 Ga0501048_0292418_195_617 140
598 3300049582 Ga0501048_0674724 Ga0501048_0674724_217_639 140
599 3300049582 Ga0501048_1080280 Ga0501048_1080280_23_451 140
600 3300049583 Ga0501067_0154006 Ga0501067_0154006_329_754 140
601 3300049584 Ga0501068_0033097 Ga0501068_0033097_2083_2508 140
602 3300049584 Ga0501068_0071879 Ga0501068_0071879_622_1047 140
603 3300049584 Ga0501068_0082028 Ga0501068_0082028_590_1015 140
604 3300049587 Ga0501071_0107335 Ga0501071_0107335_1425_1850 140
605 3300049587 Ga0501071_0124133 Ga0501071_0124133_883_1308 140
606 3300049588 Ga0501072_0018561 Ga0501072_0018561_2371_2796 140
607 3300049588 Ga0501072_0028643 Ga0501072_0028643_198_623 140
608 3300049588 Ga0501072_0045219 Ga0501072_0045219_2521_2943 140
609 3300049588 Ga0501072_0101298 Ga0501072_0101298_1125_1550 140
610 3300049588 Ga0501072_0128520 Ga0501072_0128520_1401_1826 140
611 3300049588 Ga0501072_0359228 Ga0501072_0359228_346_771 140
612 3300049588 Ga0501072_0360289 Ga0501072_0360289_212_634 140
613 3300049588 Ga0501072_0437841 Ga0501072_0437841_147_572 140
614 3300049588 Ga0501072_0484509 Ga0501072_0484509_49_474 140
615 3300049588 Ga0501072_0503136 Ga0501072_0503136_193_618 140
616 3300049588 Ga0501072_1598324 Ga0501072_1598324_49_474 140
617 3300049589 Ga0501073_0555769 Ga0501073_0555769_124_549 140
618 3300049590 Ga0501074_0010060 Ga0501074_0010060_781_1206 140
619 3300049590 Ga0501074_0089779 Ga0501074_0089779_1716_2141 140
620 3300049590 Ga0501074_0684644 Ga0501074_0684644_212_637 140
621 3300049591 Ga0501075_0000122 Ga0501075_0000122_10720_11145 140
622 3300049591 Ga0501075_0036490 Ga0501075_0036490_1466_1891 140
623 3300049591 Ga0501075_0049544 Ga0501075_0049544_1140_1565 140
624 3300049591 Ga0501075_0056627 Ga0501075_0056627_765_1190 140
625 3300049591 Ga0501075_0060695 Ga0501075_0060695_743_1168 140
626 3300049591 Ga0501075_0106630 Ga0501075_0106630_865_1287 140
627 3300049591 Ga0501075_0122974 Ga0501075_0122974_1219_1644 140
628 3300049591 Ga0501075_0201147 Ga0501075_0201147_170_595 140
629 3300049591 Ga0501075_0349403 Ga0501075_0349403_392_850 140
630 3300049591 Ga0501075_0479799 Ga0501075_0479799_296_721 140
631 3300049591 Ga0501075_0593594 Ga0501075_0593594_371_796 140
632 3300049592 Ga0501076_0000012 Ga0501076_0000012_43344_43769 140
633 3300049592 Ga0501076_0002878 Ga0501076_0002878_6933_7358 140
634 3300049592 Ga0501076_0077598 Ga0501076_0077598_898_1320 140
635 3300049592 Ga0501076_0136162 Ga0501076_0136162_98_568 140
636 3300049592 Ga0501076_0148285 Ga0501076_0148285_304_726 140
637 3300049592 Ga0501076_0173942 Ga0501076_0173942_537_962 140
638 3300049592 Ga0501076_0283450 Ga0501076_0283450_836_1261 140
639 3300049592 Ga0501076_0558068 Ga0501076_0558068_192_617 140
640 3300049592 Ga0501076_0611806 Ga0501076_0611806_154_579 140
641 3300049592 Ga0501076_1277826 Ga0501076_1277826_10_435 140
642 3300049593 Ga0501077_0007666 Ga0501077_0007666_1823_2248 140
643 3300049593 Ga0501077_0033134 Ga0501077_0033134_284_709 140
644 3300049593 Ga0501077_0045888 Ga0501077_0045888_1607_2032 140
645 3300049593 Ga0501077_0086210 Ga0501077_0086210_959_1381 140
646 3300049593 Ga0501077_0095346 Ga0501077_0095346_541_966 140
647 3300049593 Ga0501077_0489828 Ga0501077_0489828_251_676 140
648 3300049593 Ga0501077_0509656 Ga0501077_0509656_337_759 140
649 3300049593 Ga0501077_0887102 Ga0501077_0887102_55_477 140
650 3300049741 Ga0501079_0001408 Ga0501079_0001408_14095_14520 140
651 3300049741 Ga0501079_0008164 Ga0501079_0008164_1704_2129 140
652 3300049741 Ga0501079_0028593 Ga0501079_0028593_1179_1604 140
653 3300049741 Ga0501079_0061478 Ga0501079_0061478_56_481 140
654 3300049741 Ga0501079_0073083 Ga0501079_0073083_1275_1697 140
655 3300049741 Ga0501079_0076362 Ga0501079_0076362_2118_2543 140
656 3300049741 Ga0501079_0086560 Ga0501079_0086560_1345_1770 140
657 3300049741 Ga0501079_0102595 Ga0501079_0102595_1747_2172 140
658 3300049741 Ga0501079_0159600 Ga0501079_0159600_436_861 140
659 3300049741 Ga0501079_0172787 Ga0501079_0172787_282_704 140
660 3300049741 Ga0501079_0737754 Ga0501079_0737754_201_626 140
661 3300049742 Ga0501080_0033964 Ga0501080_0033964_371_796 140
662 3300049742 Ga0501080_0060392 Ga0501080_0060392_793_1218 140
663 3300049742 Ga0501080_0073226 Ga0501080_0073226_177_602 140
664 3300049742 Ga0501080_0209044 Ga0501080_0209044_1182_1604 140
665 3300049742 Ga0501080_0224668 Ga0501080_0224668_1233_1658 140
666 3300049742 Ga0501080_0300936 Ga0501080_0300936_194_619 140
667 3300049742 Ga0501080_0399135 Ga0501080_0399135_653_1078 140
668 3300049742 Ga0501080_0576758 Ga0501080_0576758_390_815 140
669 3300049742 Ga0501080_0690141 Ga0501080_0690141_214_636 140
670 3300049743 Ga0501081_0003182 Ga0501081_0003182_8368_8793 140
671 3300049743 Ga0501081_0004031 Ga0501081_0004031_6694_7119 140
672 3300049743 Ga0501081_0052950 Ga0501081_0052950_834_1259 140
673 3300049743 Ga0501081_0072865 Ga0501081_0072865_904_1326 140
674 3300049743 Ga0501081_0080845 Ga0501081_0080845_1299_1724 140
675 3300049743 Ga0501081_0082082 Ga0501081_0082082_454_888 140
676 3300049743 Ga0501081_0082694 Ga0501081_0082694_375_797 140
677 3300049743 Ga0501081_0193785 Ga0501081_0193785_962_1387 140
678 3300049744 Ga0501083_0040424 Ga0501083_0040424_1605_2030 140
679 3300049744 Ga0501083_0459500 Ga0501083_0459500_319_741 140
680 3300049767 Ga0501270_065601 Ga0501270_065601_150_572 140
681 3300049822 Ga0501035_0281278 Ga0501035_0281278_19_444 140
682 3300049822 Ga0501035_0345517 Ga0501035_0345517_51_476 140
683 3300049822 Ga0501035_0405915 Ga0501035_0405915_385_810 140
684 3300049822 Ga0501035_1040239 Ga0501035_1040239_122_544 140
685 3300049824 Ga0501045_0000164 Ga0501045_0000164_2762_3187 140
686 3300049824 Ga0501045_0011986 Ga0501045_0011986_3596_4021 140
687 3300049824 Ga0501045_0042486 Ga0501045_0042486_491_916 140
688 3300049824 Ga0501045_0119512 Ga0501045_0119512_10_432 140
689 3300049824 Ga0501045_0141088 Ga0501045_0141088_1238_1663 140
690 3300049824 Ga0501045_0234833 Ga0501045_0234833_194_619 140
691 3300049824 Ga0501045_0879036 Ga0501045_0879036_125_547 140
692 3300049824 Ga0501045_0937593 Ga0501045_0937593_171_596 140
693 3300050507 nmdc:mga05p37_1022399_c1 nmdc:mga05p37_1022399_c1_395_820 140
694 3300050507 nmdc:mga05p37_103698_c1 nmdc:mga05p37_103698_c1_258_683 140
695 3300050507 nmdc:mga05p37_108840_c1 nmdc:mga05p37_108840_c1_799_1224 140
696 3300050507 nmdc:mga05p37_23238_c1 nmdc:mga05p37_23238_c1_7017_7439 140
697 3300050507 nmdc:mga05p37_277605_c1 nmdc:mga05p37_277605_c1_1031_1453 140
698 3300050507 nmdc:mga05p37_29115_c1 nmdc:mga05p37_29115_c1_4215_4640 140
699 3300050507 nmdc:mga05p37_347650_c1 nmdc:mga05p37_347650_c1_736_1158 140
700 3300050507 nmdc:mga05p37_37550_c1 nmdc:mga05p37_37550_c1_4348_4773 140
701 3300050507 nmdc:mga05p37_5092_c2 nmdc:mga05p37_5092_c2_12815_13240 140
702 3300050507 nmdc:mga05p37_53887_c1 nmdc:mga05p37_53887_c1_340_765 140
703 3300050507 nmdc:mga05p37_623076_c1 nmdc:mga05p37_623076_c1_155_580 140
704 3300050507 nmdc:mga05p37_89_c1 nmdc:mga05p37_89_c1_53521_53943 140
705 3300050508 nmdc:mga09592_108401_c1 nmdc:mga09592_108401_c1_1877_2302 140
706 3300050508 nmdc:mga09592_15687_c1 nmdc:mga09592_15687_c1_4059_4484 140
707 3300050508 nmdc:mga09592_17102_c1 nmdc:mga09592_17102_c1_4371_4796 140
708 3300050508 nmdc:mga09592_2605_c1 nmdc:mga09592_2605_c1_10230_10652 140
709 3300050508 nmdc:mga09592_71083_c1 nmdc:mga09592_71083_c1_2263_2685 140
710 3300050508 nmdc:mga09592_837_c1 nmdc:mga09592_837_c1_10161_10586 140
711 3300050509 nmdc:mga0qj67_10750_c1 nmdc:mga0qj67_10750_c1_4330_4755 140
712 3300050509 nmdc:mga0qj67_422069_c1 nmdc:mga0qj67_422069_c1_426_848 140
713 3300050509 nmdc:mga0qj67_798_c1 nmdc:mga0qj67_798_c1_1329_1754 140
714 3300050510 nmdc:mga06r32_1241285_c1 nmdc:mga06r32_1241285_c1_218_643 140
715 3300050510 nmdc:mga06r32_173146_c1 nmdc:mga06r32_173146_c1_899_1321 140
716 3300050510 nmdc:mga06r32_23011_c1 nmdc:mga06r32_23011_c1_1085_1510 140
717 3300050510 nmdc:mga06r32_298402_c1 nmdc:mga06r32_298402_c1_663_1085 140
718 3300050510 nmdc:mga06r32_471585_c1 nmdc:mga06r32_471585_c1_638_1063 140
719 3300050510 nmdc:mga06r32_49155_c1 nmdc:mga06r32_49155_c1_1294_1716 140
720 3300050510 nmdc:mga06r32_708379_c1 nmdc:mga06r32_708379_c1_202_624 140
721 3300050510 nmdc:mga06r32_978023_c1 nmdc:mga06r32_978023_c1_118_543 140
722 3300050511 nmdc:mga08y16_267845_c1 nmdc:mga08y16_267845_c1_1312_1737 140
723 3300050511 nmdc:mga08y16_47030_c1 nmdc:mga08y16_47030_c1_68_490 140
724 3300050511 nmdc:mga08y16_725081_c1 nmdc:mga08y16_725081_c1_444_869 140
725 3300050512 nmdc:mga0n895_126244_c1 nmdc:mga0n895_126244_c1_71_505 140
726 3300050512 nmdc:mga0n895_1298947_c1 nmdc:mga0n895_1298947_c1_15_440 140
727 3300050512 nmdc:mga0n895_203_c1 nmdc:mga0n895_203_c1_14297_14719 140
728 3300050512 nmdc:mga0n895_255128_c1 nmdc:mga0n895_255128_c1_1103_1525 140
729 3300050512 nmdc:mga0n895_3372_c1 nmdc:mga0n895_3372_c1_3247_3672 140
730 3300050512 nmdc:mga0n895_3902_c1 nmdc:mga0n895_3902_c1_4114_4539 140
731 3300050512 nmdc:mga0n895_709770_c1 nmdc:mga0n895_709770_c1_348_773 140
732 3300050513 nmdc:mga0rr50_1089720_c1 nmdc:mga0rr50_1089720_c1_63_497 140
733 3300050513 nmdc:mga0rr50_12498_c1 nmdc:mga0rr50_12498_c1_4328_4750 140
734 3300050513 nmdc:mga0rr50_1444_c1 nmdc:mga0rr50_1444_c1_4908_5333 140
735 3300050513 nmdc:mga0rr50_2675_c1 nmdc:mga0rr50_2675_c1_8133_8558 140
736 3300050513 nmdc:mga0rr50_39170_c1 nmdc:mga0rr50_39170_c1_1959_2384 140
737 3300050513 nmdc:mga0rr50_694_c1 nmdc:mga0rr50_694_c1_7655_8077 140
738 3300050513 nmdc:mga0rr50_90198_c1 nmdc:mga0rr50_90198_c1_125_550 140
739 3300050514 nmdc:mga08x19_1359344_c1 nmdc:mga08x19_1359344_c1_10_444 140
740 3300050514 nmdc:mga08x19_4220_c1 nmdc:mga08x19_4220_c1_8046_8471 140
741 3300050514 nmdc:mga08x19_470_c1 nmdc:mga08x19_470_c1_19945_20367 140
742 3300050514 nmdc:mga08x19_78615_c1 nmdc:mga08x19_78615_c1_1643_2068 140
743 3300050515 nmdc:mga0a205_13883_c1 nmdc:mga0a205_13883_c1_3839_4264 140
744 3300050515 nmdc:mga0a205_28094_c1 nmdc:mga0a205_28094_c1_4408_4833 140
745 3300050515 nmdc:mga0a205_35751_c1 nmdc:mga0a205_35751_c1_3513_3935 140
746 3300050515 nmdc:mga0a205_51316_c1 nmdc:mga0a205_51316_c1_2586_3008 140
747 3300050515 nmdc:mga0a205_60390_c1 nmdc:mga0a205_60390_c1_2604_3029 140
748 3300050515 nmdc:mga0a205_753791_c1 nmdc:mga0a205_753791_c1_268_693 140
749 3300050515 nmdc:mga0a205_9939_c1 nmdc:mga0a205_9939_c1_3175_3597 140
750 3300054114 Ga0501084_0000300 Ga0501084_0000300_31082_31507 140
751 3300054114 Ga0501084_0003591 Ga0501084_0003591_1064_1489 140
752 3300054114 Ga0501084_0005651 Ga0501084_0005651_3780_4205 140
753 3300054114 Ga0501084_0255730 Ga0501084_0255730_11_436 140
754 3300054114 Ga0501084_0285265 Ga0501084_0285265_737_1162 140
755 3300060353 Ga0501082_0003847 Ga0501082_0003847_8895_9320 140
756 3300060353 Ga0501082_0012227 Ga0501082_0012227_5089_5514 140
757 3300060353 Ga0501082_0088114 Ga0501082_0088114_1816_2241 140
758 3300060353 Ga0501082_0143390 Ga0501082_0143390_1297_1719 140
759 3300060353 Ga0501082_0598533 Ga0501082_0598533_503_925 140
760 3300060353 Ga0501082_0993473 Ga0501082_0993473_55_480 140
761 3300060353 Ga0501082_1651940 Ga0501082_1651940_59_484 140
762 3300060353 Ga0501082_1743550 Ga0501082_1743550_29_457 140
763 3300061734 Ga0530510_0000015 Ga0530510_0000015_73944_74369 140
764 3300061734 Ga0530510_0007543 Ga0530510_0007543_4896_5321 140
765 3300061734 Ga0530510_0010173 Ga0530510_0010173_1996_2424 140
766 3300061734 Ga0530510_0010662 Ga0530510_0010662_4481_4906 140
767 3300061734 Ga0530510_0011887 Ga0530510_0011887_3868_4293 140
768 3300061734 Ga0530510_0021593 Ga0530510_0021593_1444_1866 140
769 3300061734 Ga0530510_0059640 Ga0530510_0059640_954_1379 140
770 3300061734 Ga0530510_0124071 Ga0530510_0124071_608_1033 140
771 3300061734 Ga0530510_0472423 Ga0530510_0472423_329_754 140
772 3300061734 Ga0530510_0672897 Ga0530510_0672897_255_680 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00334

NDK

Nucleoside diphosphate kinase

4

138

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ay1-assembly5.cif.gz_E crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori 0.9921 3 137
6ay1-assembly8.cif.gz_H crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori 0.9877 1 137
6ay1-assembly7.cif.gz_G crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori 0.9852 3 137
6aes-assembly2.cif.gz_B crystal structure of nucleoside diphosphate kinase from pseudomonas aeruginosa at 3.55 a resolution. 0.9839 1 140
3zto-assembly1.cif.gz_A orthorhombic crystal form c222 of the aquifex aeolicus nucleoside diphosphate kinase 0.9831 1 137
ID Description Score Start End Superfamily
6ay1G00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9852 3 137 3.30.70.141
af_O88425_6_161_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.978 2 132 3.30.70.141
4w98A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9764 1 140 3.30.70.141
af_A0A0G2L2L7_25_106_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9733 3 78 3.30.70.141
af_C6T4F9_81_235_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9728 3 140 3.30.70.141
ID Description Score Start End GO Terms
AF-A0A2N6EU76-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 1.002 3 137 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A3M2CU60-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 1.002 3 137 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A2V8JZB2-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 1.001 3 137 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A2V9HHJ3-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 1.001 1 137 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A3M1S670-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 1.001 3 137 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872

Feature Viewer

pLDDT pTM Quality
96.75 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map