F480134

General Info

Members Datasets Scaffolds Average Seq Length
772 313 1544 391

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0000283|Ga0501038_0000283_31844_33013
Length 377
Sequence MPRRYIFSSESVGEGHPDKVAAQDPASRVACETFVKSNVVVIGGEITTKAKLDYEKIIRDSIREIGYVNDDDVFHADKVFITNLMTAQSPDIAQGVDSKKAKGKKTAEQGAGDQGLMFGYACNETPELMPAPVMFAHRLGRELTRIRKSGKVKWLRPDAKSQVSVVYEDGKPVAIKNVVISTQHAEGVEHAEIEKFCIEKVIKKVLPKAMLKDTEFLINPTGRFVIGGPQGDTGLTGRKIIVDSYGGSGRHGGGAFSGKDPSKVDRSAAYMGRYVAKNVVAAGLAAKCEVQFAYAIGHPQPVSVHIDTFGTNSVPEEKIEAAVLKTFSFKPADIVSQLDLLRPIYSKSTNYGHFGKEDVDLPWEKTDKAAALKKAAV

Samples

Sample ID Description Type Environment
1 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
107 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
108 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
112 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
172 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
173 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
174 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
175 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
176 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
177 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
178 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
179 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
180 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
181 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
182 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
183 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
184 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
185 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
188 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
189 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
190 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
193 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
194 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
195 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
200 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
201 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
202 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
203 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
204 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
205 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
206 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
207 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
208 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
209 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
210 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
211 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
215 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
216 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
227 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
228 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
229 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
230 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
231 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
232 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
233 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
234 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
241 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
242 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
243 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
244 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
245 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
246 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
247 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
248 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
249 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
250 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
251 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
252 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
253 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
254 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
255 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
258 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
259 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
260 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
264 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
270 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
271 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
272 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
284 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
285 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
286 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
287 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
288 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
289 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
290 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
291 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
292 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
293 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
296 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
297 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
304 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
305 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
306 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
307 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
308 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
309 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
310 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
311 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
312 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
313 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.3
Nodule 0
Rhizoplane 2.2
Rhizosphere 93.91
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501038_0000283 3300049574 Bacteria 43189
2 CNXas_1000006 3300000545 Bacteria 45010
3 JGI24743J22301_10002112 3300001991 Bacteria 2929
4 rootH2_10058531 3300003320 Bacteria 9903
5 rootH1_10082290 3300003323 Bacteria 6819
6 Ga0065712_10010936 3300005290 Bacteria 2449
7 Ga0065715_10004593 3300005293 Bacteria 12450
8 Ga0065715_10106685 3300005293 Bacteria 2814
9 Ga0070658_10112886 3300005327 Bacteria 2253
10 Ga0070658_10243766 3300005327 Bacteria 1524
11 Ga0070676_10000248 3300005328 Bacteria 23423
12 Ga0070676_10018573 3300005328 Bacteria 3855
13 Ga0070683_100020959 3300005329 Bacteria 5827
14 Ga0070683_100044685 3300005329 Bacteria 4086
15 Ga0070683_100076252 3300005329 Bacteria 3134
16 Ga0070690_100001952 3300005330 Bacteria 10971
17 Ga0070690_100005965 3300005330 Bacteria 6879
18 Ga0070690_100019930 3300005330 Bacteria 4080
19 Ga0070690_100038952 3300005330 Bacteria 3001
20 Ga0070670_100003759 3300005331 Bacteria 12636
21 Ga0070670_100007118 3300005331 Bacteria 9472
22 Ga0070670_100052459 3300005331 Bacteria 3503
23 Ga0070670_100102729 3300005331 Bacteria 2462
24 Ga0070670_100111012 3300005331 Bacteria 2363
25 Ga0070677_10000945 3300005333 Bacteria 9414
26 Ga0068869_100037138 3300005334 Bacteria 3463
27 Ga0068869_100076728 3300005334 Bacteria 2484
28 Ga0068869_100081226 3300005334 Bacteria 2420
29 Ga0070666_10003269 3300005335 Bacteria 9841
30 Ga0070666_10016731 3300005335 Bacteria 4694
31 Ga0070666_10028332 3300005335 Bacteria 3675
32 Ga0070680_100104796 3300005336 Bacteria 2350
33 Ga0068868_100006364 3300005338 Bacteria 8353
34 Ga0070689_100007599 3300005340 Bacteria 7593
35 Ga0070689_100022570 3300005340 Bacteria 4700
36 Ga0070689_100033784 3300005340 Bacteria 3899
37 Ga0070689_100135213 3300005340 Bacteria 1979
38 Ga0070687_100007310 3300005343 Bacteria 4594
39 Ga0070668_100013168 3300005347 Bacteria 6166
40 Ga0070669_100000734 3300005353 Bacteria 23917
41 Ga0070669_100001339 3300005353 Bacteria 17761
42 Ga0070669_100012556 3300005353 Bacteria 6007
43 Ga0070669_100013646 3300005353 Bacteria 5775
44 Ga0070669_100025602 3300005353 Bacteria 4238
45 Ga0070669_100046891 3300005353 Bacteria 3151
46 Ga0070669_100201606 3300005353 Bacteria 1566
47 Ga0070675_100000385 3300005354 Bacteria 29879
48 Ga0070675_100004509 3300005354 Bacteria 10639
49 Ga0070675_100011964 3300005354 Bacteria 6801
50 Ga0070675_100046877 3300005354 Bacteria 3541
51 Ga0070675_100161122 3300005354 Bacteria 1929
52 Ga0070675_100187306 3300005354 Bacteria 1792
53 Ga0070671_100002030 3300005355 Bacteria 15591
54 Ga0070671_100005839 3300005355 Bacteria 9805
55 Ga0070671_100019640 3300005355 Bacteria 5502
56 Ga0070671_100084709 3300005355 Bacteria 2651
57 Ga0070671_100238016 3300005355 Bacteria 1545
58 Ga0070671_100242228 3300005355 Bacteria 1531
59 Ga0070674_100035363 3300005356 Bacteria 3345
60 Ga0070674_100044756 3300005356 Bacteria 3020
61 Ga0070673_100011950 3300005364 Bacteria 5944
62 Ga0070673_100030705 3300005364 Bacteria 4026
63 Ga0070673_100218242 3300005364 Bacteria 1649
64 Ga0070688_100040518 3300005365 Bacteria 2855
65 Ga0070659_100008173 3300005366 Bacteria 7632
66 Ga0070659_100224660 3300005366 Bacteria 1551
67 Ga0070667_100008341 3300005367 Bacteria 8587
68 Ga0070667_100010590 3300005367 Bacteria 7613
69 Ga0070667_100014017 3300005367 Bacteria 6626
70 Ga0070667_100041943 3300005367 Bacteria 3838
71 Ga0070667_100233426 3300005367 Bacteria 1641
72 Ga0070709_10031703 3300005434 Bacteria 3181
73 Ga0070709_10122812 3300005434 Bacteria 1763
74 Ga0070713_100015569 3300005436 Bacteria 5694
75 Ga0070713_100035459 3300005436 Bacteria 4016
76 Ga0070713_100041314 3300005436 Bacteria 3757
77 Ga0070701_10008260 3300005438 Bacteria 4493
78 Ga0070701_10149754 3300005438 Bacteria 1342
79 Ga0070711_100049744 3300005439 Bacteria 2871
80 Ga0070705_100038204 3300005440 Bacteria 2714
81 Ga0070705_100045603 3300005440 Bacteria 2523
82 Ga0070705_100096312 3300005440 Bacteria 1857
83 Ga0070700_100019607 3300005441 Bacteria 3906
84 Ga0070700_100108782 3300005441 Bacteria 1839
85 Ga0070694_100072340 3300005444 Bacteria 2378
86 Ga0070708_100093738 3300005445 Bacteria 2738
87 Ga0070708_100222170 3300005445 Bacteria 1771
88 Ga0070678_100010174 3300005456 Bacteria 5733
89 Ga0070678_100028434 3300005456 Bacteria 3813
90 Ga0070662_100001586 3300005457 Bacteria 14046
91 Ga0070662_100050447 3300005457 Bacteria 3002
92 Ga0070662_100077716 3300005457 Bacteria 2463
93 Ga0070662_100214538 3300005457 Bacteria 1533
94 Ga0070662_100283070 3300005457 Bacteria 1342
95 Ga0068867_100019002 3300005459 Bacteria 4893
96 Ga0068867_100032408 3300005459 Bacteria 3780
97 Ga0070706_100028448 3300005467 Bacteria 5145
98 Ga0070706_100052958 3300005467 Bacteria 3745
99 Ga0070706_100104361 3300005467 Bacteria 2636
100 Ga0070706_100165591 3300005467 Unclassified 2064
101 Ga0070706_100222848 3300005467 Bacteria 1760
102 Ga0070706_100229837 3300005467 Bacteria 1732
103 Ga0070707_100015615 3300005468 Bacteria 7126
104 Ga0070707_100090337 3300005468 Bacteria 2965
105 Ga0070707_100137401 3300005468 Bacteria 2377
106 Ga0070707_100213082 3300005468 Bacteria 1882
107 Ga0070707_100240928 3300005468 Bacteria 1760
108 Ga0070698_100006205 3300005471 Bacteria 13015
109 Ga0070698_100009604 3300005471 Bacteria 10349
110 Ga0070698_100117811 3300005471 Bacteria 2618
111 Ga0070698_100144883 3300005471 Bacteria 2325
112 Ga0070699_100006320 3300005518 Bacteria 10330
113 Ga0070699_100133061 3300005518 Bacteria 2193
114 Ga0070699_100153004 3300005518 Unclassified 2041
115 Ga0070679_100098075 3300005530 Bacteria 2918
116 Ga0070697_100004942 3300005536 Bacteria 10234
117 Ga0070697_100011397 3300005536 Bacteria 6948
118 Ga0070697_100013435 3300005536 Bacteria 6423
119 Ga0070697_100042017 3300005536 Bacteria 3700
120 Ga0070697_100043197 3300005536 Bacteria 3648
121 Ga0070697_100044868 3300005536 Bacteria 3581
122 Ga0070697_100053225 3300005536 Bacteria 3290
123 Ga0070697_100058002 3300005536 Bacteria 3150
124 Ga0070697_100091930 3300005536 Bacteria 2509
125 Ga0070697_100130945 3300005536 Bacteria 2103
126 Ga0070697_100176164 3300005536 Bacteria 1812
127 Ga0070697_100218703 3300005536 Bacteria 1623
128 Ga0068853_100000079 3300005539 Bacteria 66544
129 Ga0070672_100000689 3300005543 Bacteria 19943
130 Ga0070672_100105671 3300005543 Bacteria 2289
131 Ga0070672_100109048 3300005543 Bacteria 2254
132 Ga0070672_100141531 3300005543 Bacteria 1984
133 Ga0070686_100007164 3300005544 Bacteria 6214
134 Ga0070686_100018329 3300005544 Bacteria 4106
135 Ga0070686_100020856 3300005544 Bacteria 3884
136 Ga0070665_100000048 3300005548 Bacteria 265077
137 Ga0070665_100047072 3300005548 Bacteria 4329
138 Ga0070665_100148258 3300005548 Bacteria 2349
139 Ga0070665_100353650 3300005548 Bacteria 1475
140 Ga0068855_100004472 3300005563 Bacteria 17078
141 Ga0068855_100111785 3300005563 Bacteria 3136
142 Ga0070664_100001259 3300005564 Bacteria 20292
143 Ga0068856_100000961 3300005614 Bacteria 30770
144 Ga0068856_100001550 3300005614 Bacteria 24054
145 Ga0068856_100004953 3300005614 Bacteria 13183
146 Ga0068856_100020194 3300005614 Bacteria 6470
147 Ga0068856_100046781 3300005614 Bacteria 4262
148 Ga0068856_100076849 3300005614 Bacteria 3308
149 Ga0068856_100133460 3300005614 Bacteria 2488
150 Ga0068856_100165529 3300005614 Bacteria 2222
151 Ga0068852_100052745 3300005616 Bacteria 3497
152 Ga0068859_100034128 3300005617 Bacteria 5107
153 Ga0068859_100061487 3300005617 Bacteria 3784
154 Ga0068861_100022665 3300005719 Bacteria 4527
155 Ga0068851_10108334 3300005834 Bacteria 1481
156 Ga0068870_10001437 3300005840 Bacteria 9631
157 Ga0068870_10023918 3300005840 Bacteria 3018
158 Ga0068863_100000231 3300005841 Bacteria 59096
159 Ga0068863_100094940 3300005841 Bacteria 2831
160 Ga0068858_100037048 3300005842 Bacteria 4521
161 Ga0068858_100074413 3300005842 Bacteria 3154
162 Ga0068858_100194680 3300005842 Bacteria 1916
163 Ga0068860_100003161 3300005843 Bacteria 17000
164 Ga0068860_100019432 3300005843 Bacteria 6589
165 Ga0068860_100065930 3300005843 Bacteria 3438
166 Ga0068860_100102955 3300005843 Bacteria 2725
167 Ga0068862_100001194 3300005844 Bacteria 24496
168 Ga0068862_100006381 3300005844 Bacteria 9803
169 Ga0081540_1027033 3300005983 Bacteria 3260
170 Ga0070717_10000337 3300006028 Bacteria 30235
171 Ga0070717_10013743 3300006028 Bacteria 6212
172 Ga0075363_100003320 3300006048 Bacteria 6823
173 Ga0070715_10067557 3300006163 Bacteria 1587
174 Ga0070716_100016089 3300006173 Bacteria 3855
175 Ga0075362_10002457 3300006177 Bacteria 6233
176 Ga0097621_100024987 3300006237 Bacteria 4671
177 Ga0068871_100004235 3300006358 Bacteria 9939
178 Ga0068871_100065745 3300006358 Bacteria 2971
179 Ga0068871_100111132 3300006358 Bacteria 2305
180 Ga0068871_100144642 3300006358 Bacteria 2023
181 Ga0068871_100291468 3300006358 Bacteria 1430
182 Ga0075428_100000842 3300006844 Bacteria 32151
183 Ga0075428_100000957 3300006844 Bacteria 30618
184 Ga0075428_100014998 3300006844 Bacteria 8612
185 Ga0075428_100276409 3300006844 Bacteria 1807
186 Ga0075430_100000572 3300006846 Bacteria 27946
187 Ga0075431_100000551 3300006847 Bacteria 31528
188 Ga0075431_100013493 3300006847 Bacteria 8252
189 Ga0075431_100016348 3300006847 Bacteria 7528
190 Ga0075431_100226337 3300006847 Bacteria 1907
191 Ga0075433_10005810 3300006852 Bacteria 9712
192 Ga0075434_100139686 3300006871 Bacteria 2442
193 Ga0075429_100008849 3300006880 Bacteria 8750
194 Ga0075429_100017823 3300006880 Bacteria 6140
195 Ga0075429_100060993 3300006880 Bacteria 3285
196 Ga0075429_100098972 3300006880 Bacteria 2545
197 Ga0068865_100002562 3300006881 Bacteria 10784
198 Ga0068865_100012360 3300006881 Bacteria 5373
199 Ga0068865_100012941 3300006881 Bacteria 5262
200 Ga0068865_100016987 3300006881 Bacteria 4671
201 Ga0068865_100048046 3300006881 Bacteria 2935
202 Ga0097620_100034129 3300006931 Bacteria 5107
203 Ga0097620_100061487 3300006931 Bacteria 3784
204 Ga0075435_100038469 3300007076 Bacteria 3814
205 Ga0105240_10000578 3300009093 Bacteria 68020
206 Ga0105240_10018969 3300009093 Bacteria 9210
207 Ga0105240_10024257 3300009093 Bacteria 8003
208 Ga0111539_10011336 3300009094 Bacteria 11198
209 Ga0111539_10018172 3300009094 Bacteria 8709
210 Ga0111539_10022992 3300009094 Bacteria 7654
211 Ga0111539_10136543 3300009094 Bacteria 2872
212 Ga0105245_10077641 3300009098 Bacteria 3028
213 Ga0105247_10056209 3300009101 Bacteria 2430
214 Ga0105243_10042829 3300009148 Bacteria 3546
215 Ga0105242_10011774 3300009176 Bacteria 6731
216 Ga0105242_10059708 3300009176 Bacteria 3130
217 Ga0105248_10031471 3300009177 Bacteria 5930
218 Ga0105248_10123291 3300009177 Bacteria 2923
219 Ga0105248_10168372 3300009177 Bacteria 2470
220 Ga0105248_10193931 3300009177 Bacteria 2289
221 Ga0105237_10051331 3300009545 Bacteria 4142
222 Ga0105238_10012956 3300009551 Bacteria 8417
223 Ga0105238_10029076 3300009551 Bacteria 5630
224 Ga0105238_10035744 3300009551 Bacteria 5050
225 Ga0105238_10053462 3300009551 Bacteria 4058
226 Ga0105249_10002500 3300009553 Bacteria 15914
227 Ga0105249_10004793 3300009553 Bacteria 11677
228 Ga0099796_10013520 3300010159 Bacteria 2333
229 Ga0105239_10015469 3300010375 Bacteria 8452
230 Ga0105239_10028110 3300010375 Bacteria 6188
231 Ga0105246_10144762 3300011119 Bacteria 1792
232 Ga0157315_1000356 3300012508 Bacteria 2045
233 Ga0157371_10158459 3300013102 Bacteria 1616
234 Ga0157369_10459609 3300013105 Bacteria 1318
235 Ga0157374_10002188 3300013296 Bacteria 16472
236 Ga0157374_10109684 3300013296 Bacteria 2653
237 Ga0157374_10116951 3300013296 Bacteria 2570
238 Ga0157374_10187887 3300013296 Bacteria 2020
239 Ga0157374_10235593 3300013296 Bacteria 1799
240 Ga0157378_10003931 3300013297 Bacteria 13148
241 Ga0157378_10097110 3300013297 Bacteria 2685
242 Ga0163162_10002397 3300013306 Bacteria 17627
243 Ga0163162_10004313 3300013306 Bacteria 13697
244 Ga0163162_10008137 3300013306 Bacteria 10233
245 Ga0163162_10062888 3300013306 Bacteria 3753
246 Ga0163162_10237327 3300013306 Bacteria 1954
247 Ga0163162_10275792 3300013306 Bacteria 1813
248 Ga0157372_10038792 3300013307 Bacteria 5257
249 Ga0157372_10169624 3300013307 Bacteria 2525
250 Ga0157372_10494396 3300013307 Bacteria 1426
251 Ga0157375_10001096 3300013308 Bacteria 23478
252 Ga0157375_10003082 3300013308 Bacteria 14472
253 Ga0157375_10109581 3300013308 Bacteria 2857
254 Ga0157375_10125141 3300013308 Bacteria 2685
255 Ga0163163_10000067 3300014325 Bacteria 114831
256 Ga0163163_10011575 3300014325 Bacteria 8012
257 Ga0163163_10032001 3300014325 Bacteria 5079
258 Ga0163163_10306182 3300014325 Bacteria 1641
259 Ga0157380_10016988 3300014326 Bacteria 5375
260 Ga0157380_10370240 3300014326 Bacteria 1348
261 Ga0157377_10029482 3300014745 Bacteria 2963
262 Ga0157379_10035666 3300014968 Bacteria 4434
263 Ga0157376_10008613 3300014969 Bacteria 7373
264 Ga0163161_10171737 3300017792 Bacteria 1658
265 Ga0213873_10030059 3300021358 Bacteria 1343
266 Ga0213872_10028109 3300021361 Bacteria 2580
267 Ga0213872_10096550 3300021361 Bacteria 1319
268 Ga0213874_10002921 3300021377 Bacteria 3732
269 Ga0213876_10003848 3300021384 Bacteria 8498
270 Ga0213876_10006562 3300021384 Bacteria 6344
271 Ga0207666_1000889 3300025271 Bacteria 3583
272 Ga0207666_1001615 3300025271 Bacteria 2668
273 Ga0207673_1008078 3300025290 Bacteria 1328
274 Ga0209050_1004972 3300025298 Bacteria 8653
275 Ga0207697_10000302 3300025315 Bacteria 27561
276 Ga0207697_10000444 3300025315 Bacteria 23320
277 Ga0207697_10000466 3300025315 Bacteria 22833
278 Ga0207697_10000701 3300025315 Bacteria 19066
279 Ga0207697_10025351 3300025315 Bacteria 2424
280 Ga0207682_10000378 3300025893 Bacteria 20628
281 Ga0207682_10057669 3300025893 Bacteria 1619
282 Ga0207692_10060286 3300025898 Bacteria 1962
283 Ga0207642_10001476 3300025899 Bacteria 7272
284 Ga0207688_10000628 3300025901 Bacteria 17382
285 Ga0207688_10004479 3300025901 Bacteria 7605
286 Ga0207688_10150080 3300025901 Bacteria 1376
287 Ga0207680_10011142 3300025903 Bacteria 4531
288 Ga0207685_10038566 3300025905 Bacteria 1767
289 Ga0207699_10004830 3300025906 Bacteria 6450
290 Ga0207699_10081388 3300025906 Bacteria 2009
291 Ga0207645_10001125 3300025907 Bacteria 22125
292 Ga0207645_10001285 3300025907 Bacteria 20617
293 Ga0207645_10001911 3300025907 Bacteria 16819
294 Ga0207645_10009322 3300025907 Bacteria 6798
295 Ga0207645_10029101 3300025907 Bacteria 3562
296 Ga0207643_10000925 3300025908 Bacteria 17575
297 Ga0207643_10033706 3300025908 Bacteria 2866
298 Ga0207643_10084003 3300025908 Bacteria 1848
299 Ga0207684_10000347 3300025910 Bacteria 64001
300 Ga0207684_10028724 3300025910 Bacteria 4737
301 Ga0207695_10000484 3300025913 Bacteria 85269
302 Ga0207695_10003866 3300025913 Bacteria 20720
303 Ga0207695_10018725 3300025913 Bacteria 7994
304 Ga0207695_10113244 3300025913 Bacteria 2689
305 Ga0207695_10181846 3300025913 Bacteria 2023
306 Ga0207695_10340342 3300025913 Bacteria 1388
307 Ga0207693_10001355 3300025915 Bacteria 21674
308 Ga0207693_10037096 3300025915 Bacteria 3841
309 Ga0207663_10006155 3300025916 Bacteria 6112
310 Ga0207663_10065512 3300025916 Bacteria 2323
311 Ga0207662_10000375 3300025918 Bacteria 20156
312 Ga0207649_10027532 3300025920 Bacteria 3336
313 Ga0207646_10000985 3300025922 Bacteria 36586
314 Ga0207646_10075150 3300025922 Bacteria 3019
315 Ga0207646_10115211 3300025922 Bacteria 2414
316 Ga0207646_10288283 3300025922 Bacteria 1483
317 Ga0207681_10002979 3300025923 Bacteria 10645
318 Ga0207681_10039064 3300025923 Bacteria 3148
319 Ga0207681_10043631 3300025923 Bacteria 3002
320 Ga0207681_10127834 3300025923 Bacteria 1874
321 Ga0207681_10206194 3300025923 Bacteria 1512
322 Ga0207694_10019987 3300025924 Bacteria 5066
323 Ga0207694_10038422 3300025924 Bacteria 3680
324 Ga0207650_10002921 3300025925 Bacteria 11797
325 Ga0207650_10024299 3300025925 Bacteria 4306
326 Ga0207650_10026880 3300025925 Bacteria 4111
327 Ga0207659_10002399 3300025926 Bacteria 11146
328 Ga0207659_10008013 3300025926 Bacteria 6535
329 Ga0207659_10025879 3300025926 Bacteria 3951
330 Ga0207659_10059552 3300025926 Bacteria 2745
331 Ga0207659_10138242 3300025926 Bacteria 1888
332 Ga0207687_10135953 3300025927 Bacteria 1859
333 Ga0207700_10036126 3300025928 Bacteria 3565
334 Ga0207700_10040007 3300025928 Bacteria 3418
335 Ga0207644_10007239 3300025931 Bacteria 7221
336 Ga0207644_10034472 3300025931 Bacteria 3542
337 Ga0207644_10149881 3300025931 Bacteria 1804
338 Ga0207706_10002111 3300025933 Bacteria 19453
339 Ga0207706_10005892 3300025933 Bacteria 11400
340 Ga0207706_10021939 3300025933 Bacteria 5731
341 Ga0207706_10100357 3300025933 Bacteria 2546
342 Ga0207706_10124794 3300025933 Bacteria 2265
343 Ga0207706_10215392 3300025933 Bacteria 1682
344 Ga0207686_10025368 3300025934 Bacteria 3447
345 Ga0207670_10004378 3300025936 Bacteria 7593
346 Ga0207670_10030875 3300025936 Bacteria 3426
347 Ga0207669_10184898 3300025937 Bacteria 1498
348 Ga0207704_10006332 3300025938 Bacteria 5514
349 Ga0207704_10058320 3300025938 Bacteria 2377
350 Ga0207665_10026355 3300025939 Bacteria 3838
351 Ga0207691_10000116 3300025940 Bacteria 71833
352 Ga0207691_10005381 3300025940 Bacteria 12358
353 Ga0207691_10008777 3300025940 Bacteria 9694
354 Ga0207691_10050836 3300025940 Bacteria 3793
355 Ga0207691_10177028 3300025940 Bacteria 1865
356 Ga0207711_10146709 3300025941 Bacteria 2126
357 Ga0207711_10267964 3300025941 Bacteria 1571
358 Ga0207689_10000045 3300025942 Bacteria 92506
359 Ga0207689_10001594 3300025942 Bacteria 21468
360 Ga0207689_10011387 3300025942 Bacteria 7622
361 Ga0207689_10072457 3300025942 Bacteria 2830
362 Ga0207661_10052689 3300025944 Bacteria 3252
363 Ga0207661_10141595 3300025944 Bacteria 2070
364 Ga0207679_10021819 3300025945 Bacteria 4349
365 Ga0207667_10000717 3300025949 Bacteria 43005
366 Ga0207667_10105736 3300025949 Bacteria 2904
367 Ga0207651_10032287 3300025960 Bacteria 3361
368 Ga0207651_10056749 3300025960 Bacteria 2697
369 Ga0207651_10057094 3300025960 Bacteria 2690
370 Ga0207712_10011699 3300025961 Bacteria 5596
371 Ga0207712_10018503 3300025961 Bacteria 4539
372 Ga0207668_10002463 3300025972 Bacteria 10811
373 Ga0207668_10018590 3300025972 Bacteria 4378
374 Ga0207668_10115075 3300025972 Bacteria 2025
375 Ga0207640_10079265 3300025981 Bacteria 2238
376 Ga0207658_10004538 3300025986 Bacteria 9641
377 Ga0207658_10058261 3300025986 Bacteria 2873
378 Ga0207658_10078875 3300025986 Bacteria 2517
379 Ga0207677_10009748 3300026023 Bacteria 5410
380 Ga0207677_10077060 3300026023 Bacteria 2376
381 Ga0207639_10000046 3300026041 Bacteria 134165
382 Ga0207639_10293964 3300026041 Unclassified 1433
383 Ga0207678_10015983 3300026067 Bacteria 6591
384 Ga0207708_10049366 3300026075 Bacteria 3204
385 Ga0207708_10121751 3300026075 Bacteria 2033
386 Ga0207702_10015097 3300026078 Bacteria 6404
387 Ga0207702_10027128 3300026078 Bacteria 4755
388 Ga0207641_10009098 3300026088 Bacteria 8204
389 Ga0207641_10040413 3300026088 Bacteria 3906
390 Ga0207641_10044700 3300026088 Bacteria 3725
391 Ga0207641_10210708 3300026088 Bacteria 1797
392 Ga0207648_10000163 3300026089 Bacteria 68352
393 Ga0207648_10018129 3300026089 Bacteria 6377
394 Ga0207648_10031472 3300026089 Bacteria 4691
395 Ga0207648_10039286 3300026089 Bacteria 4161
396 Ga0207648_10089838 3300026089 Bacteria 2684
397 Ga0207648_10150952 3300026089 Bacteria 2050
398 Ga0207676_10143199 3300026095 Bacteria 2049
399 Ga0207676_10160650 3300026095 Bacteria 1946
400 Ga0207674_10021486 3300026116 Bacteria 6950
401 Ga0207674_10051550 3300026116 Bacteria 4199
402 Ga0207674_10082582 3300026116 Bacteria 3214
403 Ga0207674_10092314 3300026116 Bacteria 3017
404 Ga0207674_10289202 3300026116 Bacteria 1587
405 Ga0207675_100049102 3300026118 Bacteria 3939
406 Ga0207675_100166534 3300026118 Bacteria 2105
407 Ga0207675_100212668 3300026118 Bacteria 1861
408 Ga0207675_100268464 3300026118 Bacteria 1655
409 Ga0207683_10003680 3300026121 Bacteria 13322
410 Ga0207683_10013903 3300026121 Bacteria 6863
411 Ga0207683_10079661 3300026121 Bacteria 2904
412 Ga0207698_10134699 3300026142 Bacteria 2118
413 Ga0207698_10465447 3300026142 Bacteria 1223
414 Ga0209974_10018010 3300027876 Bacteria 2342
415 Ga0207428_10001377 3300027907 Bacteria 25761
416 Ga0207428_10023301 3300027907 Bacteria 5208
417 Ga0207428_10067214 3300027907 Bacteria 2822
418 Ga0268266_10000358 3300028379 Bacteria 70786
419 Ga0268266_10021477 3300028379 Bacteria 5498
420 Ga0268266_10113144 3300028379 Bacteria 2407
421 Ga0268265_10006705 3300028380 Bacteria 7793
422 Ga0268265_10134902 3300028380 Bacteria 2057
423 Ga0268265_10232575 3300028380 Bacteria 1621
424 Ga0268264_10000626 3300028381 Bacteria 42069
425 Ga0268264_10001797 3300028381 Bacteria 19617
426 Ga0268264_10199341 3300028381 Bacteria 1830
427 Ga0268264_10243278 3300028381 Bacteria 1667
428 Ga0268264_10369533 3300028381 Bacteria 1370
429 Ga0265337_1007706 3300028556 Bacteria 3999
430 Ga0265337_1010912 3300028556 Bacteria 3158
431 Ga0265337_1017648 3300028556 Bacteria 2284
432 Ga0265337_1022920 3300028556 Bacteria 1927
433 Ga0265319_1000001 3300028563 Bacteria 549513
434 Ga0265319_1000043 3300028563 Bacteria 109696
435 Ga0265319_1004241 3300028563 Bacteria 7153
436 Ga0265319_1007717 3300028563 Bacteria 4801
437 Ga0265319_1011357 3300028563 Bacteria 3651
438 Ga0265319_1012262 3300028563 Bacteria 3473
439 Ga0265319_1023933 3300028563 Bacteria 2206
440 Ga0265319_1037439 3300028563 Bacteria 1653
441 Ga0265318_10000006 3300028577 Bacteria 285591
442 Ga0265318_10001709 3300028577 Bacteria 12570
443 Ga0265318_10001747 3300028577 Bacteria 12409
444 Ga0265318_10005162 3300028577 Bacteria 6168
445 Ga0265323_10000009 3300028653 Bacteria 115038
446 Ga0265323_10001134 3300028653 Bacteria 13719
447 Ga0265323_10002342 3300028653 Bacteria 8748
448 Ga0265323_10002635 3300028653 Bacteria 8131
449 Ga0265323_10003339 3300028653 Bacteria 7117
450 Ga0265323_10004770 3300028653 Bacteria 5812
451 Ga0265323_10010839 3300028653 Bacteria 3691
452 Ga0265323_10011083 3300028653 Bacteria 3642
453 Ga0265322_10005955 3300028654 Bacteria 3592
454 Ga0265322_10016293 3300028654 Bacteria 2145
455 Ga0265336_10006198 3300028666 Bacteria 4332
456 Ga0265336_10007689 3300028666 Bacteria 3822
457 Ga0265336_10014556 3300028666 Bacteria 2605
458 Ga0265336_10021469 3300028666 Bacteria 2064
459 Ga0265338_10000138 3300028800 Bacteria 135457
460 Ga0265338_10000242 3300028800 Bacteria 101378
461 Ga0265338_10000282 3300028800 Bacteria 91694
462 Ga0265338_10000722 3300028800 Bacteria 56495
463 Ga0265338_10001585 3300028800 Bacteria 36540
464 Ga0265338_10001988 3300028800 Bacteria 31801
465 Ga0265338_10002610 3300028800 Bacteria 26620
466 Ga0265338_10003663 3300028800 Bacteria 21403
467 Ga0265338_10005035 3300028800 Bacteria 17457
468 Ga0265338_10011789 3300028800 Bacteria 10049
469 Ga0265338_10012495 3300028800 Bacteria 9676
470 Ga0265338_10012686 3300028800 Bacteria 9589
471 Ga0265338_10016374 3300028800 Bacteria 8074
472 Ga0265338_10025244 3300028800 Bacteria 6039
473 Ga0265338_10025370 3300028800 Bacteria 6017
474 Ga0265338_10036839 3300028800 Bacteria 4672
475 Ga0265338_10091928 3300028800 Bacteria 2504
476 Ga0265338_10238997 3300028800 Bacteria 1346
477 Ga0265324_10000119 3300029957 Bacteria 62736
478 Ga0265324_10000877 3300029957 Bacteria 19266
479 Ga0265324_10002642 3300029957 Bacteria 8977
480 Ga0265324_10007228 3300029957 Bacteria 4529
481 Ga0265324_10015776 3300029957 Bacteria 2773
482 Ga0265324_10035084 3300029957 Bacteria 1746
483 Ga0307511_10000007 3300030521 Bacteria 167546
484 Ga0265330_10014205 3300031235 Bacteria 3697
485 Ga0265330_10031190 3300031235 Bacteria 2389
486 Ga0265328_10005430 3300031239 Bacteria 5458
487 Ga0265320_10000595 3300031240 Bacteria 27781
488 Ga0265320_10001368 3300031240 Bacteria 17761
489 Ga0265320_10003752 3300031240 Bacteria 10111
490 Ga0265320_10004727 3300031240 Bacteria 8872
491 Ga0265320_10004860 3300031240 Bacteria 8727
492 Ga0265320_10009158 3300031240 Bacteria 5993
493 Ga0265320_10010667 3300031240 Bacteria 5452
494 Ga0265320_10011712 3300031240 Bacteria 5147
495 Ga0265320_10016570 3300031240 Bacteria 4124
496 Ga0265320_10017941 3300031240 Bacteria 3910
497 Ga0265320_10034680 3300031240 Bacteria 2564
498 Ga0265320_10079164 3300031240 Bacteria 1536
499 Ga0265325_10027125 3300031241 Bacteria 3099
500 Ga0265325_10061165 3300031241 Bacteria 1911
501 Ga0265325_10070186 3300031241 Bacteria 1760
502 Ga0265329_10003181 3300031242 Bacteria 7220
503 Ga0265340_10003129 3300031247 Bacteria 9383
504 Ga0265339_10011008 3300031249 Bacteria 5591
505 Ga0265339_10027359 3300031249 Bacteria 3255
506 Ga0265331_10005132 3300031250 Bacteria 7978
507 Ga0265331_10012876 3300031250 Bacteria 4512
508 Ga0265331_10026401 3300031250 Bacteria 2920
509 Ga0265327_10000057 3300031251 Bacteria 242754
510 Ga0265327_10001054 3300031251 Bacteria 38537
511 Ga0265327_10005748 3300031251 Bacteria 10220
512 Ga0265327_10006381 3300031251 Bacteria 9443
513 Ga0265327_10045869 3300031251 Bacteria 2319
514 Ga0265316_10003432 3300031344 Bacteria 16028
515 Ga0265316_10016369 3300031344 Bacteria 6433
516 Ga0265316_10019696 3300031344 Bacteria 5763
517 Ga0265316_10030127 3300031344 Bacteria 4452
518 Ga0265316_10047150 3300031344 Bacteria 3410
519 Ga0265316_10047871 3300031344 Bacteria 3379
520 Ga0265316_10049264 3300031344 Bacteria 3319
521 Ga0265316_10114582 3300031344 Bacteria 2039
522 Ga0265316_10154166 3300031344 Bacteria 1720
523 Ga0265316_10211900 3300031344 Bacteria 1432
524 Ga0307513_10028717 3300031456 Bacteria 6354
525 Ga0307408_100000053 3300031548 Bacteria 147370
526 Ga0307408_100062510 3300031548 Bacteria 2721
527 Ga0265313_10000235 3300031595 Bacteria 60074
528 Ga0265313_10004169 3300031595 Bacteria 11224
529 Ga0265313_10004255 3300031595 Bacteria 11096
530 Ga0265313_10005748 3300031595 Bacteria 9026
531 Ga0265313_10006169 3300031595 Bacteria 8597
532 Ga0265313_10008039 3300031595 Bacteria 7066
533 Ga0265313_10023358 3300031595 Bacteria 3331
534 Ga0265313_10029220 3300031595 Bacteria 2854
535 Ga0307508_10000054 3300031616 Bacteria 127800
536 Ga0265314_10000251 3300031711 Bacteria 79144
537 Ga0265314_10001813 3300031711 Bacteria 23039
538 Ga0265314_10003093 3300031711 Bacteria 16384
539 Ga0265314_10005666 3300031711 Bacteria 11218
540 Ga0265314_10023426 3300031711 Bacteria 4708
541 Ga0265342_10012810 3300031712 Bacteria 5661
542 Ga0265342_10017893 3300031712 Bacteria 4601
543 Ga0265342_10030508 3300031712 Bacteria 3340
544 Ga0265342_10030802 3300031712 Bacteria 3321
545 Ga0265342_10093602 3300031712 Bacteria 1720
546 Ga0307409_100000002 3300031995 Bacteria 93798
547 Ga0307416_100011718 3300032002 Bacteria 5870
548 Ga0307411_10134472 3300032005 Bacteria 1813
549 Ga0373930_0000978 3300034816 Bacteria 4105
550 Ga0373950_0001082 3300034818 Bacteria 3478
551 Ga0373926_0027134 3300035083 Bacteria 2005
552 Ga0373928_0000312 3300035084 Bacteria 9671
553 Ga0373929_0000193 3300035085 Bacteria 10902
554 Ga0373940_0020953 3300035088 Bacteria 1666
555 Ga0373944_0000573 3300035089 Bacteria 8715
556 Ga0373944_0026721 3300035089 Bacteria 1707
557 Ga0373949_0003818 3300035090 Bacteria 3513
558 Ga0373951_0001760 3300035091 Bacteria 5639
559 Ga0373932_0000006 3300035112 Bacteria 208547
560 Ga0373954_0011485 3300035118 Bacteria 3926
561 Ga0373954_0051418 3300035118 Bacteria 1935
562 Ga0373956_0008869 3300035119 Bacteria 4074
563 Ga0373956_0059606 3300035119 Bacteria 1727
564 Ga0373943_0021278 3300035170 Bacteria 2994
565 Ga0373931_0000009 3300035691 Bacteria 349854
566 Ga0373931_0089685 3300035691 Bacteria 1711
567 Ga0373931_0132910 3300035691 Bacteria 1434
568 Ga0373935_0033697 3300035692 Bacteria 3189
569 Ga0373935_0126451 3300035692 Bacteria 1713
570 Ga0373927_0009094 3300035695 Bacteria 6667
571 Ga0373927_0017568 3300035695 Bacteria 4707
572 Ga0373927_0028762 3300035695 Bacteria 3625
573 Ga0373927_0103564 3300035695 Bacteria 1852
574 Ga0373927_0122267 3300035695 Bacteria 1699
575 Ga0373933_0028896 3300035724 Bacteria 3201
576 Ga0373947_0032638 3300035725 Bacteria 3070
577 Ga0373947_0042133 3300035725 Bacteria 2725
578 Ga0373947_0056616 3300035725 Bacteria 2370
579 Ga0373937_0022484 3300036401 Bacteria 5670
580 Ga0373937_0163520 3300036401 Bacteria 2087
581 Ga0373925_0001741 3300037068 Bacteria 18257
582 Ga0373925_0003544 3300037068 Bacteria 12040
583 Ga0373925_0151307 3300037068 Bacteria 1822
584 Ga0395899_0000020 3300037312 Bacteria 404354
585 Ga0395900_0024890 3300037418 Bacteria 6126
586 Ga0395898_0000005 3300037466 Bacteria 621247
587 Ga0395905_0000010 3300037471 Bacteria 460729
588 Ga0395905_0132505 3300037471 Bacteria 2344
589 Ga0436364_0647265 3300037853 Bacteria 3544
590 Ga0436364_1476831 3300037853 Bacteria 3572
591 Ga0395901_0385257 3300038443 Bacteria 1442
592 Ga0436365_0441002 3300039437 Bacteria 19263
593 Ga0436365_0544830 3300039437 Bacteria 22244
594 Ga0436365_1068943 3300039437 Bacteria 3880
595 Ga0436365_1292648 3300039437 Bacteria 7784
596 Ga0436360_0740666 3300039438 Bacteria 5218
597 Ga0436361_0047446 3300039447 Bacteria 1886
598 Ga0436361_0188547 3300039447 Bacteria 3350
599 Ga0436361_0241484 3300039447 Bacteria 3076
600 Ga0436361_0527722 3300039447 Bacteria 10136
601 Ga0436361_1046901 3300039447 Bacteria 1342
602 Ga0436361_1140109 3300039447 Bacteria 21949
603 Ga0436363_0784473 3300039450 Bacteria 24841
604 Ga0436363_1318228 3300039450 Bacteria 11987
605 Ga0436362_0387322 3300039453 Bacteria 1375
606 Ga0436362_0798909 3300039453 Bacteria 2148
607 Ga0451577_0000012 3300042876 Bacteria 575467
608 Ga0451577_0001703 3300042876 Bacteria 28368
609 Ga0451577_0030786 3300042876 Bacteria 4845
610 Ga0451577_0261225 3300042876 Bacteria 1568
611 Ga0451577_0283042 3300042876 Bacteria 1502
612 Ga0453683_0000403 3300044673 Bacteria 50902
613 Ga0453683_0170594 3300044673 Bacteria 1378
614 Ga0453684_0000001 3300044712 Bacteria 2623166
615 Ga0453684_0000192 3300044712 Bacteria 266757
616 Ga0453684_0004565 3300044712 Bacteria 28951
617 Ga0453684_0009020 3300044712 Bacteria 17605
618 Ga0453684_0010410 3300044712 Bacteria 15914
619 Ga0453684_0020798 3300044712 Bacteria 9862
620 Ga0453684_0069855 3300044712 Bacteria 4452
621 Ga0453684_0212683 3300044712 Bacteria 2246
622 Ga0466971_0000006 3300044719 Bacteria 128202
623 Ga0466957_0004898 3300044842 Bacteria 7492
624 Ga0466957_0043655 3300044842 Bacteria 2715
625 Ga0451576_0008755 3300045051 Bacteria 11842
626 Ga0451576_0029476 3300045051 Bacteria 5872
627 Ga0451576_0031424 3300045051 Bacteria 5660
628 Ga0451576_0048179 3300045051 Bacteria 4478
629 Ga0451576_0090804 3300045051 Bacteria 3177
630 Ga0451576_0117822 3300045051 Bacteria 2765
631 Ga0451576_0225816 3300045051 Bacteria 1955
632 Ga0466967_0004408 3300045976 Bacteria 9484
633 Ga0466967_0010251 3300045976 Bacteria 7014
634 Ga0495592_0000045 3300046454 Bacteria 118163
635 Ga0495592_0014758 3300046454 Bacteria 5930
636 Ga0495592_0087019 3300046454 Bacteria 2249
637 Ga0495629_0079064 3300046459 Bacteria 2296
638 Ga0495580_0115232 3300046472 Bacteria 1867
639 Ga0495662_0030112 3300046476 Bacteria 2620
640 Ga0495664_0139481 3300046477 Bacteria 1470
641 Ga0495584_0024301 3300046491 Bacteria 3073
642 Ga0495618_0006593 3300046514 Bacteria 7038
643 Ga0495618_0008517 3300046514 Bacteria 6202
644 Ga0495628_0001155 3300046516 Bacteria 24079
645 Ga0495628_0122138 3300046516 Bacteria 1997
646 Ga0495628_0193825 3300046516 Bacteria 1534
647 Ga0495628_0206500 3300046516 Bacteria 1479
648 Ga0495630_0000045 3300046517 Bacteria 102985
649 Ga0495630_0064159 3300046517 Bacteria 2759
650 Ga0495666_0012985 3300046526 Bacteria 4151
651 Ga0495666_0035803 3300046526 Bacteria 2418
652 Ga0495652_0071464 3300046529 Bacteria 2897
653 Ga0495652_0076969 3300046529 Bacteria 2766
654 Ga0495640_0032140 3300046533 Bacteria 3740
655 Ga0495640_0042846 3300046533 Bacteria 3155
656 Ga0495640_0043106 3300046533 Bacteria 3144
657 Ga0495586_0000005 3300046535 Bacteria 171839
658 Ga0495586_0000591 3300046535 Bacteria 21065
659 Ga0495586_0000637 3300046535 Bacteria 20227
660 Ga0495586_0010295 3300046535 Bacteria 4975
661 Ga0495586_0056467 3300046535 Bacteria 2129
662 Ga0495645_0004585 3300046543 Bacteria 9430
663 Ga0495667_0044320 3300046559 Bacteria 2946
664 Ga0495634_0001571 3300046642 Bacteria 20092
665 Ga0495634_0089601 3300046642 Bacteria 1999
666 Ga0495635_0008933 3300046663 Bacteria 6994
667 Ga0495659_0007894 3300046664 Bacteria 3376
668 Ga0495599_0011928 3300046678 Bacteria 5346
669 Ga0495658_0003521 3300046683 Bacteria 7748
670 Ga0495658_0023694 3300046683 Bacteria 3262
671 Ga0495658_0045123 3300046683 Bacteria 2472
672 Ga0495669_0007080 3300046684 Bacteria 4697
673 Ga0495613_0002301 3300046689 Bacteria 14465
674 Ga0495613_0029339 3300046689 Bacteria 4090
675 Ga0495613_0077034 3300046689 Bacteria 2426
676 Ga0495674_0001441 3300047319 Bacteria 23322
677 Ga0495674_0017412 3300047319 Bacteria 6685
678 Ga0495674_0228132 3300047319 Bacteria 1538
679 Ga0495680_0011217 3300047322 Bacteria 7958
680 Ga0496100_0003236 3300048903 Bacteria 8460
681 Ga0496101_0051257 3300048904 Bacteria 2973
682 Ga0496106_0063418 3300048909 Bacteria 2808
683 Ga0496107_0001569 3300048910 Bacteria 14207
684 Ga0496107_0074695 3300048910 Bacteria 2466
685 Ga0496110_0059026 3300048913 Bacteria 3380
686 Ga0496110_0105394 3300048913 Bacteria 2530
687 Ga0496110_0155824 3300048913 Bacteria 2069
688 Ga0496112_0007512 3300048915 Bacteria 9676
689 Ga0496112_0010430 3300048915 Bacteria 8426
690 Ga0496112_0034041 3300048915 Bacteria 4957
691 Ga0496112_0229371 3300048915 Bacteria 1811
692 Ga0496113_0200592 3300048916 Bacteria 1586
693 Ga0496114_0065462 3300048917 Bacteria 3045
694 Ga0496114_0101285 3300048917 Bacteria 2459
695 Ga0496115_0005570 3300048918 Bacteria 9161
696 Ga0496115_0017563 3300048918 Bacteria 5473
697 Ga0496121_0095631 3300048924 Bacteria 2308
698 Ga0496125_0000110 3300048928 Bacteria 192693
699 Ga0501031_0000091 3300049568 Bacteria 48610
700 Ga0501031_0020039 3300049568 Bacteria 4360
701 Ga0501031_0080907 3300049568 Bacteria 2117
702 Ga0501033_0000020 3300049570 Bacteria 192214
703 Ga0501033_0002658 3300049570 Bacteria 15012
704 Ga0501033_0003846 3300049570 Bacteria 12200
705 Ga0501033_0006324 3300049570 Bacteria 9281
706 Ga0501034_0050486 3300049571 Bacteria 4195
707 Ga0501036_0027261 3300049572 Bacteria 4827
708 Ga0501036_0031375 3300049572 Bacteria 4490
709 Ga0501037_0000058 3300049573 Bacteria 101525
710 Ga0501037_0020721 3300049573 Bacteria 4854
711 Ga0501037_0040952 3300049573 Bacteria 3409
712 Ga0501038_0005697 3300049574 Bacteria 11552
713 Ga0501038_0019739 3300049574 Bacteria 6067
714 Ga0501039_0013054 3300049575 Bacteria 6351
715 Ga0501039_0031445 3300049575 Bacteria 4092
716 Ga0501042_0023650 3300049578 Bacteria 4301
717 Ga0501042_0087539 3300049578 Bacteria 2235
718 Ga0501043_0001065 3300049579 Bacteria 24136
719 Ga0501043_0001113 3300049579 Bacteria 23625
720 Ga0501043_0224364 3300049579 Bacteria 1453
721 Ga0501046_0033226 3300049580 Bacteria 4170
722 Ga0501046_0066424 3300049580 Bacteria 2811
723 Ga0501047_0001353 3300049581 Bacteria 24076
724 Ga0501047_0035925 3300049581 Bacteria 4787
725 Ga0501047_0036456 3300049581 Bacteria 4753
726 Ga0501047_0051124 3300049581 Bacteria 3991
727 Ga0501047_0091271 3300049581 Bacteria 2923
728 Ga0501048_0036590 3300049582 Bacteria 3527
729 Ga0501048_0213927 3300049582 Bacteria 1367
730 Ga0501067_0016767 3300049583 Bacteria 4048
731 Ga0501068_0048515 3300049584 Bacteria 2564
732 Ga0501070_0003081 3300049586 Bacteria 14515
733 Ga0501070_0053359 3300049586 Bacteria 3354
734 Ga0501071_0060321 3300049587 Bacteria 2746
735 Ga0501071_0092496 3300049587 Bacteria 2223
736 Ga0501073_0002383 3300049589 Bacteria 14068
737 Ga0501074_0045385 3300049590 Bacteria 3180
738 Ga0501076_0017054 3300049592 Bacteria 5515
739 Ga0501243_000053 3300049675 Bacteria 10983
740 Ga0501080_0085770 3300049742 Bacteria 2926
741 Ga0501083_0055444 3300049744 Bacteria 2657
742 Ga0501035_0000001 3300049822 Bacteria 1037138
743 Ga0501035_0034270 3300049822 Bacteria 4614
744 Ga0501035_0189038 3300049822 Bacteria 1771
745 Ga0501044_0000357 3300049823 Bacteria 57151
746 Ga0501044_0000810 3300049823 Bacteria 37615
747 Ga0501044_0002595 3300049823 Bacteria 20534
748 Ga0501044_0028574 3300049823 Bacteria 5886
749 Ga0501044_0057655 3300049823 Bacteria 3985
750 Ga0501045_0022608 3300049824 Bacteria 4504
751 nmdc:mga03683_653_c1 3300050489 Bacteria 9956
752 nmdc:mga07m45_1903_c2 3300050496 Bacteria 4189
753 nmdc:mga09592_10882_c1 3300050508 Bacteria 7404
754 nmdc:mga0qj67_89269_c1 3300050509 Bacteria 2475
755 nmdc:mga0qj67_898_c1 3300050509 Bacteria 20435
756 nmdc:mga06r32_333785_c1 3300050510 Bacteria 1501
757 nmdc:mga06r32_4916_c1 3300050510 Bacteria 12037
758 nmdc:mga08y16_41182_c1 3300050511 Bacteria 4840
759 nmdc:mga08y16_71609_c1 3300050511 Bacteria 3612
760 nmdc:mga0n895_96626_c1 3300050512 Bacteria 2959
761 nmdc:mga0rr50_30584_c1 3300050513 Bacteria 3814
762 nmdc:mga0a205_2928_c1 3300050515 Bacteria 15120
763 nmdc:mga0a205_313186_c1 3300050515 Bacteria 1441
764 Ga0495601_0038755 3300053077 Bacteria 2981
765 Ga0500555_000411 3300053103 Bacteria 17882
766 Ga0500556_0000541 3300053104 Bacteria 25490
767 Ga0500616_0001890 3300053153 Bacteria 18852
768 Ga0500622_0046498 3300053156 Bacteria 2244
769 Ga0500645_015027 3300053730 Bacteria 2460
770 Ga0466962_0000008 3300061719 Bacteria 157750
771 2787507514 2786546548 Bacteria 4745694
772 2788434889 2786546940 Bacteria 6396474
773 Ga0501038_0000283
774 CNXas_1000006
775 JGI24743J22301_10002112
776 rootH2_10058531
777 rootH1_10082290
778 Ga0065712_10010936
779 Ga0065715_10004593
780 Ga0065715_10106685
781 Ga0070658_10112886
782 Ga0070658_10243766
783 Ga0070676_10000248
784 Ga0070676_10018573
785 Ga0070683_100020959
786 Ga0070683_100044685
787 Ga0070683_100076252
788 Ga0070690_100001952
789 Ga0070690_100005965
790 Ga0070690_100019930
791 Ga0070690_100038952
792 Ga0070670_100003759
793 Ga0070670_100007118
794 Ga0070670_100052459
795 Ga0070670_100102729
796 Ga0070670_100111012
797 Ga0070677_10000945
798 Ga0068869_100037138
799 Ga0068869_100076728
800 Ga0068869_100081226
801 Ga0070666_10003269
802 Ga0070666_10016731
803 Ga0070666_10028332
804 Ga0070680_100104796
805 Ga0068868_100006364
806 Ga0070689_100007599
807 Ga0070689_100022570
808 Ga0070689_100033784
809 Ga0070689_100135213
810 Ga0070687_100007310
811 Ga0070668_100013168
812 Ga0070669_100000734
813 Ga0070669_100001339
814 Ga0070669_100012556
815 Ga0070669_100013646
816 Ga0070669_100025602
817 Ga0070669_100046891
818 Ga0070669_100201606
819 Ga0070675_100000385
820 Ga0070675_100004509
821 Ga0070675_100011964
822 Ga0070675_100046877
823 Ga0070675_100161122
824 Ga0070675_100187306
825 Ga0070671_100002030
826 Ga0070671_100005839
827 Ga0070671_100019640
828 Ga0070671_100084709
829 Ga0070671_100238016
830 Ga0070671_100242228
831 Ga0070674_100035363
832 Ga0070674_100044756
833 Ga0070673_100011950
834 Ga0070673_100030705
835 Ga0070673_100218242
836 Ga0070688_100040518
837 Ga0070659_100008173
838 Ga0070659_100224660
839 Ga0070667_100008341
840 Ga0070667_100010590
841 Ga0070667_100014017
842 Ga0070667_100041943
843 Ga0070667_100233426
844 Ga0070709_10031703
845 Ga0070709_10122812
846 Ga0070713_100015569
847 Ga0070713_100035459
848 Ga0070713_100041314
849 Ga0070701_10008260
850 Ga0070701_10149754
851 Ga0070711_100049744
852 Ga0070705_100038204
853 Ga0070705_100045603
854 Ga0070705_100096312
855 Ga0070700_100019607
856 Ga0070700_100108782
857 Ga0070694_100072340
858 Ga0070708_100093738
859 Ga0070708_100222170
860 Ga0070678_100010174
861 Ga0070678_100028434
862 Ga0070662_100001586
863 Ga0070662_100050447
864 Ga0070662_100077716
865 Ga0070662_100214538
866 Ga0070662_100283070
867 Ga0068867_100019002
868 Ga0068867_100032408
869 Ga0070706_100028448
870 Ga0070706_100052958
871 Ga0070706_100104361
872 Ga0070706_100165591
873 Ga0070706_100222848
874 Ga0070706_100229837
875 Ga0070707_100015615
876 Ga0070707_100090337
877 Ga0070707_100137401
878 Ga0070707_100213082
879 Ga0070707_100240928
880 Ga0070698_100006205
881 Ga0070698_100009604
882 Ga0070698_100117811
883 Ga0070698_100144883
884 Ga0070699_100006320
885 Ga0070699_100133061
886 Ga0070699_100153004
887 Ga0070679_100098075
888 Ga0070697_100004942
889 Ga0070697_100011397
890 Ga0070697_100013435
891 Ga0070697_100042017
892 Ga0070697_100043197
893 Ga0070697_100044868
894 Ga0070697_100053225
895 Ga0070697_100058002
896 Ga0070697_100091930
897 Ga0070697_100130945
898 Ga0070697_100176164
899 Ga0070697_100218703
900 Ga0068853_100000079
901 Ga0070672_100000689
902 Ga0070672_100105671
903 Ga0070672_100109048
904 Ga0070672_100141531
905 Ga0070686_100007164
906 Ga0070686_100018329
907 Ga0070686_100020856
908 Ga0070665_100000048
909 Ga0070665_100047072
910 Ga0070665_100148258
911 Ga0070665_100353650
912 Ga0068855_100004472
913 Ga0068855_100111785
914 Ga0070664_100001259
915 Ga0068856_100000961
916 Ga0068856_100001550
917 Ga0068856_100004953
918 Ga0068856_100020194
919 Ga0068856_100046781
920 Ga0068856_100076849
921 Ga0068856_100133460
922 Ga0068856_100165529
923 Ga0068852_100052745
924 Ga0068859_100034128
925 Ga0068859_100061487
926 Ga0068861_100022665
927 Ga0068851_10108334
928 Ga0068870_10001437
929 Ga0068870_10023918
930 Ga0068863_100000231
931 Ga0068863_100094940
932 Ga0068858_100037048
933 Ga0068858_100074413
934 Ga0068858_100194680
935 Ga0068860_100003161
936 Ga0068860_100019432
937 Ga0068860_100065930
938 Ga0068860_100102955
939 Ga0068862_100001194
940 Ga0068862_100006381
941 Ga0081540_1027033
942 Ga0070717_10000337
943 Ga0070717_10013743
944 Ga0075363_100003320
945 Ga0070715_10067557
946 Ga0070716_100016089
947 Ga0075362_10002457
948 Ga0097621_100024987
949 Ga0068871_100004235
950 Ga0068871_100065745
951 Ga0068871_100111132
952 Ga0068871_100144642
953 Ga0068871_100291468
954 Ga0075428_100000842
955 Ga0075428_100000957
956 Ga0075428_100014998
957 Ga0075428_100276409
958 Ga0075430_100000572
959 Ga0075431_100000551
960 Ga0075431_100013493
961 Ga0075431_100016348
962 Ga0075431_100226337
963 Ga0075433_10005810
964 Ga0075434_100139686
965 Ga0075429_100008849
966 Ga0075429_100017823
967 Ga0075429_100060993
968 Ga0075429_100098972
969 Ga0068865_100002562
970 Ga0068865_100012360
971 Ga0068865_100012941
972 Ga0068865_100016987
973 Ga0068865_100048046
974 Ga0097620_100034129
975 Ga0097620_100061487
976 Ga0075435_100038469
977 Ga0105240_10000578
978 Ga0105240_10018969
979 Ga0105240_10024257
980 Ga0111539_10011336
981 Ga0111539_10018172
982 Ga0111539_10022992
983 Ga0111539_10136543
984 Ga0105245_10077641
985 Ga0105247_10056209
986 Ga0105243_10042829
987 Ga0105242_10011774
988 Ga0105242_10059708
989 Ga0105248_10031471
990 Ga0105248_10123291
991 Ga0105248_10168372
992 Ga0105248_10193931
993 Ga0105237_10051331
994 Ga0105238_10012956
995 Ga0105238_10029076
996 Ga0105238_10035744
997 Ga0105238_10053462
998 Ga0105249_10002500
999 Ga0105249_10004793
1000 Ga0099796_10013520
1001 Ga0105239_10015469
1002 Ga0105239_10028110
1003 Ga0105246_10144762
1004 Ga0157315_1000356
1005 Ga0157371_10158459
1006 Ga0157369_10459609
1007 Ga0157374_10002188
1008 Ga0157374_10109684
1009 Ga0157374_10116951
1010 Ga0157374_10187887
1011 Ga0157374_10235593
1012 Ga0157378_10003931
1013 Ga0157378_10097110
1014 Ga0163162_10002397
1015 Ga0163162_10004313
1016 Ga0163162_10008137
1017 Ga0163162_10062888
1018 Ga0163162_10237327
1019 Ga0163162_10275792
1020 Ga0157372_10038792
1021 Ga0157372_10169624
1022 Ga0157372_10494396
1023 Ga0157375_10001096
1024 Ga0157375_10003082
1025 Ga0157375_10109581
1026 Ga0157375_10125141
1027 Ga0163163_10000067
1028 Ga0163163_10011575
1029 Ga0163163_10032001
1030 Ga0163163_10306182
1031 Ga0157380_10016988
1032 Ga0157380_10370240
1033 Ga0157377_10029482
1034 Ga0157379_10035666
1035 Ga0157376_10008613
1036 Ga0163161_10171737
1037 Ga0213873_10030059
1038 Ga0213872_10028109
1039 Ga0213872_10096550
1040 Ga0213874_10002921
1041 Ga0213876_10003848
1042 Ga0213876_10006562
1043 Ga0207666_1000889
1044 Ga0207666_1001615
1045 Ga0207673_1008078
1046 Ga0209050_1004972
1047 Ga0207697_10000302
1048 Ga0207697_10000444
1049 Ga0207697_10000466
1050 Ga0207697_10000701
1051 Ga0207697_10025351
1052 Ga0207682_10000378
1053 Ga0207682_10057669
1054 Ga0207692_10060286
1055 Ga0207642_10001476
1056 Ga0207688_10000628
1057 Ga0207688_10004479
1058 Ga0207688_10150080
1059 Ga0207680_10011142
1060 Ga0207685_10038566
1061 Ga0207699_10004830
1062 Ga0207699_10081388
1063 Ga0207645_10001125
1064 Ga0207645_10001285
1065 Ga0207645_10001911
1066 Ga0207645_10009322
1067 Ga0207645_10029101
1068 Ga0207643_10000925
1069 Ga0207643_10033706
1070 Ga0207643_10084003
1071 Ga0207684_10000347
1072 Ga0207684_10028724
1073 Ga0207695_10000484
1074 Ga0207695_10003866
1075 Ga0207695_10018725
1076 Ga0207695_10113244
1077 Ga0207695_10181846
1078 Ga0207695_10340342
1079 Ga0207693_10001355
1080 Ga0207693_10037096
1081 Ga0207663_10006155
1082 Ga0207663_10065512
1083 Ga0207662_10000375
1084 Ga0207649_10027532
1085 Ga0207646_10000985
1086 Ga0207646_10075150
1087 Ga0207646_10115211
1088 Ga0207646_10288283
1089 Ga0207681_10002979
1090 Ga0207681_10039064
1091 Ga0207681_10043631
1092 Ga0207681_10127834
1093 Ga0207681_10206194
1094 Ga0207694_10019987
1095 Ga0207694_10038422
1096 Ga0207650_10002921
1097 Ga0207650_10024299
1098 Ga0207650_10026880
1099 Ga0207659_10002399
1100 Ga0207659_10008013
1101 Ga0207659_10025879
1102 Ga0207659_10059552
1103 Ga0207659_10138242
1104 Ga0207687_10135953
1105 Ga0207700_10036126
1106 Ga0207700_10040007
1107 Ga0207644_10007239
1108 Ga0207644_10034472
1109 Ga0207644_10149881
1110 Ga0207706_10002111
1111 Ga0207706_10005892
1112 Ga0207706_10021939
1113 Ga0207706_10100357
1114 Ga0207706_10124794
1115 Ga0207706_10215392
1116 Ga0207686_10025368
1117 Ga0207670_10004378
1118 Ga0207670_10030875
1119 Ga0207669_10184898
1120 Ga0207704_10006332
1121 Ga0207704_10058320
1122 Ga0207665_10026355
1123 Ga0207691_10000116
1124 Ga0207691_10005381
1125 Ga0207691_10008777
1126 Ga0207691_10050836
1127 Ga0207691_10177028
1128 Ga0207711_10146709
1129 Ga0207711_10267964
1130 Ga0207689_10000045
1131 Ga0207689_10001594
1132 Ga0207689_10011387
1133 Ga0207689_10072457
1134 Ga0207661_10052689
1135 Ga0207661_10141595
1136 Ga0207679_10021819
1137 Ga0207667_10000717
1138 Ga0207667_10105736
1139 Ga0207651_10032287
1140 Ga0207651_10056749
1141 Ga0207651_10057094
1142 Ga0207712_10011699
1143 Ga0207712_10018503
1144 Ga0207668_10002463
1145 Ga0207668_10018590
1146 Ga0207668_10115075
1147 Ga0207640_10079265
1148 Ga0207658_10004538
1149 Ga0207658_10058261
1150 Ga0207658_10078875
1151 Ga0207677_10009748
1152 Ga0207677_10077060
1153 Ga0207639_10000046
1154 Ga0207639_10293964
1155 Ga0207678_10015983
1156 Ga0207708_10049366
1157 Ga0207708_10121751
1158 Ga0207702_10015097
1159 Ga0207702_10027128
1160 Ga0207641_10009098
1161 Ga0207641_10040413
1162 Ga0207641_10044700
1163 Ga0207641_10210708
1164 Ga0207648_10000163
1165 Ga0207648_10018129
1166 Ga0207648_10031472
1167 Ga0207648_10039286
1168 Ga0207648_10089838
1169 Ga0207648_10150952
1170 Ga0207676_10143199
1171 Ga0207676_10160650
1172 Ga0207674_10021486
1173 Ga0207674_10051550
1174 Ga0207674_10082582
1175 Ga0207674_10092314
1176 Ga0207674_10289202
1177 Ga0207675_100049102
1178 Ga0207675_100166534
1179 Ga0207675_100212668
1180 Ga0207675_100268464
1181 Ga0207683_10003680
1182 Ga0207683_10013903
1183 Ga0207683_10079661
1184 Ga0207698_10134699
1185 Ga0207698_10465447
1186 Ga0209974_10018010
1187 Ga0207428_10001377
1188 Ga0207428_10023301
1189 Ga0207428_10067214
1190 Ga0268266_10000358
1191 Ga0268266_10021477
1192 Ga0268266_10113144
1193 Ga0268265_10006705
1194 Ga0268265_10134902
1195 Ga0268265_10232575
1196 Ga0268264_10000626
1197 Ga0268264_10001797
1198 Ga0268264_10199341
1199 Ga0268264_10243278
1200 Ga0268264_10369533
1201 Ga0265337_1007706
1202 Ga0265337_1010912
1203 Ga0265337_1017648
1204 Ga0265337_1022920
1205 Ga0265319_1000001
1206 Ga0265319_1000043
1207 Ga0265319_1004241
1208 Ga0265319_1007717
1209 Ga0265319_1011357
1210 Ga0265319_1012262
1211 Ga0265319_1023933
1212 Ga0265319_1037439
1213 Ga0265318_10000006
1214 Ga0265318_10001709
1215 Ga0265318_10001747
1216 Ga0265318_10005162
1217 Ga0265323_10000009
1218 Ga0265323_10001134
1219 Ga0265323_10002342
1220 Ga0265323_10002635
1221 Ga0265323_10003339
1222 Ga0265323_10004770
1223 Ga0265323_10010839
1224 Ga0265323_10011083
1225 Ga0265322_10005955
1226 Ga0265322_10016293
1227 Ga0265336_10006198
1228 Ga0265336_10007689
1229 Ga0265336_10014556
1230 Ga0265336_10021469
1231 Ga0265338_10000138
1232 Ga0265338_10000242
1233 Ga0265338_10000282
1234 Ga0265338_10000722
1235 Ga0265338_10001585
1236 Ga0265338_10001988
1237 Ga0265338_10002610
1238 Ga0265338_10003663
1239 Ga0265338_10005035
1240 Ga0265338_10011789
1241 Ga0265338_10012495
1242 Ga0265338_10012686
1243 Ga0265338_10016374
1244 Ga0265338_10025244
1245 Ga0265338_10025370
1246 Ga0265338_10036839
1247 Ga0265338_10091928
1248 Ga0265338_10238997
1249 Ga0265324_10000119
1250 Ga0265324_10000877
1251 Ga0265324_10002642
1252 Ga0265324_10007228
1253 Ga0265324_10015776
1254 Ga0265324_10035084
1255 Ga0307511_10000007
1256 Ga0265330_10014205
1257 Ga0265330_10031190
1258 Ga0265328_10005430
1259 Ga0265320_10000595
1260 Ga0265320_10001368
1261 Ga0265320_10003752
1262 Ga0265320_10004727
1263 Ga0265320_10004860
1264 Ga0265320_10009158
1265 Ga0265320_10010667
1266 Ga0265320_10011712
1267 Ga0265320_10016570
1268 Ga0265320_10017941
1269 Ga0265320_10034680
1270 Ga0265320_10079164
1271 Ga0265325_10027125
1272 Ga0265325_10061165
1273 Ga0265325_10070186
1274 Ga0265329_10003181
1275 Ga0265340_10003129
1276 Ga0265339_10011008
1277 Ga0265339_10027359
1278 Ga0265331_10005132
1279 Ga0265331_10012876
1280 Ga0265331_10026401
1281 Ga0265327_10000057
1282 Ga0265327_10001054
1283 Ga0265327_10005748
1284 Ga0265327_10006381
1285 Ga0265327_10045869
1286 Ga0265316_10003432
1287 Ga0265316_10016369
1288 Ga0265316_10019696
1289 Ga0265316_10030127
1290 Ga0265316_10047150
1291 Ga0265316_10047871
1292 Ga0265316_10049264
1293 Ga0265316_10114582
1294 Ga0265316_10154166
1295 Ga0265316_10211900
1296 Ga0307513_10028717
1297 Ga0307408_100000053
1298 Ga0307408_100062510
1299 Ga0265313_10000235
1300 Ga0265313_10004169
1301 Ga0265313_10004255
1302 Ga0265313_10005748
1303 Ga0265313_10006169
1304 Ga0265313_10008039
1305 Ga0265313_10023358
1306 Ga0265313_10029220
1307 Ga0307508_10000054
1308 Ga0265314_10000251
1309 Ga0265314_10001813
1310 Ga0265314_10003093
1311 Ga0265314_10005666
1312 Ga0265314_10023426
1313 Ga0265342_10012810
1314 Ga0265342_10017893
1315 Ga0265342_10030508
1316 Ga0265342_10030802
1317 Ga0265342_10093602
1318 Ga0307409_100000002
1319 Ga0307416_100011718
1320 Ga0307411_10134472
1321 Ga0373930_0000978
1322 Ga0373950_0001082
1323 Ga0373926_0027134
1324 Ga0373928_0000312
1325 Ga0373929_0000193
1326 Ga0373940_0020953
1327 Ga0373944_0000573
1328 Ga0373944_0026721
1329 Ga0373949_0003818
1330 Ga0373951_0001760
1331 Ga0373932_0000006
1332 Ga0373954_0011485
1333 Ga0373954_0051418
1334 Ga0373956_0008869
1335 Ga0373956_0059606
1336 Ga0373943_0021278
1337 Ga0373931_0000009
1338 Ga0373931_0089685
1339 Ga0373931_0132910
1340 Ga0373935_0033697
1341 Ga0373935_0126451
1342 Ga0373927_0009094
1343 Ga0373927_0017568
1344 Ga0373927_0028762
1345 Ga0373927_0103564
1346 Ga0373927_0122267
1347 Ga0373933_0028896
1348 Ga0373947_0032638
1349 Ga0373947_0042133
1350 Ga0373947_0056616
1351 Ga0373937_0022484
1352 Ga0373937_0163520
1353 Ga0373925_0001741
1354 Ga0373925_0003544
1355 Ga0373925_0151307
1356 Ga0395899_0000020
1357 Ga0395900_0024890
1358 Ga0395898_0000005
1359 Ga0395905_0000010
1360 Ga0395905_0132505
1361 Ga0436364_0647265
1362 Ga0436364_1476831
1363 Ga0395901_0385257
1364 Ga0436365_0441002
1365 Ga0436365_0544830
1366 Ga0436365_1068943
1367 Ga0436365_1292648
1368 Ga0436360_0740666
1369 Ga0436361_0047446
1370 Ga0436361_0188547
1371 Ga0436361_0241484
1372 Ga0436361_0527722
1373 Ga0436361_1046901
1374 Ga0436361_1140109
1375 Ga0436363_0784473
1376 Ga0436363_1318228
1377 Ga0436362_0387322
1378 Ga0436362_0798909
1379 Ga0451577_0000012
1380 Ga0451577_0001703
1381 Ga0451577_0030786
1382 Ga0451577_0261225
1383 Ga0451577_0283042
1384 Ga0453683_0000403
1385 Ga0453683_0170594
1386 Ga0453684_0000001
1387 Ga0453684_0000192
1388 Ga0453684_0004565
1389 Ga0453684_0009020
1390 Ga0453684_0010410
1391 Ga0453684_0020798
1392 Ga0453684_0069855
1393 Ga0453684_0212683
1394 Ga0466971_0000006
1395 Ga0466957_0004898
1396 Ga0466957_0043655
1397 Ga0451576_0008755
1398 Ga0451576_0029476
1399 Ga0451576_0031424
1400 Ga0451576_0048179
1401 Ga0451576_0090804
1402 Ga0451576_0117822
1403 Ga0451576_0225816
1404 Ga0466967_0004408
1405 Ga0466967_0010251
1406 Ga0495592_0000045
1407 Ga0495592_0014758
1408 Ga0495592_0087019
1409 Ga0495629_0079064
1410 Ga0495580_0115232
1411 Ga0495662_0030112
1412 Ga0495664_0139481
1413 Ga0495584_0024301
1414 Ga0495618_0006593
1415 Ga0495618_0008517
1416 Ga0495628_0001155
1417 Ga0495628_0122138
1418 Ga0495628_0193825
1419 Ga0495628_0206500
1420 Ga0495630_0000045
1421 Ga0495630_0064159
1422 Ga0495666_0012985
1423 Ga0495666_0035803
1424 Ga0495652_0071464
1425 Ga0495652_0076969
1426 Ga0495640_0032140
1427 Ga0495640_0042846
1428 Ga0495640_0043106
1429 Ga0495586_0000005
1430 Ga0495586_0000591
1431 Ga0495586_0000637
1432 Ga0495586_0010295
1433 Ga0495586_0056467
1434 Ga0495645_0004585
1435 Ga0495667_0044320
1436 Ga0495634_0001571
1437 Ga0495634_0089601
1438 Ga0495635_0008933
1439 Ga0495659_0007894
1440 Ga0495599_0011928
1441 Ga0495658_0003521
1442 Ga0495658_0023694
1443 Ga0495658_0045123
1444 Ga0495669_0007080
1445 Ga0495613_0002301
1446 Ga0495613_0029339
1447 Ga0495613_0077034
1448 Ga0495674_0001441
1449 Ga0495674_0017412
1450 Ga0495674_0228132
1451 Ga0495680_0011217
1452 Ga0496100_0003236
1453 Ga0496101_0051257
1454 Ga0496106_0063418
1455 Ga0496107_0001569
1456 Ga0496107_0074695
1457 Ga0496110_0059026
1458 Ga0496110_0105394
1459 Ga0496110_0155824
1460 Ga0496112_0007512
1461 Ga0496112_0010430
1462 Ga0496112_0034041
1463 Ga0496112_0229371
1464 Ga0496113_0200592
1465 Ga0496114_0065462
1466 Ga0496114_0101285
1467 Ga0496115_0005570
1468 Ga0496115_0017563
1469 Ga0496121_0095631
1470 Ga0496125_0000110
1471 Ga0501031_0000091
1472 Ga0501031_0020039
1473 Ga0501031_0080907
1474 Ga0501033_0000020
1475 Ga0501033_0002658
1476 Ga0501033_0003846
1477 Ga0501033_0006324
1478 Ga0501034_0050486
1479 Ga0501036_0027261
1480 Ga0501036_0031375
1481 Ga0501037_0000058
1482 Ga0501037_0020721
1483 Ga0501037_0040952
1484 Ga0501038_0005697
1485 Ga0501038_0019739
1486 Ga0501039_0013054
1487 Ga0501039_0031445
1488 Ga0501042_0023650
1489 Ga0501042_0087539
1490 Ga0501043_0001065
1491 Ga0501043_0001113
1492 Ga0501043_0224364
1493 Ga0501046_0033226
1494 Ga0501046_0066424
1495 Ga0501047_0001353
1496 Ga0501047_0035925
1497 Ga0501047_0036456
1498 Ga0501047_0051124
1499 Ga0501047_0091271
1500 Ga0501048_0036590
1501 Ga0501048_0213927
1502 Ga0501067_0016767
1503 Ga0501068_0048515
1504 Ga0501070_0003081
1505 Ga0501070_0053359
1506 Ga0501071_0060321
1507 Ga0501071_0092496
1508 Ga0501073_0002383
1509 Ga0501074_0045385
1510 Ga0501076_0017054
1511 Ga0501243_000053
1512 Ga0501080_0085770
1513 Ga0501083_0055444
1514 Ga0501035_0000001
1515 Ga0501035_0034270
1516 Ga0501035_0189038
1517 Ga0501044_0000357
1518 Ga0501044_0000810
1519 Ga0501044_0002595
1520 Ga0501044_0028574
1521 Ga0501044_0057655
1522 Ga0501045_0022608
1523 nmdc:mga03683_653_c1
1524 nmdc:mga07m45_1903_c2
1525 nmdc:mga09592_10882_c1
1526 nmdc:mga0qj67_89269_c1
1527 nmdc:mga0qj67_898_c1
1528 nmdc:mga06r32_333785_c1
1529 nmdc:mga06r32_4916_c1
1530 nmdc:mga08y16_41182_c1
1531 nmdc:mga08y16_71609_c1
1532 nmdc:mga0n895_96626_c1
1533 nmdc:mga0rr50_30584_c1
1534 nmdc:mga0a205_2928_c1
1535 nmdc:mga0a205_313186_c1
1536 Ga0495601_0038755
1537 Ga0500555_000411
1538 Ga0500556_0000541
1539 Ga0500616_0001890
1540 Ga0500622_0046498
1541 Ga0500645_015027
1542 Ga0466962_0000008
1543 2787507514
1544 2788434889

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02773

S-AdoMet_synt_C

S-adenosylmethionine synthetase, C-terminal domain

226

365

0.98

PF02772

S-AdoMet_synt_M

S-adenosylmethionine synthetase, central domain

108

224

0.97

PF00438

S-AdoMet_synt_N

S-adenosylmethionine synthetase, N-terminal domain

4

90

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5t8s-assembly1.cif.gz_A crystal structure of a s-adenosylmethionine synthase from neisseria gonorrhoeae with bound s-adenosylmethionine, amp, pyrophosphate, phosphate, and magnesium 0.9426 3 398
5t8t-assembly1.cif.gz_A crystal structure of a s-adenosylmethionine synthase from neisseria gonorrhoeae with bound amp and magnesium 0.9367 3 398
3iml-assembly2.cif.gz_C crystal structure of s-adenosylmethionine synthetase from burkholderia pseudomallei 0.9365 5 390
5t8s-assembly1.cif.gz_A crystal structure of a s-adenosylmethionine synthase from neisseria gonorrhoeae with bound s-adenosylmethionine, amp, pyrophosphate, phosphate, and magnesium 0.9355 3 398
7loz-assembly1.cif.gz_A-2 s-adenosylmethionine synthetase 0.9345 5 398
ID Description Score Start End Superfamily
af_Q58EF9_292_361_3.30.300.10 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9815 288 354 3.30.300.10
af_B4FIE9_281_392_3.30.300.10 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9795 288 387 3.30.300.10
af_Q2G1W4_285_396_3.30.300.10 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9777 288 397 3.30.300.10
1fugB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9723 286 398 3.30.300.10
af_Q2G1W4_285_396_3.30.300.10 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9521 288 397 3.30.300.10
ID Description Score Start End GO Terms
AF-A0A4Q3HYV0-F1-model_v4 deleted 0.9972 291 399
AF-A0A3B9BBD0-F1-model_v4 Methionine adenosyltransferase (EC 2.5.1.6) 0.9948 281 399 GO:0004478
GO:0005524
GO:0006556
GO:0006730
GO:0046872
AF-A0A353T3L3-F1-model_v4 Methionine adenosyltransferase (EC 2.5.1.6) 0.9894 134 236 GO:0004478
GO:0005524
GO:0006556
GO:0046872
AF-A0A3D4YSU2-F1-model_v4 deleted 0.9893 295 398
AF-A0A432SI99-F1-model_v4 Methionine adenosyltransferase 0.9892 288 396 GO:0004478
GO:0005524
GO:0006556
GO:0006730
GO:0046872

Map