F480161
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 773 | 283 | 773 | 283 |
Family's Representative Sequence
| Representative Sequence | 3300006871|Ga0075434_100000731|Ga0075434_1000007319 |
| Length | 302 |
| Sequence | MAHVPVATATVSRDAISPNAAATSIVIPALDEAASIASVVAGFRAAAPWREILVVDDGSHDETGREAEAAGARVLRHPYNIGNGAAVKNGIRNASGTFVLIADADGQHRPADAVRLVSRLDQYDLVVGTRSSQSQATSARRLGNTVLNWLASYLTGQPVPDLTSGFRAARRDHLAEFLHLLPNGFSTPTTTTLAFMKAGYRVRFEPIDAAQRSGASKIRLGADGVRFFVILLKVITIFSPLRIFMPVSAASFALGAAYAVWTIITQSHVTNSSVLLILLSVVIFLVGLVSEQISSLRFEGRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 71 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 161 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 162 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 164 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 165 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 166 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 167 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 168 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 169 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 170 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 171 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 172 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 173 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 175 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 176 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 179 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 183 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 186 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 187 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 190 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 191 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 192 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 193 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 194 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 195 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 225 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 226 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 227 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 228 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 231 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 232 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 233 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 234 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 258 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 259 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 260 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 261 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 262 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 263 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 264 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 276 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 277 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 278 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 280 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 281 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 282 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.36 |
| Nodule | 0 |
| Rhizoplane | 2.98 |
| Rhizosphere | 93.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10009006 | 3300003203 | Bacteria | 4486 |
| 2 | Ga0065714_10138713 | 3300005288 | Unclassified | 1188 |
| 3 | Ga0065712_10001067 | 3300005290 | Bacteria | 7125 |
| 4 | Ga0065712_10072264 | 3300005290 | Bacteria | 4834 |
| 5 | Ga0065712_10107967 | 3300005290 | Bacteria | 1885 |
| 6 | Ga0065712_10207944 | 3300005290 | Bacteria | 1083 |
| 7 | Ga0065715_10001723 | 3300005293 | Bacteria | 6503 |
| 8 | Ga0065715_10270509 | 3300005293 | Bacteria | 1112 |
| 9 | Ga0065707_10000798 | 3300005295 | Bacteria | 12363 |
| 10 | Ga0065707_10284468 | 3300005295 | Bacteria | 1040 |
| 11 | Ga0070676_10000699 | 3300005328 | Bacteria | 16384 |
| 12 | Ga0070676_10017521 | 3300005328 | Bacteria | 3965 |
| 13 | Ga0070676_10068840 | 3300005328 | Bacteria | 2120 |
| 14 | Ga0070683_100112517 | 3300005329 | Bacteria | 2569 |
| 15 | Ga0070690_100033059 | 3300005330 | Bacteria | 3235 |
| 16 | Ga0070690_100039162 | 3300005330 | Unclassified | 2994 |
| 17 | Ga0070670_100098656 | 3300005331 | Bacteria | 2514 |
| 18 | Ga0070670_100238307 | 3300005331 | Bacteria | 1584 |
| 19 | Ga0068869_100000964 | 3300005334 | Bacteria | 16738 |
| 20 | Ga0070666_10106778 | 3300005335 | Bacteria | 1934 |
| 21 | Ga0068868_100136478 | 3300005338 | Unclassified | 2011 |
| 22 | Ga0070689_100007688 | 3300005340 | Bacteria | 7550 |
| 23 | Ga0070689_100164729 | 3300005340 | Unclassified | 1794 |
| 24 | Ga0070689_100219068 | 3300005340 | Bacteria | 1560 |
| 25 | Ga0070689_100380007 | 3300005340 | Bacteria | 1190 |
| 26 | Ga0070691_10003375 | 3300005341 | Bacteria | 7177 |
| 27 | Ga0070687_100038685 | 3300005343 | Bacteria | 2392 |
| 28 | Ga0070687_100168436 | 3300005343 | Bacteria | 1302 |
| 29 | Ga0070668_100103380 | 3300005347 | Unclassified | 2260 |
| 30 | Ga0070669_100031922 | 3300005353 | Bacteria | 3805 |
| 31 | Ga0070669_100043051 | 3300005353 | Bacteria | 3287 |
| 32 | Ga0070669_100097555 | 3300005353 | Bacteria | 2212 |
| 33 | Ga0070669_100137527 | 3300005353 | Unclassified | 1880 |
| 34 | Ga0070669_100397713 | 3300005353 | Bacteria | 1127 |
| 35 | Ga0070675_100005236 | 3300005354 | Bacteria | 9898 |
| 36 | Ga0070675_100053786 | 3300005354 | Bacteria | 3312 |
| 37 | Ga0070675_100126870 | 3300005354 | Bacteria | 2171 |
| 38 | Ga0070675_100573310 | 3300005354 | Unclassified | 1022 |
| 39 | Ga0070671_100026568 | 3300005355 | Bacteria | 4759 |
| 40 | Ga0070674_100001871 | 3300005356 | Bacteria | 11420 |
| 41 | Ga0070674_100059259 | 3300005356 | Bacteria | 2665 |
| 42 | Ga0070674_100417024 | 3300005356 | Unclassified | 1100 |
| 43 | Ga0070673_100041377 | 3300005364 | Bacteria | 3544 |
| 44 | Ga0070673_100445383 | 3300005364 | Bacteria | 1164 |
| 45 | Ga0070688_100007851 | 3300005365 | Bacteria | 5770 |
| 46 | Ga0070688_100026468 | 3300005365 | Bacteria | 3446 |
| 47 | Ga0070688_100034875 | 3300005365 | Bacteria | 3052 |
| 48 | Ga0070688_100169452 | 3300005365 | Bacteria | 1505 |
| 49 | Ga0070688_100250071 | 3300005365 | Unclassified | 1262 |
| 50 | Ga0070667_100022288 | 3300005367 | Bacteria | 5255 |
| 51 | Ga0070667_100057268 | 3300005367 | Bacteria | 3294 |
| 52 | Ga0070667_100205627 | 3300005367 | Bacteria | 1748 |
| 53 | Ga0070703_10030703 | 3300005406 | Unclassified | 1621 |
| 54 | Ga0070709_10071049 | 3300005434 | Bacteria | 2246 |
| 55 | Ga0070709_10099188 | 3300005434 | Unclassified | 1937 |
| 56 | Ga0070714_100054657 | 3300005435 | Bacteria | 3411 |
| 57 | Ga0070713_100069420 | 3300005436 | Unclassified | 2971 |
| 58 | Ga0070701_10040089 | 3300005438 | Bacteria | 2379 |
| 59 | Ga0070701_10148322 | 3300005438 | Bacteria | 1348 |
| 60 | Ga0070701_10194275 | 3300005438 | Bacteria | 1196 |
| 61 | Ga0070711_100200363 | 3300005439 | Bacteria | 1540 |
| 62 | Ga0070705_100022317 | 3300005440 | Bacteria | 3381 |
| 63 | Ga0070700_100018153 | 3300005441 | Bacteria | 4039 |
| 64 | Ga0070694_100012406 | 3300005444 | Bacteria | 5296 |
| 65 | Ga0070694_100018659 | 3300005444 | Bacteria | 4405 |
| 66 | Ga0070694_100049731 | 3300005444 | Bacteria | 2824 |
| 67 | Ga0070694_100079716 | 3300005444 | Bacteria | 2274 |
| 68 | Ga0070694_100402596 | 3300005444 | Bacteria | 1072 |
| 69 | Ga0070708_100505920 | 3300005445 | Unclassified | 1139 |
| 70 | Ga0070678_100003316 | 3300005456 | Bacteria | 8955 |
| 71 | Ga0070678_100192055 | 3300005456 | Bacteria | 1679 |
| 72 | Ga0070662_100094530 | 3300005457 | Bacteria | 2251 |
| 73 | Ga0070662_100147453 | 3300005457 | Bacteria | 1829 |
| 74 | Ga0070662_100242114 | 3300005457 | Bacteria | 1447 |
| 75 | Ga0070681_10427219 | 3300005458 | Unclassified | 1237 |
| 76 | Ga0068867_100002075 | 3300005459 | Bacteria | 14042 |
| 77 | Ga0068867_100006297 | 3300005459 | Bacteria | 8396 |
| 78 | Ga0068867_100008030 | 3300005459 | Bacteria | 7459 |
| 79 | Ga0068867_100084626 | 3300005459 | Bacteria | 2396 |
| 80 | Ga0070706_100011704 | 3300005467 | Bacteria | 8143 |
| 81 | Ga0070706_100012509 | 3300005467 | Bacteria | 7860 |
| 82 | Ga0070706_100192377 | 3300005467 | Bacteria | 1906 |
| 83 | Ga0070706_100310088 | 3300005467 | Bacteria | 1472 |
| 84 | Ga0070707_100014338 | 3300005468 | Bacteria | 7430 |
| 85 | Ga0070707_100220807 | 3300005468 | Bacteria | 1846 |
| 86 | Ga0070698_100019157 | 3300005471 | Bacteria | 7194 |
| 87 | Ga0070698_100019232 | 3300005471 | Bacteria | 7176 |
| 88 | Ga0070698_100028041 | 3300005471 | Bacteria | 5852 |
| 89 | Ga0070698_100032063 | 3300005471 | Bacteria | 5445 |
| 90 | Ga0070698_100200224 | 3300005471 | Bacteria | 1933 |
| 91 | Ga0070699_100001478 | 3300005518 | Bacteria | 21521 |
| 92 | Ga0070699_100004519 | 3300005518 | Bacteria | 12311 |
| 93 | Ga0070699_100032818 | 3300005518 | Bacteria | 4484 |
| 94 | Ga0070699_100071834 | 3300005518 | Bacteria | 3010 |
| 95 | Ga0070699_100110423 | 3300005518 | Bacteria | 2414 |
| 96 | Ga0070679_100219458 | 3300005530 | Bacteria | 1863 |
| 97 | Ga0070684_100181808 | 3300005535 | Bacteria | 1912 |
| 98 | Ga0070697_100020652 | 3300005536 | Bacteria | 5213 |
| 99 | Ga0070697_100092703 | 3300005536 | Bacteria | 2500 |
| 100 | Ga0070697_100095605 | 3300005536 | Bacteria | 2464 |
| 101 | Ga0070697_100394030 | 3300005536 | Bacteria | 1201 |
| 102 | Ga0068853_100278383 | 3300005539 | Bacteria | 1542 |
| 103 | Ga0068853_100678191 | 3300005539 | Bacteria | 982 |
| 104 | Ga0070672_100028622 | 3300005543 | Bacteria | 4170 |
| 105 | Ga0070672_100062270 | 3300005543 | Bacteria | 2944 |
| 106 | Ga0070672_100094880 | 3300005543 | Bacteria | 2412 |
| 107 | Ga0070672_100247451 | 3300005543 | Bacteria | 1501 |
| 108 | Ga0070672_100379155 | 3300005543 | Bacteria | 1209 |
| 109 | Ga0070672_100500864 | 3300005543 | Bacteria | 1051 |
| 110 | Ga0070686_100000389 | 3300005544 | Bacteria | 28031 |
| 111 | Ga0070686_100009670 | 3300005544 | Bacteria | 5421 |
| 112 | Ga0070686_100068212 | 3300005544 | Bacteria | 2319 |
| 113 | Ga0070695_100006557 | 3300005545 | Bacteria | 6878 |
| 114 | Ga0070695_100008088 | 3300005545 | Bacteria | 6231 |
| 115 | Ga0070695_100009348 | 3300005545 | Bacteria | 5832 |
| 116 | Ga0070695_100050006 | 3300005545 | Bacteria | 2678 |
| 117 | Ga0070696_100014340 | 3300005546 | Bacteria | 5315 |
| 118 | Ga0070696_100037917 | 3300005546 | Bacteria | 3325 |
| 119 | Ga0070696_100084821 | 3300005546 | Bacteria | 2248 |
| 120 | Ga0070696_100206394 | 3300005546 | Bacteria | 1469 |
| 121 | Ga0070696_100276345 | 3300005546 | Bacteria | 1279 |
| 122 | Ga0070693_100128802 | 3300005547 | Bacteria | 1579 |
| 123 | Ga0070665_100001535 | 3300005548 | Bacteria | 26671 |
| 124 | Ga0070665_100005633 | 3300005548 | Bacteria | 12877 |
| 125 | Ga0070665_100464003 | 3300005548 | Bacteria | 1277 |
| 126 | Ga0070704_100003916 | 3300005549 | Bacteria | 8569 |
| 127 | Ga0070704_100023161 | 3300005549 | Bacteria | 4050 |
| 128 | Ga0070704_100050537 | 3300005549 | Bacteria | 2923 |
| 129 | Ga0070704_100080914 | 3300005549 | Bacteria | 2391 |
| 130 | Ga0070704_100146523 | 3300005549 | Bacteria | 1851 |
| 131 | Ga0070704_100378791 | 3300005549 | Unclassified | 1201 |
| 132 | Ga0070664_100018344 | 3300005564 | Bacteria | 5747 |
| 133 | Ga0068857_100142398 | 3300005577 | Bacteria | 2168 |
| 134 | Ga0068857_100524412 | 3300005577 | Bacteria | 1114 |
| 135 | Ga0068854_100011771 | 3300005578 | Bacteria | 5710 |
| 136 | Ga0068854_100034635 | 3300005578 | Bacteria | 3528 |
| 137 | Ga0068854_100224822 | 3300005578 | Bacteria | 1487 |
| 138 | Ga0068856_100020616 | 3300005614 | Bacteria | 6405 |
| 139 | Ga0070702_100000153 | 3300005615 | Bacteria | 21550 |
| 140 | Ga0070702_100076128 | 3300005615 | Bacteria | 1997 |
| 141 | Ga0070702_100139383 | 3300005615 | Bacteria | 1543 |
| 142 | Ga0068859_100002430 | 3300005617 | Bacteria | 18973 |
| 143 | Ga0068859_100010205 | 3300005617 | Bacteria | 9453 |
| 144 | Ga0068859_100010819 | 3300005617 | Bacteria | 9184 |
| 145 | Ga0068859_100076006 | 3300005617 | Bacteria | 3399 |
| 146 | Ga0068859_100213567 | 3300005617 | Bacteria | 2016 |
| 147 | Ga0068859_100401924 | 3300005617 | Bacteria | 1466 |
| 148 | Ga0068859_100862943 | 3300005617 | Bacteria | 991 |
| 149 | Ga0068864_100017239 | 3300005618 | Bacteria | 6022 |
| 150 | Ga0068864_100468257 | 3300005618 | Bacteria | 1208 |
| 151 | Ga0068864_100649680 | 3300005618 | Bacteria | 1027 |
| 152 | Ga0068861_100009190 | 3300005719 | Bacteria | 6816 |
| 153 | Ga0068861_100039211 | 3300005719 | Bacteria | 3534 |
| 154 | Ga0068861_100258100 | 3300005719 | Bacteria | 1491 |
| 155 | Ga0068870_10003571 | 3300005840 | Bacteria | 6593 |
| 156 | Ga0068870_10211075 | 3300005840 | Bacteria | 1183 |
| 157 | Ga0068863_100007204 | 3300005841 | Bacteria | 10910 |
| 158 | Ga0068863_100075448 | 3300005841 | Bacteria | 3190 |
| 159 | Ga0068863_100083398 | 3300005841 | Bacteria | 3029 |
| 160 | Ga0068863_100176568 | 3300005841 | Bacteria | 2050 |
| 161 | Ga0068863_100700121 | 3300005841 | Bacteria | 1007 |
| 162 | Ga0068858_100017801 | 3300005842 | Bacteria | 6652 |
| 163 | Ga0068858_100021737 | 3300005842 | Bacteria | 5994 |
| 164 | Ga0068858_100022246 | 3300005842 | Bacteria | 5920 |
| 165 | Ga0068858_100062574 | 3300005842 | Bacteria | 3441 |
| 166 | Ga0068858_100079687 | 3300005842 | Bacteria | 3043 |
| 167 | Ga0068858_100175688 | 3300005842 | Bacteria | 2021 |
| 168 | Ga0068858_100214731 | 3300005842 | Bacteria | 1821 |
| 169 | Ga0068860_100017112 | 3300005843 | Bacteria | 7067 |
| 170 | Ga0068860_100084173 | 3300005843 | Bacteria | 3025 |
| 171 | Ga0068860_100237809 | 3300005843 | Unclassified | 1771 |
| 172 | Ga0068860_100690453 | 3300005843 | Bacteria | 1030 |
| 173 | Ga0068862_100039812 | 3300005844 | Bacteria | 3994 |
| 174 | Ga0068862_100053930 | 3300005844 | Bacteria | 3442 |
| 175 | Ga0068862_100115564 | 3300005844 | Bacteria | 2360 |
| 176 | Ga0068862_100116919 | 3300005844 | Bacteria | 2346 |
| 177 | Ga0068862_100202123 | 3300005844 | Bacteria | 1792 |
| 178 | Ga0068862_100307396 | 3300005844 | Unclassified | 1460 |
| 179 | Ga0068862_100309333 | 3300005844 | Bacteria | 1456 |
| 180 | Ga0068862_100448362 | 3300005844 | Bacteria | 1216 |
| 181 | Ga0068862_100479580 | 3300005844 | Bacteria | 1177 |
| 182 | Ga0068862_100600230 | 3300005844 | Bacteria | 1057 |
| 183 | Ga0081455_10073814 | 3300005937 | Bacteria | 2819 |
| 184 | Ga0081455_10152618 | 3300005937 | Unclassified | 1779 |
| 185 | Ga0081538_10046027 | 3300005981 | Bacteria | 2697 |
| 186 | Ga0081539_10000093 | 3300005985 | Bacteria | 207314 |
| 187 | Ga0081539_10018173 | 3300005985 | Bacteria | 4893 |
| 188 | Ga0075365_10001234 | 3300006038 | Bacteria | 11312 |
| 189 | Ga0075368_10015337 | 3300006042 | Bacteria | 2842 |
| 190 | Ga0075363_100024048 | 3300006048 | Bacteria | 3094 |
| 191 | Ga0075363_100127602 | 3300006048 | Bacteria | 1425 |
| 192 | Ga0075364_10016789 | 3300006051 | Bacteria | 4560 |
| 193 | Ga0075364_10052859 | 3300006051 | Bacteria | 2655 |
| 194 | Ga0075364_10068331 | 3300006051 | Unclassified | 2337 |
| 195 | Ga0075364_10158757 | 3300006051 | Bacteria | 1526 |
| 196 | Ga0070712_100413800 | 3300006175 | Bacteria | 1116 |
| 197 | Ga0075367_10000879 | 3300006178 | Bacteria | 12052 |
| 198 | Ga0075367_10001875 | 3300006178 | Bacteria | 9299 |
| 199 | Ga0075366_10000322 | 3300006195 | Bacteria | 21867 |
| 200 | Ga0097621_100022037 | 3300006237 | Bacteria | 4940 |
| 201 | Ga0097621_100025087 | 3300006237 | Bacteria | 4662 |
| 202 | Ga0097621_100050591 | 3300006237 | Bacteria | 3379 |
| 203 | Ga0097621_100051939 | 3300006237 | Bacteria | 3337 |
| 204 | Ga0097621_100474135 | 3300006237 | Bacteria | 1130 |
| 205 | Ga0075370_10112040 | 3300006353 | Unclassified | 1585 |
| 206 | Ga0068871_100002675 | 3300006358 | Bacteria | 12162 |
| 207 | Ga0068871_100005949 | 3300006358 | Bacteria | 8586 |
| 208 | Ga0068871_100010750 | 3300006358 | Bacteria | 6694 |
| 209 | Ga0068871_100055165 | 3300006358 | Bacteria | 3226 |
| 210 | Ga0068871_100220821 | 3300006358 | Bacteria | 1642 |
| 211 | Ga0075428_100000185 | 3300006844 | Bacteria | 58526 |
| 212 | Ga0075428_100001446 | 3300006844 | Bacteria | 25375 |
| 213 | Ga0075428_100006198 | 3300006844 | Bacteria | 13304 |
| 214 | Ga0075428_100009291 | 3300006844 | Bacteria | 10901 |
| 215 | Ga0075428_100035422 | 3300006844 | Bacteria | 5503 |
| 216 | Ga0075428_100044494 | 3300006844 | Bacteria | 4879 |
| 217 | Ga0075428_100049566 | 3300006844 | Bacteria | 4607 |
| 218 | Ga0075428_100121374 | 3300006844 | Bacteria | 2846 |
| 219 | Ga0075428_100125903 | 3300006844 | Bacteria | 2788 |
| 220 | Ga0075428_100235005 | 3300006844 | Bacteria | 1978 |
| 221 | Ga0075428_100322682 | 3300006844 | Bacteria | 1659 |
| 222 | Ga0075430_100029567 | 3300006846 | Bacteria | 4649 |
| 223 | Ga0075430_100041017 | 3300006846 | Bacteria | 3917 |
| 224 | Ga0075431_100000373 | 3300006847 | Bacteria | 35683 |
| 225 | Ga0075431_100200574 | 3300006847 | Unclassified | 2041 |
| 226 | Ga0075433_10002985 | 3300006852 | Bacteria | 12993 |
| 227 | Ga0075433_10021172 | 3300006852 | Bacteria | 5449 |
| 228 | Ga0075433_10119754 | 3300006852 | Bacteria | 2337 |
| 229 | Ga0075433_10196348 | 3300006852 | Bacteria | 1795 |
| 230 | Ga0075433_10362897 | 3300006852 | Bacteria | 1279 |
| 231 | Ga0075434_100000731 | 3300006871 | Bacteria | 25794 |
| 232 | Ga0075434_100018881 | 3300006871 | Bacteria | 6665 |
| 233 | Ga0075434_100046329 | 3300006871 | Bacteria | 4315 |
| 234 | Ga0075434_100055954 | 3300006871 | Bacteria | 3920 |
| 235 | Ga0075434_100078644 | 3300006871 | Bacteria | 3294 |
| 236 | Ga0075434_100088081 | 3300006871 | Bacteria | 3105 |
| 237 | Ga0075434_100103133 | 3300006871 | Bacteria | 2860 |
| 238 | Ga0075434_100116335 | 3300006871 | Bacteria | 2687 |
| 239 | Ga0075434_100139413 | 3300006871 | Bacteria | 2444 |
| 240 | Ga0075434_100147879 | 3300006871 | Bacteria | 2370 |
| 241 | Ga0075434_100213999 | 3300006871 | Bacteria | 1947 |
| 242 | Ga0075434_100232096 | 3300006871 | Bacteria | 1865 |
| 243 | Ga0075434_100686417 | 3300006871 | Bacteria | 1042 |
| 244 | Ga0075429_100004956 | 3300006880 | Bacteria | 11469 |
| 245 | Ga0075429_100021887 | 3300006880 | Bacteria | 5542 |
| 246 | Ga0075429_100057532 | 3300006880 | Unclassified | 3385 |
| 247 | Ga0075429_100059596 | 3300006880 | Bacteria | 3325 |
| 248 | Ga0075429_100182682 | 3300006880 | Bacteria | 1838 |
| 249 | Ga0068865_100014920 | 3300006881 | Bacteria | 4946 |
| 250 | Ga0068865_100052129 | 3300006881 | Bacteria | 2835 |
| 251 | Ga0068865_100079374 | 3300006881 | Bacteria | 2351 |
| 252 | Ga0068865_100118849 | 3300006881 | Unclassified | 1962 |
| 253 | Ga0068865_100196771 | 3300006881 | Bacteria | 1562 |
| 254 | Ga0068865_100411148 | 3300006881 | Bacteria | 1110 |
| 255 | Ga0068865_100454968 | 3300006881 | Bacteria | 1059 |
| 256 | Ga0075436_100001874 | 3300006914 | Bacteria | 14448 |
| 257 | Ga0075436_100009966 | 3300006914 | Bacteria | 6501 |
| 258 | Ga0075436_100029447 | 3300006914 | Bacteria | 3776 |
| 259 | Ga0075436_100043595 | 3300006914 | Bacteria | 3093 |
| 260 | Ga0075436_100058963 | 3300006914 | Bacteria | 2651 |
| 261 | Ga0097620_100002430 | 3300006931 | Bacteria | 18973 |
| 262 | Ga0097620_100010205 | 3300006931 | Bacteria | 9453 |
| 263 | Ga0097620_100010819 | 3300006931 | Bacteria | 9184 |
| 264 | Ga0097620_100076008 | 3300006931 | Bacteria | 3399 |
| 265 | Ga0097620_100213557 | 3300006931 | Bacteria | 2016 |
| 266 | Ga0097620_100401942 | 3300006931 | Bacteria | 1466 |
| 267 | Ga0097620_100863149 | 3300006931 | Bacteria | 991 |
| 268 | Ga0075435_100000052 | 3300007076 | Bacteria | 58955 |
| 269 | Ga0075435_100000404 | 3300007076 | Bacteria | 26487 |
| 270 | Ga0075435_100003568 | 3300007076 | Bacteria | 10570 |
| 271 | Ga0075435_100003713 | 3300007076 | Bacteria | 10397 |
| 272 | Ga0075435_100015716 | 3300007076 | Bacteria | 5694 |
| 273 | Ga0075435_100089258 | 3300007076 | Bacteria | 2541 |
| 274 | Ga0075435_100529093 | 3300007076 | Bacteria | 1020 |
| 275 | Ga0099794_10047989 | 3300007265 | Bacteria | 2049 |
| 276 | Ga0105240_10080775 | 3300009093 | Bacteria | 3997 |
| 277 | Ga0105240_10092713 | 3300009093 | Bacteria | 3688 |
| 278 | Ga0105240_10243836 | 3300009093 | Bacteria | 2082 |
| 279 | Ga0105240_10262018 | 3300009093 | Bacteria | 1994 |
| 280 | Ga0105240_10558426 | 3300009093 | Unclassified | 1266 |
| 281 | Ga0105240_10646204 | 3300009093 | Bacteria | 1160 |
| 282 | Ga0111539_10000156 | 3300009094 | Bacteria | 77946 |
| 283 | Ga0111539_10000160 | 3300009094 | Bacteria | 76643 |
| 284 | Ga0111539_10000602 | 3300009094 | Bacteria | 46554 |
| 285 | Ga0111539_10000696 | 3300009094 | Bacteria | 43539 |
| 286 | Ga0111539_10001042 | 3300009094 | Bacteria | 36422 |
| 287 | Ga0111539_10004422 | 3300009094 | Bacteria | 18377 |
| 288 | Ga0111539_10006977 | 3300009094 | Bacteria | 14496 |
| 289 | Ga0111539_10008296 | 3300009094 | Bacteria | 13224 |
| 290 | Ga0111539_10013117 | 3300009094 | Bacteria | 10365 |
| 291 | Ga0111539_10060587 | 3300009094 | Bacteria | 4485 |
| 292 | Ga0111539_10175052 | 3300009094 | Bacteria | 2506 |
| 293 | Ga0111539_10194097 | 3300009094 | Bacteria | 2368 |
| 294 | Ga0111539_10248669 | 3300009094 | Unclassified | 2070 |
| 295 | Ga0111539_10358186 | 3300009094 | Unclassified | 1698 |
| 296 | Ga0111539_10392133 | 3300009094 | Bacteria | 1617 |
| 297 | Ga0105245_10011551 | 3300009098 | Bacteria | 7692 |
| 298 | Ga0105245_10128529 | 3300009098 | Bacteria | 2374 |
| 299 | Ga0105247_10009155 | 3300009101 | Bacteria | 6027 |
| 300 | Ga0114129_10000307 | 3300009147 | Bacteria | 57086 |
| 301 | Ga0114129_10000789 | 3300009147 | Bacteria | 40604 |
| 302 | Ga0114129_10022026 | 3300009147 | Bacteria | 9044 |
| 303 | Ga0114129_10031216 | 3300009147 | Bacteria | 7534 |
| 304 | Ga0114129_10041136 | 3300009147 | Bacteria | 6515 |
| 305 | Ga0114129_10072173 | 3300009147 | Bacteria | 4813 |
| 306 | Ga0114129_10074016 | 3300009147 | Bacteria | 4745 |
| 307 | Ga0114129_10105727 | 3300009147 | Bacteria | 3889 |
| 308 | Ga0114129_10187299 | 3300009147 | Bacteria | 2812 |
| 309 | Ga0114129_10190198 | 3300009147 | Bacteria | 2788 |
| 310 | Ga0114129_10205497 | 3300009147 | Bacteria | 2665 |
| 311 | Ga0114129_10233471 | 3300009147 | Bacteria | 2476 |
| 312 | Ga0114129_10306477 | 3300009147 | Bacteria | 2115 |
| 313 | Ga0114129_10373801 | 3300009147 | Unclassified | 1883 |
| 314 | Ga0114129_10609664 | 3300009147 | Bacteria | 1413 |
| 315 | Ga0114129_10764197 | 3300009147 | Unclassified | 1236 |
| 316 | Ga0105243_10026757 | 3300009148 | Bacteria | 4417 |
| 317 | Ga0105243_10032527 | 3300009148 | Bacteria | 4031 |
| 318 | Ga0105242_10009242 | 3300009176 | Bacteria | 7563 |
| 319 | Ga0105242_10014541 | 3300009176 | Bacteria | 6098 |
| 320 | Ga0105242_10026694 | 3300009176 | Bacteria | 4578 |
| 321 | Ga0105242_10046424 | 3300009176 | Bacteria | 3523 |
| 322 | Ga0105242_10166914 | 3300009176 | Bacteria | 1932 |
| 323 | Ga0105242_10211456 | 3300009176 | Bacteria | 1729 |
| 324 | Ga0105242_10626399 | 3300009176 | Bacteria | 1043 |
| 325 | Ga0105248_10000664 | 3300009177 | Bacteria | 39095 |
| 326 | Ga0105248_10013204 | 3300009177 | Bacteria | 9093 |
| 327 | Ga0105248_10022913 | 3300009177 | Bacteria | 6935 |
| 328 | Ga0105248_10036959 | 3300009177 | Bacteria | 5462 |
| 329 | Ga0105248_10076990 | 3300009177 | Bacteria | 3749 |
| 330 | Ga0105248_10085756 | 3300009177 | Bacteria | 3543 |
| 331 | Ga0105248_10093898 | 3300009177 | Bacteria | 3379 |
| 332 | Ga0105248_10098891 | 3300009177 | Bacteria | 3287 |
| 333 | Ga0105248_10102078 | 3300009177 | Bacteria | 3233 |
| 334 | Ga0105248_10781633 | 3300009177 | Bacteria | 1077 |
| 335 | Ga0105237_10163863 | 3300009545 | Bacteria | 2222 |
| 336 | Ga0105238_10209861 | 3300009551 | Bacteria | 1923 |
| 337 | Ga0105249_10174424 | 3300009553 | Bacteria | 2087 |
| 338 | Ga0105249_10201704 | 3300009553 | Unclassified | 1947 |
| 339 | Ga0105239_10408535 | 3300010375 | Unclassified | 1537 |
| 340 | Ga0157374_10002073 | 3300013296 | Bacteria | 16874 |
| 341 | Ga0163162_10300551 | 3300013306 | Unclassified | 1737 |
| 342 | Ga0157375_10231243 | 3300013308 | Bacteria | 2008 |
| 343 | Ga0157375_10261724 | 3300013308 | Bacteria | 1891 |
| 344 | Ga0157375_10504432 | 3300013308 | Bacteria | 1374 |
| 345 | Ga0157375_10595022 | 3300013308 | Bacteria | 1265 |
| 346 | Ga0157375_11017378 | 3300013308 | Bacteria | 968 |
| 347 | Ga0163163_10000071 | 3300014325 | Bacteria | 112778 |
| 348 | Ga0163163_10015069 | 3300014325 | Bacteria | 7131 |
| 349 | Ga0163163_10068131 | 3300014325 | Bacteria | 3540 |
| 350 | Ga0163163_10298179 | 3300014325 | Unclassified | 1664 |
| 351 | Ga0157380_10013458 | 3300014326 | Bacteria | 5964 |
| 352 | Ga0157380_10037774 | 3300014326 | Bacteria | 3744 |
| 353 | Ga0157380_10095651 | 3300014326 | Bacteria | 2461 |
| 354 | Ga0157380_10170281 | 3300014326 | Bacteria | 1902 |
| 355 | Ga0157380_10356277 | 3300014326 | Bacteria | 1371 |
| 356 | Ga0157377_10019370 | 3300014745 | Bacteria | 3554 |
| 357 | Ga0157379_10033107 | 3300014968 | Bacteria | 4608 |
| 358 | Ga0157379_10033243 | 3300014968 | Bacteria | 4600 |
| 359 | Ga0157379_10044852 | 3300014968 | Bacteria | 3946 |
| 360 | Ga0157379_10172233 | 3300014968 | Bacteria | 1954 |
| 361 | Ga0157376_10019635 | 3300014969 | Bacteria | 5214 |
| 362 | Ga0157376_10036751 | 3300014969 | Bacteria | 3970 |
| 363 | Ga0157376_10144372 | 3300014969 | Bacteria | 2139 |
| 364 | Ga0157376_10148821 | 3300014969 | Bacteria | 2109 |
| 365 | Ga0157376_10338809 | 3300014969 | Bacteria | 1435 |
| 366 | Ga0157376_10341882 | 3300014969 | Bacteria | 1429 |
| 367 | Ga0157376_10669417 | 3300014969 | Bacteria | 1040 |
| 368 | Ga0207697_10080375 | 3300025315 | Bacteria | 1373 |
| 369 | Ga0207697_10100482 | 3300025315 | Bacteria | 1232 |
| 370 | Ga0207653_10021645 | 3300025885 | Unclassified | 2039 |
| 371 | Ga0207642_10019615 | 3300025899 | Bacteria | 2622 |
| 372 | Ga0207710_10052606 | 3300025900 | Bacteria | 1831 |
| 373 | Ga0207688_10038394 | 3300025901 | Bacteria | 2657 |
| 374 | Ga0207680_10100316 | 3300025903 | Bacteria | 1859 |
| 375 | Ga0207680_10268807 | 3300025903 | Unclassified | 1182 |
| 376 | Ga0207680_10395067 | 3300025903 | Bacteria | 976 |
| 377 | Ga0207685_10073529 | 3300025905 | Bacteria | 1393 |
| 378 | Ga0207645_10000703 | 3300025907 | Bacteria | 27863 |
| 379 | Ga0207645_10020740 | 3300025907 | Bacteria | 4297 |
| 380 | Ga0207643_10003545 | 3300025908 | Bacteria | 8401 |
| 381 | Ga0207643_10038629 | 3300025908 | Bacteria | 2682 |
| 382 | Ga0207684_10002365 | 3300025910 | Bacteria | 19093 |
| 383 | Ga0207684_10011424 | 3300025910 | Bacteria | 7769 |
| 384 | Ga0207684_10057251 | 3300025910 | Bacteria | 3307 |
| 385 | Ga0207684_10166296 | 3300025910 | Bacteria | 1901 |
| 386 | Ga0207695_10206287 | 3300025913 | Bacteria | 1878 |
| 387 | Ga0207695_10306351 | 3300025913 | Bacteria | 1479 |
| 388 | Ga0207662_10010058 | 3300025918 | Bacteria | 5215 |
| 389 | Ga0207662_10011304 | 3300025918 | Bacteria | 4945 |
| 390 | Ga0207662_10072333 | 3300025918 | Bacteria | 2089 |
| 391 | Ga0207662_10124767 | 3300025918 | Bacteria | 1618 |
| 392 | Ga0207662_10217663 | 3300025918 | Bacteria | 1242 |
| 393 | Ga0207662_10363168 | 3300025918 | Bacteria | 975 |
| 394 | Ga0207652_10196227 | 3300025921 | Bacteria | 1816 |
| 395 | Ga0207646_10038448 | 3300025922 | Bacteria | 4310 |
| 396 | Ga0207646_10082584 | 3300025922 | Bacteria | 2873 |
| 397 | Ga0207646_10099480 | 3300025922 | Bacteria | 2606 |
| 398 | Ga0207646_10159188 | 3300025922 | Bacteria | 2037 |
| 399 | Ga0207681_10025744 | 3300025923 | Bacteria | 3787 |
| 400 | Ga0207681_10064591 | 3300025923 | Bacteria | 2528 |
| 401 | Ga0207681_10110831 | 3300025923 | Bacteria | 1996 |
| 402 | Ga0207681_10255692 | 3300025923 | Bacteria | 1369 |
| 403 | Ga0207681_10361668 | 3300025923 | Bacteria | 1164 |
| 404 | Ga0207650_10003830 | 3300025925 | Bacteria | 10286 |
| 405 | Ga0207659_10000076 | 3300025926 | Bacteria | 62373 |
| 406 | Ga0207659_10448836 | 3300025926 | Bacteria | 1086 |
| 407 | Ga0207687_10008761 | 3300025927 | Bacteria | 6612 |
| 408 | Ga0207687_10009881 | 3300025927 | Bacteria | 6247 |
| 409 | Ga0207700_10036920 | 3300025928 | Bacteria | 3534 |
| 410 | Ga0207664_10076262 | 3300025929 | Bacteria | 2713 |
| 411 | Ga0207644_10380629 | 3300025931 | Bacteria | 1151 |
| 412 | Ga0207706_10040920 | 3300025933 | Bacteria | 4108 |
| 413 | Ga0207706_10105559 | 3300025933 | Bacteria | 2479 |
| 414 | Ga0207706_10252015 | 3300025933 | Bacteria | 1542 |
| 415 | Ga0207686_10004368 | 3300025934 | Bacteria | 7578 |
| 416 | Ga0207686_10049941 | 3300025934 | Bacteria | 2599 |
| 417 | Ga0207686_10054142 | 3300025934 | Bacteria | 2512 |
| 418 | Ga0207686_10223851 | 3300025934 | Bacteria | 1360 |
| 419 | Ga0207709_10028376 | 3300025935 | Bacteria | 3235 |
| 420 | Ga0207670_10028759 | 3300025936 | Bacteria | 3534 |
| 421 | Ga0207670_10063060 | 3300025936 | Bacteria | 2535 |
| 422 | Ga0207670_10154530 | 3300025936 | Bacteria | 1706 |
| 423 | Ga0207670_10257510 | 3300025936 | Bacteria | 1351 |
| 424 | Ga0207670_10373440 | 3300025936 | Bacteria | 1134 |
| 425 | Ga0207669_10023792 | 3300025937 | Bacteria | 3279 |
| 426 | Ga0207669_10030630 | 3300025937 | Bacteria | 2992 |
| 427 | Ga0207669_10058849 | 3300025937 | Bacteria | 2347 |
| 428 | Ga0207669_10375172 | 3300025937 | Bacteria | 1107 |
| 429 | Ga0207669_10411576 | 3300025937 | Bacteria | 1062 |
| 430 | Ga0207704_10014182 | 3300025938 | Bacteria | 4017 |
| 431 | Ga0207704_10045320 | 3300025938 | Bacteria | 2612 |
| 432 | Ga0207691_10022611 | 3300025940 | Bacteria | 5929 |
| 433 | Ga0207691_10084145 | 3300025940 | Bacteria | 2856 |
| 434 | Ga0207691_10087212 | 3300025940 | Bacteria | 2800 |
| 435 | Ga0207691_10131951 | 3300025940 | Bacteria | 2206 |
| 436 | Ga0207691_10390183 | 3300025940 | Bacteria | 1188 |
| 437 | Ga0207711_10033049 | 3300025941 | Bacteria | 4376 |
| 438 | Ga0207711_10077122 | 3300025941 | Unclassified | 2904 |
| 439 | Ga0207711_10100385 | 3300025941 | Bacteria | 2560 |
| 440 | Ga0207711_10129375 | 3300025941 | Bacteria | 2262 |
| 441 | Ga0207711_10427666 | 3300025941 | Bacteria | 1232 |
| 442 | Ga0207689_10005018 | 3300025942 | Bacteria | 11923 |
| 443 | Ga0207689_10067106 | 3300025942 | Bacteria | 2949 |
| 444 | Ga0207689_10067247 | 3300025942 | Bacteria | 2945 |
| 445 | Ga0207689_10106293 | 3300025942 | Unclassified | 2306 |
| 446 | Ga0207679_10010589 | 3300025945 | Bacteria | 5941 |
| 447 | Ga0207679_10074596 | 3300025945 | Bacteria | 2571 |
| 448 | Ga0207651_10050157 | 3300025960 | Bacteria | 2832 |
| 449 | Ga0207651_10056443 | 3300025960 | Bacteria | 2703 |
| 450 | Ga0207651_10181184 | 3300025960 | Bacteria | 1671 |
| 451 | Ga0207712_10051925 | 3300025961 | Unclassified | 2869 |
| 452 | Ga0207712_10249743 | 3300025961 | Bacteria | 1433 |
| 453 | Ga0207640_10014136 | 3300025981 | Bacteria | 4589 |
| 454 | Ga0207640_10284612 | 3300025981 | Bacteria | 1300 |
| 455 | Ga0207658_10357747 | 3300025986 | Bacteria | 1273 |
| 456 | Ga0207658_10465473 | 3300025986 | Unclassified | 1121 |
| 457 | Ga0207677_10113727 | 3300026023 | Bacteria | 2021 |
| 458 | Ga0207677_10138745 | 3300026023 | Bacteria | 1858 |
| 459 | Ga0207703_10008893 | 3300026035 | Bacteria | 7913 |
| 460 | Ga0207703_10021021 | 3300026035 | Bacteria | 5107 |
| 461 | Ga0207703_10024671 | 3300026035 | Bacteria | 4731 |
| 462 | Ga0207703_10046292 | 3300026035 | Bacteria | 3503 |
| 463 | Ga0207703_10100743 | 3300026035 | Bacteria | 2448 |
| 464 | Ga0207703_10242630 | 3300026035 | Bacteria | 1620 |
| 465 | Ga0207703_10543874 | 3300026035 | Bacteria | 1094 |
| 466 | Ga0207703_10702541 | 3300026035 | Unclassified | 962 |
| 467 | Ga0207639_10597866 | 3300026041 | Bacteria | 1017 |
| 468 | Ga0207708_10007104 | 3300026075 | Bacteria | 8270 |
| 469 | Ga0207708_10022108 | 3300026075 | Bacteria | 4803 |
| 470 | Ga0207708_10053476 | 3300026075 | Bacteria | 3077 |
| 471 | Ga0207708_10166396 | 3300026075 | Bacteria | 1743 |
| 472 | Ga0207702_10154700 | 3300026078 | Bacteria | 2089 |
| 473 | Ga0207641_10002582 | 3300026088 | Bacteria | 16638 |
| 474 | Ga0207641_10067332 | 3300026088 | Unclassified | 3067 |
| 475 | Ga0207641_10123881 | 3300026088 | Bacteria | 2311 |
| 476 | Ga0207641_10211034 | 3300026088 | Bacteria | 1796 |
| 477 | Ga0207641_10360096 | 3300026088 | Bacteria | 1389 |
| 478 | Ga0207641_10541862 | 3300026088 | Bacteria | 1134 |
| 479 | Ga0207648_10021347 | 3300026089 | Bacteria | 5820 |
| 480 | Ga0207648_10024283 | 3300026089 | Bacteria | 5414 |
| 481 | Ga0207648_10126285 | 3300026089 | Unclassified | 2250 |
| 482 | Ga0207648_10184678 | 3300026089 | Bacteria | 1846 |
| 483 | Ga0207648_10209558 | 3300026089 | Bacteria | 1730 |
| 484 | Ga0207648_10496780 | 3300026089 | Bacteria | 1116 |
| 485 | Ga0207676_10014449 | 3300026095 | Bacteria | 5681 |
| 486 | Ga0207676_10107590 | 3300026095 | Bacteria | 2326 |
| 487 | Ga0207676_10615925 | 3300026095 | Bacteria | 1044 |
| 488 | Ga0207674_10226012 | 3300026116 | Bacteria | 1820 |
| 489 | Ga0207674_10374976 | 3300026116 | Bacteria | 1375 |
| 490 | Ga0207675_100012476 | 3300026118 | Bacteria | 7937 |
| 491 | Ga0207675_100060424 | 3300026118 | Bacteria | 3538 |
| 492 | Ga0207675_100062193 | 3300026118 | Bacteria | 3486 |
| 493 | Ga0207675_100140677 | 3300026118 | Bacteria | 2293 |
| 494 | Ga0207675_100177556 | 3300026118 | Bacteria | 2038 |
| 495 | Ga0207683_10026222 | 3300026121 | Bacteria | 5031 |
| 496 | Ga0207683_10081641 | 3300026121 | Bacteria | 2870 |
| 497 | Ga0207683_10228387 | 3300026121 | Bacteria | 1697 |
| 498 | Ga0207683_10342453 | 3300026121 | Bacteria | 1371 |
| 499 | Ga0207428_10000070 | 3300027907 | Bacteria | 147650 |
| 500 | Ga0207428_10000234 | 3300027907 | Bacteria | 76592 |
| 501 | Ga0207428_10000400 | 3300027907 | Bacteria | 53869 |
| 502 | Ga0207428_10001302 | 3300027907 | Bacteria | 26596 |
| 503 | Ga0207428_10018313 | 3300027907 | Bacteria | 5984 |
| 504 | Ga0207428_10058479 | 3300027907 | Bacteria | 3059 |
| 505 | Ga0207428_10265195 | 3300027907 | Bacteria | 1278 |
| 506 | Ga0268266_10003216 | 3300028379 | Bacteria | 16509 |
| 507 | Ga0268265_10016423 | 3300028380 | Bacteria | 5085 |
| 508 | Ga0268265_10027810 | 3300028380 | Bacteria | 4041 |
| 509 | Ga0268265_10162126 | 3300028380 | Bacteria | 1901 |
| 510 | Ga0268265_10199289 | 3300028380 | Bacteria | 1735 |
| 511 | Ga0268265_10227279 | 3300028380 | Bacteria | 1637 |
| 512 | Ga0268265_10450452 | 3300028380 | Bacteria | 1202 |
| 513 | Ga0268265_10532082 | 3300028380 | Bacteria | 1113 |
| 514 | Ga0268264_10043485 | 3300028381 | Bacteria | 3722 |
| 515 | Ga0268264_10108713 | 3300028381 | Bacteria | 2425 |
| 516 | Ga0268264_10133144 | 3300028381 | Bacteria | 2207 |
| 517 | Ga0268264_10158713 | 3300028381 | Bacteria | 2035 |
| 518 | Ga0268264_10317624 | 3300028381 | Bacteria | 1472 |
| 519 | Ga0265316_10157511 | 3300031344 | Bacteria | 1699 |
| 520 | Ga0307408_100044867 | 3300031548 | Bacteria | 3153 |
| 521 | Ga0307408_100076075 | 3300031548 | Bacteria | 2496 |
| 522 | Ga0307408_100169148 | 3300031548 | Bacteria | 1744 |
| 523 | Ga0265314_10129545 | 3300031711 | Bacteria | 1576 |
| 524 | Ga0307409_100043273 | 3300031995 | Bacteria | 3380 |
| 525 | Ga0307409_100130442 | 3300031995 | Bacteria | 2147 |
| 526 | Ga0307416_100144179 | 3300032002 | Bacteria | 2171 |
| 527 | Ga0307416_100218624 | 3300032002 | Unclassified | 1825 |
| 528 | Ga0307411_10157774 | 3300032005 | Bacteria | 1695 |
| 529 | Ga0307411_10356225 | 3300032005 | Bacteria | 1195 |
| 530 | Ga0307415_100230100 | 3300032126 | Bacteria | 1492 |
| 531 | Ga0373930_0000070 | 3300034816 | Bacteria | 9941 |
| 532 | Ga0373948_0008242 | 3300034817 | Bacteria | 1770 |
| 533 | Ga0373958_0000542 | 3300034819 | Bacteria | 4712 |
| 534 | Ga0373934_0000325 | 3300035086 | Bacteria | 16805 |
| 535 | Ga0373940_0000640 | 3300035088 | Bacteria | 5594 |
| 536 | Ga0373949_0000540 | 3300035090 | Bacteria | 12471 |
| 537 | Ga0373951_0000475 | 3300035091 | Bacteria | 11487 |
| 538 | Ga0373952_0001255 | 3300035092 | Bacteria | 4629 |
| 539 | Ga0373939_0005973 | 3300035114 | Bacteria | 2917 |
| 540 | Ga0373939_0010136 | 3300035114 | Bacteria | 2349 |
| 541 | Ga0373941_0004778 | 3300035115 | Bacteria | 3151 |
| 542 | Ga0373956_0046774 | 3300035119 | Bacteria | 1934 |
| 543 | Ga0373957_0004234 | 3300035120 | Bacteria | 4349 |
| 544 | Ga0373946_0066593 | 3300035171 | Bacteria | 1545 |
| 545 | Ga0373942_0000397 | 3300035207 | Bacteria | 12081 |
| 546 | Ga0373961_0001526 | 3300035241 | Bacteria | 6709 |
| 547 | Ga0373962_0000747 | 3300035242 | Bacteria | 7374 |
| 548 | Ga0373924_0079333 | 3300035410 | Bacteria | 1394 |
| 549 | Ga0373931_0000745 | 3300035691 | Bacteria | 13573 |
| 550 | Ga0373931_0098264 | 3300035691 | Bacteria | 1643 |
| 551 | Ga0373933_0082877 | 3300035724 | Bacteria | 1969 |
| 552 | Ga0373933_0300647 | 3300035724 | Unclassified | 1039 |
| 553 | Ga0373947_0155390 | 3300035725 | Bacteria | 1476 |
| 554 | Ga0373937_0000553 | 3300036401 | Bacteria | 33171 |
| 555 | Ga0373937_0061534 | 3300036401 | Bacteria | 3451 |
| 556 | Ga0373937_0099930 | 3300036401 | Bacteria | 2691 |
| 557 | Ga0373937_0153381 | 3300036401 | Bacteria | 2159 |
| 558 | Ga0373937_0283328 | 3300036401 | Unclassified | 1565 |
| 559 | Ga0373937_0386871 | 3300036401 | Bacteria | 1327 |
| 560 | Ga0373925_0086098 | 3300037068 | Bacteria | 2397 |
| 561 | Ga0373925_0140146 | 3300037068 | Bacteria | 1892 |
| 562 | Ga0395901_0413018 | 3300038443 | Unclassified | 1385 |
| 563 | Ga0450923_006411 | 3300042125 | Bacteria | 1950 |
| 564 | Ga0451577_0286690 | 3300042876 | Unclassified | 1492 |
| 565 | Ga0453684_0089560 | 3300044712 | Bacteria | 3805 |
| 566 | Ga0451576_0219836 | 3300045051 | Bacteria | 1983 |
| 567 | Ga0451576_0789040 | 3300045051 | Bacteria | 997 |
| 568 | Ga0466967_0246898 | 3300045976 | Bacteria | 1704 |
| 569 | Ga0495629_0286003 | 3300046459 | Bacteria | 1131 |
| 570 | Ga0495638_0015021 | 3300046460 | Bacteria | 5213 |
| 571 | Ga0495580_0079243 | 3300046472 | Bacteria | 2291 |
| 572 | Ga0495580_0164754 | 3300046472 | Bacteria | 1534 |
| 573 | Ga0495608_0003061 | 3300046511 | Bacteria | 11950 |
| 574 | Ga0495628_0032621 | 3300046516 | Bacteria | 4203 |
| 575 | Ga0495628_0090587 | 3300046516 | Unclassified | 2368 |
| 576 | Ga0495630_0003233 | 3300046517 | Bacteria | 11349 |
| 577 | Ga0495643_0005940 | 3300046522 | Bacteria | 8145 |
| 578 | Ga0495652_0105738 | 3300046529 | Bacteria | 2274 |
| 579 | Ga0495586_0068635 | 3300046535 | Bacteria | 1934 |
| 580 | Ga0495645_0000493 | 3300046543 | Bacteria | 27347 |
| 581 | Ga0495633_0117561 | 3300046558 | Bacteria | 1232 |
| 582 | Ga0495656_0095683 | 3300046615 | Bacteria | 1366 |
| 583 | Ga0495634_0250667 | 3300046642 | Bacteria | 1083 |
| 584 | Ga0495635_0048819 | 3300046663 | Bacteria | 2918 |
| 585 | Ga0495659_0112090 | 3300046664 | Bacteria | 1066 |
| 586 | Ga0495588_0023407 | 3300046674 | Bacteria | 3058 |
| 587 | Ga0495599_0296464 | 3300046678 | Bacteria | 977 |
| 588 | Ga0495647_0100015 | 3300046681 | Bacteria | 1200 |
| 589 | Ga0495658_0038388 | 3300046683 | Bacteria | 2652 |
| 590 | Ga0495669_0007871 | 3300046684 | Bacteria | 4471 |
| 591 | Ga0495613_0001719 | 3300046689 | Bacteria | 16660 |
| 592 | Ga0495581_0154224 | 3300047315 | Bacteria | 1342 |
| 593 | Ga0495674_0046339 | 3300047319 | Bacteria | 3859 |
| 594 | Ga0495674_0054062 | 3300047319 | Bacteria | 3528 |
| 595 | Ga0495674_0412679 | 3300047319 | Unclassified | 1089 |
| 596 | Ga0495672_0000242 | 3300047320 | Bacteria | 76766 |
| 597 | Ga0495672_0099714 | 3300047320 | Bacteria | 1578 |
| 598 | Ga0495676_0147614 | 3300047321 | Bacteria | 1678 |
| 599 | Ga0495680_0109726 | 3300047322 | Bacteria | 2046 |
| 600 | Ga0495684_0000189 | 3300047471 | Bacteria | 47374 |
| 601 | Ga0495684_0009207 | 3300047471 | Bacteria | 7622 |
| 602 | Ga0496100_0069187 | 3300048903 | Unclassified | 2350 |
| 603 | Ga0496101_0001075 | 3300048904 | Bacteria | 16188 |
| 604 | Ga0496101_0083968 | 3300048904 | Bacteria | 2358 |
| 605 | Ga0496101_0292003 | 3300048904 | Bacteria | 1276 |
| 606 | Ga0496102_0022264 | 3300048905 | Bacteria | 5615 |
| 607 | Ga0496102_0144120 | 3300048905 | Bacteria | 2235 |
| 608 | Ga0496102_0185098 | 3300048905 | Bacteria | 1963 |
| 609 | Ga0496104_0002797 | 3300048907 | Bacteria | 15033 |
| 610 | Ga0496104_0082849 | 3300048907 | Bacteria | 3059 |
| 611 | Ga0496104_0203622 | 3300048907 | Unclassified | 1891 |
| 612 | Ga0496104_0484677 | 3300048907 | Bacteria | 1148 |
| 613 | Ga0496105_0099450 | 3300048908 | Bacteria | 2402 |
| 614 | Ga0496106_0025090 | 3300048909 | Bacteria | 4434 |
| 615 | Ga0496106_0149327 | 3300048909 | Bacteria | 1843 |
| 616 | Ga0496108_0006264 | 3300048911 | Bacteria | 9640 |
| 617 | Ga0496109_0036244 | 3300048912 | Bacteria | 4453 |
| 618 | Ga0496109_0078971 | 3300048912 | Bacteria | 3031 |
| 619 | Ga0496110_0042319 | 3300048913 | Bacteria | 3976 |
| 620 | Ga0496110_0083633 | 3300048913 | Bacteria | 2848 |
| 621 | Ga0496112_0056169 | 3300048915 | Bacteria | 3874 |
| 622 | Ga0496112_0141479 | 3300048915 | Bacteria | 2375 |
| 623 | Ga0496113_0007690 | 3300048916 | Bacteria | 6955 |
| 624 | Ga0496114_0025974 | 3300048917 | Bacteria | 4792 |
| 625 | Ga0501031_0330088 | 3300049568 | Bacteria | 988 |
| 626 | Ga0501034_0185918 | 3300049571 | Bacteria | 2041 |
| 627 | Ga0501036_0017503 | 3300049572 | Bacteria | 5993 |
| 628 | Ga0501036_0031898 | 3300049572 | Bacteria | 4451 |
| 629 | Ga0501036_0042741 | 3300049572 | Bacteria | 3837 |
| 630 | Ga0501040_0440721 | 3300049576 | Bacteria | 937 |
| 631 | Ga0501041_0011415 | 3300049577 | Bacteria | 5250 |
| 632 | Ga0501041_0039182 | 3300049577 | Bacteria | 2876 |
| 633 | Ga0501041_0041088 | 3300049577 | Bacteria | 2808 |
| 634 | Ga0501041_0094191 | 3300049577 | Bacteria | 1850 |
| 635 | Ga0501042_0062972 | 3300049578 | Bacteria | 2651 |
| 636 | Ga0501042_0096475 | 3300049578 | Unclassified | 2124 |
| 637 | Ga0501046_0229602 | 3300049580 | Bacteria | 1372 |
| 638 | Ga0501047_0032690 | 3300049581 | Bacteria | 5023 |
| 639 | Ga0501048_0019805 | 3300049582 | Bacteria | 4934 |
| 640 | Ga0501048_0077509 | 3300049582 | Bacteria | 2346 |
| 641 | Ga0501068_0029322 | 3300049584 | Bacteria | 3257 |
| 642 | Ga0501070_0236651 | 3300049586 | Bacteria | 1495 |
| 643 | Ga0501071_0234230 | 3300049587 | Bacteria | 1384 |
| 644 | Ga0501071_0477442 | 3300049587 | Bacteria | 955 |
| 645 | Ga0501072_0055293 | 3300049588 | Bacteria | 3128 |
| 646 | Ga0501072_0266474 | 3300049588 | Bacteria | 1363 |
| 647 | Ga0501072_0314510 | 3300049588 | Bacteria | 1244 |
| 648 | Ga0501074_0030646 | 3300049590 | Bacteria | 3898 |
| 649 | Ga0501075_0120646 | 3300049591 | Bacteria | 1995 |
| 650 | Ga0501075_0207427 | 3300049591 | Bacteria | 1495 |
| 651 | Ga0501075_0247947 | 3300049591 | Unclassified | 1357 |
| 652 | Ga0501076_0005951 | 3300049592 | Bacteria | 8808 |
| 653 | Ga0501076_0016675 | 3300049592 | Bacteria | 5571 |
| 654 | Ga0501076_0036858 | 3300049592 | Bacteria | 3834 |
| 655 | Ga0501076_0046145 | 3300049592 | Bacteria | 3442 |
| 656 | Ga0501077_0214540 | 3300049593 | Bacteria | 1223 |
| 657 | Ga0501079_0017221 | 3300049741 | Bacteria | 5517 |
| 658 | Ga0501079_0207115 | 3300049741 | Bacteria | 1532 |
| 659 | Ga0501079_0426243 | 3300049741 | Bacteria | 1041 |
| 660 | Ga0501080_0073196 | 3300049742 | Bacteria | 3187 |
| 661 | Ga0501081_0065096 | 3300049743 | Bacteria | 2533 |
| 662 | Ga0501081_0070876 | 3300049743 | Bacteria | 2429 |
| 663 | Ga0501081_0110545 | 3300049743 | Bacteria | 1950 |
| 664 | Ga0501083_0020813 | 3300049744 | Bacteria | 4560 |
| 665 | Ga0501044_0357331 | 3300049823 | Bacteria | 1379 |
| 666 | Ga0501045_0024604 | 3300049824 | Bacteria | 4324 |
| 667 | Ga0501045_0031651 | 3300049824 | Bacteria | 3831 |
| 668 | Ga0501045_0074879 | 3300049824 | Bacteria | 2493 |
| 669 | nmdc:mga03n38_109712_c1 | 3300050490 | Bacteria | 1342 |
| 670 | nmdc:mga00v17_14970_c1 | 3300050491 | Bacteria | 4344 |
| 671 | nmdc:mga00v17_77327_c1 | 3300050491 | Unclassified | 2072 |
| 672 | nmdc:mga0yw44_115556_c1 | 3300050492 | Unclassified | 1724 |
| 673 | nmdc:mga0k408_1023_c1 | 3300050493 | Bacteria | 15335 |
| 674 | nmdc:mga0k408_274502_c1 | 3300050493 | Bacteria | 1006 |
| 675 | nmdc:mga0k408_48248_c1 | 3300050493 | Bacteria | 2462 |
| 676 | nmdc:mga06z11_2066_c1 | 3300050494 | Bacteria | 7623 |
| 677 | nmdc:mga06z11_48067_c1 | 3300050494 | Bacteria | 2170 |
| 678 | nmdc:mga04h51_112180_c1 | 3300050495 | Unclassified | 1006 |
| 679 | nmdc:mga07m45_110212_c1 | 3300050496 | Unclassified | 1585 |
| 680 | nmdc:mga05p37_115943_c1 | 3300050507 | Bacteria | 3292 |
| 681 | nmdc:mga05p37_118376_c1 | 3300050507 | Bacteria | 3255 |
| 682 | nmdc:mga05p37_14644_c2 | 3300050507 | Bacteria | 8790 |
| 683 | nmdc:mga05p37_158217_c1 | 3300050507 | Bacteria | 2768 |
| 684 | nmdc:mga05p37_18019_c1 | 3300050507 | Bacteria | 8529 |
| 685 | nmdc:mga05p37_18668_c1 | 3300050507 | Bacteria | 8381 |
| 686 | nmdc:mga05p37_217260_c1 | 3300050507 | Unclassified | 2308 |
| 687 | nmdc:mga05p37_225835_c1 | 3300050507 | Bacteria | 2258 |
| 688 | nmdc:mga05p37_296188_c1 | 3300050507 | Bacteria | 1924 |
| 689 | nmdc:mga05p37_34620_c1 | 3300050507 | Bacteria | 6187 |
| 690 | nmdc:mga05p37_478104_c1 | 3300050507 | Bacteria | 1436 |
| 691 | nmdc:mga05p37_56987_c1 | 3300050507 | Bacteria | 4812 |
| 692 | nmdc:mga05p37_6282_c1 | 3300050507 | Bacteria | 13986 |
| 693 | nmdc:mga05p37_639316_c1 | 3300050507 | Bacteria | 1194 |
| 694 | nmdc:mga05p37_66740_c1 | 3300050507 | Bacteria | 4425 |
| 695 | nmdc:mga05p37_6700_c1 | 3300050507 | Bacteria | 13572 |
| 696 | nmdc:mga05p37_83007_c1 | 3300050507 | Bacteria | 3948 |
| 697 | nmdc:mga05p37_96163_c2 | 3300050507 | Bacteria | 3055 |
| 698 | nmdc:mga09592_2118_c1 | 3300050508 | Bacteria | 16016 |
| 699 | nmdc:mga09592_21193_c1 | 3300050508 | Bacteria | 5355 |
| 700 | nmdc:mga09592_21228_c1 | 3300050508 | Bacteria | 5351 |
| 701 | nmdc:mga09592_39944_c1 | 3300050508 | Bacteria | 3942 |
| 702 | nmdc:mga09592_447066_c1 | 3300050508 | Bacteria | 1115 |
| 703 | nmdc:mga0qj67_9878_c1 | 3300050509 | Bacteria | 7115 |
| 704 | nmdc:mga06r32_1608_c1 | 3300050510 | Bacteria | 20365 |
| 705 | nmdc:mga06r32_239846_c1 | 3300050510 | Bacteria | 1801 |
| 706 | nmdc:mga08y16_10_c1 | 3300050511 | Bacteria | 470512 |
| 707 | nmdc:mga08y16_12823_c1 | 3300050511 | Bacteria | 8812 |
| 708 | nmdc:mga08y16_15573_c1 | 3300050511 | Bacteria | 7995 |
| 709 | nmdc:mga08y16_173550_c1 | 3300050511 | Unclassified | 2239 |
| 710 | nmdc:mga08y16_1915_c1 | 3300050511 | Bacteria | 21221 |
| 711 | nmdc:mga08y16_26035_c1 | 3300050511 | Bacteria | 6170 |
| 712 | nmdc:mga08y16_280484_c1 | 3300050511 | Bacteria | 1719 |
| 713 | nmdc:mga08y16_35677_c1 | 3300050511 | Bacteria | 5223 |
| 714 | nmdc:mga08y16_389_c1 | 3300050511 | Bacteria | 40159 |
| 715 | nmdc:mga08y16_5423_c1 | 3300050511 | Bacteria | 13335 |
| 716 | nmdc:mga08y16_5683_c1 | 3300050511 | Bacteria | 13067 |
| 717 | nmdc:mga08y16_594705_c1 | 3300050511 | Bacteria | 1116 |
| 718 | nmdc:mga08y16_616171_c1 | 3300050511 | Bacteria | 1093 |
| 719 | nmdc:mga08y16_882_c1 | 3300050511 | Bacteria | 28902 |
| 720 | nmdc:mga0n895_101653_c1 | 3300050512 | Bacteria | 2885 |
| 721 | nmdc:mga0n895_106475_c1 | 3300050512 | Bacteria | 2817 |
| 722 | nmdc:mga0n895_223635_c1 | 3300050512 | Bacteria | 1911 |
| 723 | nmdc:mga0n895_228054_c1 | 3300050512 | Bacteria | 1891 |
| 724 | nmdc:mga0n895_312407_c1 | 3300050512 | Bacteria | 1593 |
| 725 | nmdc:mga0n895_389462_c1 | 3300050512 | Bacteria | 1410 |
| 726 | nmdc:mga0n895_49179_c1 | 3300050512 | Bacteria | 4130 |
| 727 | nmdc:mga0n895_57664_c1 | 3300050512 | Bacteria | 3828 |
| 728 | nmdc:mga0n895_61907_c1 | 3300050512 | Bacteria | 3696 |
| 729 | nmdc:mga0n895_620916_c1 | 3300050512 | Bacteria | 1082 |
| 730 | nmdc:mga0n895_66748_c1 | 3300050512 | Bacteria | 3562 |
| 731 | nmdc:mga0n895_8_c1 | 3300050512 | Bacteria | 121439 |
| 732 | nmdc:mga0rr50_131113_c1 | 3300050513 | Bacteria | 2007 |
| 733 | nmdc:mga0rr50_183809_c1 | 3300050513 | Bacteria | 1710 |
| 734 | nmdc:mga0rr50_23_c1 | 3300050513 | Bacteria | 116800 |
| 735 | nmdc:mga0rr50_32880_c1 | 3300050513 | Bacteria | 3701 |
| 736 | nmdc:mga0rr50_36661_c1 | 3300050513 | Bacteria | 3534 |
| 737 | nmdc:mga0rr50_399644_c1 | 3300050513 | Bacteria | 1161 |
| 738 | nmdc:mga0rr50_618_c1 | 3300050513 | Bacteria | 19051 |
| 739 | nmdc:mga0rr50_629376_c1 | 3300050513 | Bacteria | 915 |
| 740 | nmdc:mga0rr50_93444_c1 | 3300050513 | Bacteria | 2347 |
| 741 | nmdc:mga08x19_100971_c1 | 3300050514 | Bacteria | 1914 |
| 742 | nmdc:mga08x19_12493_c1 | 3300050514 | Bacteria | 5119 |
| 743 | nmdc:mga08x19_165_c1 | 3300050514 | Bacteria | 54991 |
| 744 | nmdc:mga08x19_9112_c1 | 3300050514 | Bacteria | 5925 |
| 745 | nmdc:mga08x19_98642_c1 | 3300050514 | Bacteria | 1936 |
| 746 | nmdc:mga0a205_132634_c1 | 3300050515 | Bacteria | 2391 |
| 747 | nmdc:mga0a205_17674_c1 | 3300050515 | Bacteria | 6693 |
| 748 | nmdc:mga0a205_182600_c1 | 3300050515 | Bacteria | 1991 |
| 749 | nmdc:mga0a205_211484_c1 | 3300050515 | Bacteria | 1828 |
| 750 | nmdc:mga0a205_255077_c1 | 3300050515 | Bacteria | 1633 |
| 751 | nmdc:mga0a205_286039_c1 | 3300050515 | Bacteria | 1524 |
| 752 | nmdc:mga0a205_390141_c1 | 3300050515 | Unclassified | 1257 |
| 753 | nmdc:mga0a205_41360_c1 | 3300050515 | Bacteria | 4438 |
| 754 | Ga0495601_0026265 | 3300053077 | Bacteria | 3594 |
| 755 | Ga0495601_0056226 | 3300053077 | Bacteria | 2492 |
| 756 | Ga0495601_0074765 | 3300053077 | Bacteria | 2168 |
| 757 | Ga0495619_0004868 | 3300053085 | Bacteria | 8524 |
| 758 | Ga0495619_0301359 | 3300053085 | Unclassified | 1110 |
| 759 | Ga0500651_0242992 | 3300053093 | Unclassified | 1049 |
| 760 | Ga0500555_022300 | 3300053103 | Bacteria | 1820 |
| 761 | Ga0500568_0008892 | 3300053139 | Bacteria | 4804 |
| 762 | Ga0501084_0038281 | 3300054114 | Bacteria | 4009 |
| 763 | Ga0590071_000286 | 3300059421 | Bacteria | 14746 |
| 764 | Ga0590074_002198 | 3300059423 | Bacteria | 3202 |
| 765 | Ga0590077_000879 | 3300059426 | Bacteria | 7697 |
| 766 | Ga0501082_0189629 | 3300060353 | Bacteria | 1789 |
| 767 | Ga0501082_0196572 | 3300060353 | Bacteria | 1754 |
| 768 | Ga0501082_0304890 | 3300060353 | Bacteria | 1387 |
| 769 | Ga0501082_0420906 | 3300060353 | Bacteria | 1166 |
| 770 | Ga0530510_0018199 | 3300061734 | Bacteria | 4981 |
| 771 | Ga0530510_0039134 | 3300061734 | Bacteria | 3423 |
| 772 | Ga0530510_0092617 | 3300061734 | Bacteria | 2206 |
| 773 | Ga0530510_0126753 | 3300061734 | Bacteria | 1877 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014969 | Ga0157376_10341882 | Ga0157376_103418821 | 243 |
| 2 | 3300038443 | Ga0395901_0413018 | Ga0395901_0413018_60_917 | 244 |
| 3 | 3300036401 | Ga0373937_0153381 | Ga0373937_0153381_14_811 | 246 |
| 4 | 3300050507 | nmdc:mga05p37_225835_c1 | nmdc:mga05p37_225835_c1_11_802 | 246 |
| 5 | 3300009094 | Ga0111539_10358186 | Ga0111539_103581862 | 249 |
| 6 | 3300050511 | nmdc:mga08y16_173550_c1 | nmdc:mga08y16_173550_c1_1276_2103 | 249 |
| 7 | 3300049576 | Ga0501040_0440721 | Ga0501040_0440721_162_917 | 250 |
| 8 | 3300049587 | Ga0501071_0477442 | Ga0501071_0477442_187_942 | 250 |
| 9 | 3300005290 | Ga0065712_10107967 | Ga0065712_101079672 | 255 |
| 10 | 3300005536 | Ga0070697_100394030 | Ga0070697_1003940302 | 255 |
| 11 | 3300006914 | Ga0075436_100043595 | Ga0075436_1000435952 | 255 |
| 12 | 3300035086 | Ga0373934_0000325 | Ga0373934_0000325_6375_7235 | 255 |
| 13 | 3300035119 | Ga0373956_0046774 | Ga0373956_0046774_74_934 | 255 |
| 14 | 3300035120 | Ga0373957_0004234 | Ga0373957_0004234_687_1547 | 255 |
| 15 | 3300035410 | Ga0373924_0079333 | Ga0373924_0079333_53_913 | 255 |
| 16 | 3300035724 | Ga0373933_0082877 | Ga0373933_0082877_855_1715 | 255 |
| 17 | 3300036401 | Ga0373937_0000553 | Ga0373937_0000553_23060_23920 | 255 |
| 18 | 3300050513 | nmdc:mga0rr50_399644_c1 | nmdc:mga0rr50_399644_c1_11_895 | 255 |
| 19 | 3300050515 | nmdc:mga0a205_132634_c1 | nmdc:mga0a205_132634_c1_280_1158 | 255 |
| 20 | 3300053093 | Ga0500651_0242992 | Ga0500651_0242992_154_1014 | 256 |
| 21 | 3300005518 | Ga0070699_100071834 | Ga0070699_1000718343 | 258 |
| 22 | 3300006871 | Ga0075434_100103133 | Ga0075434_1001031333 | 260 |
| 23 | 3300045976 | Ga0466967_0246898 | Ga0466967_0246898_102_977 | 260 |
| 24 | 3300050512 | nmdc:mga0n895_223635_c1 | nmdc:mga0n895_223635_c1_1017_1901 | 260 |
| 25 | 3300005440 | Ga0070705_100022317 | Ga0070705_1000223174 | 262 |
| 26 | 3300006051 | Ga0075364_10068331 | Ga0075364_100683312 | 262 |
| 27 | 3300050491 | nmdc:mga00v17_77327_c1 | nmdc:mga00v17_77327_c1_454_1314 | 262 |
| 28 | 3300025918 | Ga0207662_10217663 | Ga0207662_102176632 | 263 |
| 29 | 3300059423 | Ga0590074_002198 | Ga0590074_002198_140_997 | 263 |
| 30 | 3300059426 | Ga0590077_000879 | Ga0590077_000879_6687_7544 | 263 |
| 31 | 3300005985 | Ga0081539_10018173 | Ga0081539_100181731 | 264 |
| 32 | 3300006871 | Ga0075434_100139413 | Ga0075434_1001394132 | 264 |
| 33 | 3300007076 | Ga0075435_100000404 | Ga0075435_10000040419 | 264 |
| 34 | 3300009094 | Ga0111539_10060587 | Ga0111539_100605872 | 264 |
| 35 | 3300009147 | Ga0114129_10031216 | Ga0114129_100312166 | 264 |
| 36 | 3300009147 | Ga0114129_10072173 | Ga0114129_100721734 | 264 |
| 37 | 3300034819 | Ga0373958_0000542 | Ga0373958_0000542_3351_4217 | 264 |
| 38 | 3300035091 | Ga0373951_0000475 | Ga0373951_0000475_1226_2092 | 264 |
| 39 | 3300035092 | Ga0373952_0001255 | Ga0373952_0001255_1395_2261 | 264 |
| 40 | 3300035114 | Ga0373939_0005973 | Ga0373939_0005973_1395_2261 | 264 |
| 41 | 3300035115 | Ga0373941_0004778 | Ga0373941_0004778_1093_1959 | 264 |
| 42 | 3300035242 | Ga0373962_0000747 | Ga0373962_0000747_5285_6151 | 264 |
| 43 | 3300035691 | Ga0373931_0000745 | Ga0373931_0000745_5834_6700 | 264 |
| 44 | 3300045051 | Ga0451576_0219836 | Ga0451576_0219836_880_1746 | 264 |
| 45 | 3300050507 | nmdc:mga05p37_34620_c1 | nmdc:mga05p37_34620_c1_2625_3539 | 264 |
| 46 | 3300050513 | nmdc:mga0rr50_618_c1 | nmdc:mga0rr50_618_c1_3498_4364 | 264 |
| 47 | 3300050514 | nmdc:mga08x19_100971_c1 | nmdc:mga08x19_100971_c1_157_1023 | 264 |
| 48 | 3300005356 | Ga0070674_100417024 | Ga0070674_1004170241 | 265 |
| 49 | 3300005457 | Ga0070662_100242114 | Ga0070662_1002421142 | 265 |
| 50 | 3300005578 | Ga0068854_100224822 | Ga0068854_1002248222 | 265 |
| 51 | 3300005842 | Ga0068858_100079687 | Ga0068858_1000796873 | 265 |
| 52 | 3300009093 | Ga0105240_10080775 | Ga0105240_100807752 | 265 |
| 53 | 3300014326 | Ga0157380_10095651 | Ga0157380_100956511 | 265 |
| 54 | 3300025933 | Ga0207706_10252015 | Ga0207706_102520152 | 265 |
| 55 | 3300025981 | Ga0207640_10284612 | Ga0207640_102846122 | 265 |
| 56 | 3300026035 | Ga0207703_10021021 | Ga0207703_100210214 | 265 |
| 57 | 3300026118 | Ga0207675_100062193 | Ga0207675_1000621934 | 265 |
| 58 | 3300031548 | Ga0307408_100076075 | Ga0307408_1000760753 | 266 |
| 59 | 3300048904 | Ga0496101_0292003 | Ga0496101_0292003_185_1048 | 266 |
| 60 | 3300005329 | Ga0070683_100112517 | Ga0070683_1001125172 | 267 |
| 61 | 3300005290 | Ga0065712_10072264 | Ga0065712_100722643 | 269 |
| 62 | 3300005844 | Ga0068862_100202123 | Ga0068862_1002021232 | 269 |
| 63 | 3300025315 | Ga0207697_10080375 | Ga0207697_100803752 | 269 |
| 64 | 3300028380 | Ga0268265_10162126 | Ga0268265_101621262 | 269 |
| 65 | 3300048912 | Ga0496109_0078971 | Ga0496109_0078971_494_1360 | 269 |
| 66 | 3300048913 | Ga0496110_0083633 | Ga0496110_0083633_1913_2779 | 269 |
| 67 | 3300014969 | Ga0157376_10338809 | Ga0157376_103388092 | 270 |
| 68 | 3300031548 | Ga0307408_100044867 | Ga0307408_1000448673 | 270 |
| 69 | 3300032126 | Ga0307415_100230100 | Ga0307415_1002301002 | 270 |
| 70 | 3300048905 | Ga0496102_0144120 | Ga0496102_0144120_459_1328 | 270 |
| 71 | 3300050512 | nmdc:mga0n895_620916_c1 | nmdc:mga0n895_620916_c1_154_1014 | 270 |
| 72 | 3300005328 | Ga0070676_10000699 | Ga0070676_100006997 | 271 |
| 73 | 3300005341 | Ga0070691_10003375 | Ga0070691_100033755 | 271 |
| 74 | 3300005444 | Ga0070694_100012406 | Ga0070694_1000124066 | 271 |
| 75 | 3300005459 | Ga0068867_100006297 | Ga0068867_1000062977 | 271 |
| 76 | 3300005545 | Ga0070695_100009348 | Ga0070695_1000093486 | 271 |
| 77 | 3300005546 | Ga0070696_100014340 | Ga0070696_1000143402 | 271 |
| 78 | 3300005549 | Ga0070704_100003916 | Ga0070704_1000039164 | 271 |
| 79 | 3300005615 | Ga0070702_100000153 | Ga0070702_1000001532 | 271 |
| 80 | 3300005617 | Ga0068859_100862943 | Ga0068859_1008629432 | 271 |
| 81 | 3300005719 | Ga0068861_100009190 | Ga0068861_1000091904 | 271 |
| 82 | 3300006931 | Ga0097620_100863149 | Ga0097620_1008631492 | 271 |
| 83 | 3300025907 | Ga0207645_10000703 | Ga0207645_1000070311 | 271 |
| 84 | 3300025960 | Ga0207651_10056443 | Ga0207651_100564431 | 271 |
| 85 | 3300026075 | Ga0207708_10053476 | Ga0207708_100534765 | 271 |
| 86 | 3300026118 | Ga0207675_100012476 | Ga0207675_1000124765 | 271 |
| 87 | 3300005331 | Ga0070670_100238307 | Ga0070670_1002383072 | 272 |
| 88 | 3300005981 | Ga0081538_10046027 | Ga0081538_100460272 | 272 |
| 89 | 3300009094 | Ga0111539_10000602 | Ga0111539_1000060213 | 272 |
| 90 | 3300009147 | Ga0114129_10074016 | Ga0114129_100740163 | 272 |
| 91 | 3300013306 | Ga0163162_10300551 | Ga0163162_103005512 | 272 |
| 92 | 3300026088 | Ga0207641_10541862 | Ga0207641_105418621 | 272 |
| 93 | 3300027907 | Ga0207428_10001302 | Ga0207428_1000130221 | 272 |
| 94 | 3300031548 | Ga0307408_100169148 | Ga0307408_1001691482 | 272 |
| 95 | 3300032002 | Ga0307416_100144179 | Ga0307416_1001441792 | 272 |
| 96 | 3300048905 | Ga0496102_0185098 | Ga0496102_0185098_227_1099 | 272 |
| 97 | 3300050507 | nmdc:mga05p37_66740_c1 | nmdc:mga05p37_66740_c1_1939_2787 | 272 |
| 98 | 3300050511 | nmdc:mga08y16_882_c1 | nmdc:mga08y16_882_c1_15534_16394 | 272 |
| 99 | 3300005343 | Ga0070687_100168436 | Ga0070687_1001684362 | 273 |
| 100 | 3300006844 | Ga0075428_100000185 | Ga0075428_10000018538 | 273 |
| 101 | 3300009094 | Ga0111539_10000160 | Ga0111539_1000016017 | 273 |
| 102 | 3300009553 | Ga0105249_10174424 | Ga0105249_101744242 | 273 |
| 103 | 3300027907 | Ga0207428_10000234 | Ga0207428_1000023417 | 273 |
| 104 | 3300050511 | nmdc:mga08y16_10_c1 | nmdc:mga08y16_10_c1_14672_15535 | 273 |
| 105 | 3300050511 | nmdc:mga08y16_12823_c1 | nmdc:mga08y16_12823_c1_6780_7601 | 273 |
| 106 | 3300005290 | Ga0065712_10207944 | Ga0065712_102079442 | 274 |
| 107 | 3300005331 | Ga0070670_100098656 | Ga0070670_1000986562 | 274 |
| 108 | 3300005367 | Ga0070667_100205627 | Ga0070667_1002056271 | 274 |
| 109 | 3300005536 | Ga0070697_100092703 | Ga0070697_1000927032 | 274 |
| 110 | 3300005543 | Ga0070672_100062270 | Ga0070672_1000622702 | 274 |
| 111 | 3300005548 | Ga0070665_100001535 | Ga0070665_1000015355 | 274 |
| 112 | 3300005549 | Ga0070704_100146523 | Ga0070704_1001465232 | 274 |
| 113 | 3300005564 | Ga0070664_100018344 | Ga0070664_1000183443 | 274 |
| 114 | 3300005577 | Ga0068857_100524412 | Ga0068857_1005244122 | 274 |
| 115 | 3300005719 | Ga0068861_100258100 | Ga0068861_1002581002 | 274 |
| 116 | 3300005842 | Ga0068858_100017801 | Ga0068858_1000178015 | 274 |
| 117 | 3300005843 | Ga0068860_100237809 | Ga0068860_1002378092 | 274 |
| 118 | 3300006237 | Ga0097621_100051939 | Ga0097621_1000519393 | 274 |
| 119 | 3300006358 | Ga0068871_100055165 | Ga0068871_1000551652 | 274 |
| 120 | 3300006844 | Ga0075428_100006198 | Ga0075428_10000619814 | 274 |
| 121 | 3300006852 | Ga0075433_10002985 | Ga0075433_100029857 | 274 |
| 122 | 3300006880 | Ga0075429_100182682 | Ga0075429_1001826822 | 274 |
| 123 | 3300007076 | Ga0075435_100529093 | Ga0075435_1005290932 | 274 |
| 124 | 3300009093 | Ga0105240_10262018 | Ga0105240_102620182 | 274 |
| 125 | 3300009094 | Ga0111539_10000696 | Ga0111539_1000069614 | 274 |
| 126 | 3300009098 | Ga0105245_10011551 | Ga0105245_100115514 | 274 |
| 127 | 3300009176 | Ga0105242_10009242 | Ga0105242_100092424 | 274 |
| 128 | 3300009177 | Ga0105248_10022913 | Ga0105248_100229133 | 274 |
| 129 | 3300010375 | Ga0105239_10408535 | Ga0105239_104085352 | 274 |
| 130 | 3300013296 | Ga0157374_10002073 | Ga0157374_100020735 | 274 |
| 131 | 3300013308 | Ga0157375_10231243 | Ga0157375_102312431 | 274 |
| 132 | 3300014325 | Ga0163163_10298179 | Ga0163163_102981792 | 274 |
| 133 | 3300014968 | Ga0157379_10044852 | Ga0157379_100448523 | 274 |
| 134 | 3300014969 | Ga0157376_10148821 | Ga0157376_101488213 | 274 |
| 135 | 3300025903 | Ga0207680_10395067 | Ga0207680_103950672 | 274 |
| 136 | 3300025918 | Ga0207662_10124767 | Ga0207662_101247672 | 274 |
| 137 | 3300025923 | Ga0207681_10255692 | Ga0207681_102556921 | 274 |
| 138 | 3300025925 | Ga0207650_10003830 | Ga0207650_100038302 | 274 |
| 139 | 3300025926 | Ga0207659_10448836 | Ga0207659_104488362 | 274 |
| 140 | 3300025927 | Ga0207687_10009881 | Ga0207687_100098815 | 274 |
| 141 | 3300025934 | Ga0207686_10004368 | Ga0207686_100043684 | 274 |
| 142 | 3300025936 | Ga0207670_10154530 | Ga0207670_101545302 | 274 |
| 143 | 3300025945 | Ga0207679_10010589 | Ga0207679_100105894 | 274 |
| 144 | 3300025986 | Ga0207658_10357747 | Ga0207658_103577471 | 274 |
| 145 | 3300026023 | Ga0207677_10113727 | Ga0207677_101137272 | 274 |
| 146 | 3300026035 | Ga0207703_10242630 | Ga0207703_102426301 | 274 |
| 147 | 3300026095 | Ga0207676_10107590 | Ga0207676_101075903 | 274 |
| 148 | 3300026116 | Ga0207674_10374976 | Ga0207674_103749762 | 274 |
| 149 | 3300026118 | Ga0207675_100140677 | Ga0207675_1001406773 | 274 |
| 150 | 3300028379 | Ga0268266_10003216 | Ga0268266_100032169 | 274 |
| 151 | 3300028381 | Ga0268264_10158713 | Ga0268264_101587133 | 274 |
| 152 | 3300036401 | Ga0373937_0099930 | Ga0373937_0099930_293_1165 | 274 |
| 153 | 3300046543 | Ga0495645_0000493 | Ga0495645_0000493_8875_9747 | 274 |
| 154 | 3300046663 | Ga0495635_0048819 | Ga0495635_0048819_1300_2172 | 274 |
| 155 | 3300047319 | Ga0495674_0054062 | Ga0495674_0054062_1376_2248 | 274 |
| 156 | 3300047322 | Ga0495680_0109726 | Ga0495680_0109726_773_1645 | 274 |
| 157 | 3300047471 | Ga0495684_0009207 | Ga0495684_0009207_3754_4626 | 274 |
| 158 | 3300048907 | Ga0496104_0203622 | Ga0496104_0203622_756_1628 | 274 |
| 159 | 3300048917 | Ga0496114_0025974 | Ga0496114_0025974_1380_2252 | 274 |
| 160 | 3300050507 | nmdc:mga05p37_96163_c2 | nmdc:mga05p37_96163_c2_1131_1955 | 274 |
| 161 | 3300050511 | nmdc:mga08y16_5423_c1 | nmdc:mga08y16_5423_c1_892_1716 | 274 |
| 162 | 3300050513 | nmdc:mga0rr50_629376_c1 | nmdc:mga0rr50_629376_c1_23_847 | 274 |
| 163 | 3300050515 | nmdc:mga0a205_17674_c1 | nmdc:mga0a205_17674_c1_2632_3456 | 274 |
| 164 | 3300005338 | Ga0068868_100136478 | Ga0068868_1001364782 | 275 |
| 165 | 3300005354 | Ga0070675_100573310 | Ga0070675_1005733101 | 275 |
| 166 | 3300005548 | Ga0070665_100464003 | Ga0070665_1004640032 | 275 |
| 167 | 3300005618 | Ga0068864_100017239 | Ga0068864_1000172396 | 275 |
| 168 | 3300005840 | Ga0068870_10211075 | Ga0068870_102110752 | 275 |
| 169 | 3300005842 | Ga0068858_100021737 | Ga0068858_1000217372 | 275 |
| 170 | 3300005985 | Ga0081539_10000093 | Ga0081539_10000093174 | 275 |
| 171 | 3300009101 | Ga0105247_10009155 | Ga0105247_100091555 | 275 |
| 172 | 3300009177 | Ga0105248_10000664 | Ga0105248_1000066412 | 275 |
| 173 | 3300009551 | Ga0105238_10209861 | Ga0105238_102098612 | 275 |
| 174 | 3300014325 | Ga0163163_10068131 | Ga0163163_100681313 | 275 |
| 175 | 3300025900 | Ga0207710_10052606 | Ga0207710_100526062 | 275 |
| 176 | 3300025903 | Ga0207680_10268807 | Ga0207680_102688072 | 275 |
| 177 | 3300025945 | Ga0207679_10074596 | Ga0207679_100745963 | 275 |
| 178 | 3300026035 | Ga0207703_10024671 | Ga0207703_100246712 | 275 |
| 179 | 3300026095 | Ga0207676_10014449 | Ga0207676_100144496 | 275 |
| 180 | 3300048907 | Ga0496104_0082849 | Ga0496104_0082849_981_1853 | 275 |
| 181 | 3300048911 | Ga0496108_0006264 | Ga0496108_0006264_7044_7916 | 275 |
| 182 | 3300048916 | Ga0496113_0007690 | Ga0496113_0007690_1809_2681 | 275 |
| 183 | 3300059421 | Ga0590071_000286 | Ga0590071_000286_3375_4202 | 275 |
| 184 | 3300048913 | Ga0496110_0042319 | Ga0496110_0042319_2612_3487 | 276 |
| 185 | 3300048915 | Ga0496112_0141479 | Ga0496112_0141479_868_1740 | 276 |
| 186 | 3300005536 | Ga0070697_100095605 | Ga0070697_1000956052 | 277 |
| 187 | 3300005546 | Ga0070696_100206394 | Ga0070696_1002063942 | 277 |
| 188 | 3300005617 | Ga0068859_100002430 | Ga0068859_10000243015 | 277 |
| 189 | 3300006931 | Ga0097620_100002430 | Ga0097620_10000243015 | 277 |
| 190 | 3300009098 | Ga0105245_10128529 | Ga0105245_101285292 | 277 |
| 191 | 3300009147 | Ga0114129_10609664 | Ga0114129_106096642 | 277 |
| 192 | 3300025922 | Ga0207646_10159188 | Ga0207646_101591882 | 277 |
| 193 | 3300036401 | Ga0373937_0283328 | Ga0373937_0283328_68_901 | 277 |
| 194 | 3300036401 | Ga0373937_0386871 | Ga0373937_0386871_466_1299 | 277 |
| 195 | 3300046664 | Ga0495659_0112090 | Ga0495659_0112090_58_891 | 277 |
| 196 | 3300049572 | Ga0501036_0042741 | Ga0501036_0042741_2108_2968 | 277 |
| 197 | 3300049577 | Ga0501041_0094191 | Ga0501041_0094191_610_1470 | 277 |
| 198 | 3300049591 | Ga0501075_0120646 | Ga0501075_0120646_143_1003 | 277 |
| 199 | 3300049743 | Ga0501081_0070876 | Ga0501081_0070876_1093_1953 | 277 |
| 200 | 3300050507 | nmdc:mga05p37_478104_c1 | nmdc:mga05p37_478104_c1_98_931 | 277 |
| 201 | 3300050512 | nmdc:mga0n895_389462_c1 | nmdc:mga0n895_389462_c1_198_1031 | 277 |
| 202 | 3300050515 | nmdc:mga0a205_255077_c1 | nmdc:mga0a205_255077_c1_267_1100 | 277 |
| 203 | 3300009176 | Ga0105242_10211456 | Ga0105242_102114562 | 278 |
| 204 | 3300014325 | Ga0163163_10000071 | Ga0163163_1000007119 | 278 |
| 205 | 3300045051 | Ga0451576_0789040 | Ga0451576_0789040_100_975 | 278 |
| 206 | 3300049572 | Ga0501036_0017503 | Ga0501036_0017503_3996_4856 | 278 |
| 207 | 3300049581 | Ga0501047_0032690 | Ga0501047_0032690_3680_4540 | 278 |
| 208 | 3300049584 | Ga0501068_0029322 | Ga0501068_0029322_86_946 | 278 |
| 209 | 3300049586 | Ga0501070_0236651 | Ga0501070_0236651_525_1385 | 278 |
| 210 | 3300049742 | Ga0501080_0073196 | Ga0501080_0073196_618_1478 | 278 |
| 211 | 3300049744 | Ga0501083_0020813 | Ga0501083_0020813_3240_4100 | 278 |
| 212 | 3300049823 | Ga0501044_0357331 | Ga0501044_0357331_429_1289 | 278 |
| 213 | 3300060353 | Ga0501082_0196572 | Ga0501082_0196572_565_1425 | 278 |
| 214 | 3300006914 | Ga0075436_100058963 | Ga0075436_1000589633 | 279 |
| 215 | 3300009177 | Ga0105248_10102078 | Ga0105248_101020782 | 279 |
| 216 | 3300014969 | Ga0157376_10669417 | Ga0157376_106694171 | 279 |
| 217 | 3300025942 | Ga0207689_10067247 | Ga0207689_100672472 | 279 |
| 218 | 3300046681 | Ga0495647_0100015 | Ga0495647_0100015_303_1163 | 279 |
| 219 | 3300047321 | Ga0495676_0147614 | Ga0495676_0147614_725_1585 | 279 |
| 220 | 3300049588 | Ga0501072_0266474 | Ga0501072_0266474_463_1323 | 279 |
| 221 | 3300005293 | Ga0065715_10001723 | Ga0065715_100017237 | 280 |
| 222 | 3300005364 | Ga0070673_100445383 | Ga0070673_1004453832 | 280 |
| 223 | 3300005438 | Ga0070701_10148322 | Ga0070701_101483222 | 280 |
| 224 | 3300005467 | Ga0070706_100192377 | Ga0070706_1001923772 | 280 |
| 225 | 3300005545 | Ga0070695_100006557 | Ga0070695_1000065576 | 280 |
| 226 | 3300005546 | Ga0070696_100276345 | Ga0070696_1002763451 | 280 |
| 227 | 3300005842 | Ga0068858_100062574 | Ga0068858_1000625743 | 280 |
| 228 | 3300005937 | Ga0081455_10152618 | Ga0081455_101526182 | 280 |
| 229 | 3300014325 | Ga0163163_10015069 | Ga0163163_100150697 | 280 |
| 230 | 3300014968 | Ga0157379_10033243 | Ga0157379_100332434 | 280 |
| 231 | 3300025910 | Ga0207684_10166296 | Ga0207684_101662962 | 280 |
| 232 | 3300026035 | Ga0207703_10100743 | Ga0207703_101007433 | 280 |
| 233 | 3300026035 | Ga0207703_10702541 | Ga0207703_107025411 | 280 |
| 234 | 3300026118 | Ga0207675_100177556 | Ga0207675_1001775562 | 280 |
| 235 | 3300005444 | Ga0070694_100018659 | Ga0070694_1000186593 | 281 |
| 236 | 3300005445 | Ga0070708_100505920 | Ga0070708_1005059202 | 281 |
| 237 | 3300005467 | Ga0070706_100310088 | Ga0070706_1003100882 | 281 |
| 238 | 3300005468 | Ga0070707_100220807 | Ga0070707_1002208071 | 281 |
| 239 | 3300005471 | Ga0070698_100200224 | Ga0070698_1002002242 | 281 |
| 240 | 3300005518 | Ga0070699_100001478 | Ga0070699_1000014785 | 281 |
| 241 | 3300005535 | Ga0070684_100181808 | Ga0070684_1001818082 | 281 |
| 242 | 3300005545 | Ga0070695_100050006 | Ga0070695_1000500062 | 281 |
| 243 | 3300005546 | Ga0070696_100037917 | Ga0070696_1000379172 | 281 |
| 244 | 3300005617 | Ga0068859_100213567 | Ga0068859_1002135672 | 281 |
| 245 | 3300005844 | Ga0068862_100309333 | Ga0068862_1003093332 | 281 |
| 246 | 3300006852 | Ga0075433_10196348 | Ga0075433_101963483 | 281 |
| 247 | 3300006871 | Ga0075434_100046329 | Ga0075434_1000463294 | 281 |
| 248 | 3300006881 | Ga0068865_100052129 | Ga0068865_1000521293 | 281 |
| 249 | 3300006914 | Ga0075436_100009966 | Ga0075436_1000099666 | 281 |
| 250 | 3300006931 | Ga0097620_100213557 | Ga0097620_1002135572 | 281 |
| 251 | 3300007076 | Ga0075435_100003568 | Ga0075435_1000035688 | 281 |
| 252 | 3300007076 | Ga0075435_100089258 | Ga0075435_1000892582 | 281 |
| 253 | 3300007265 | Ga0099794_10047989 | Ga0099794_100479892 | 281 |
| 254 | 3300009177 | Ga0105248_10076990 | Ga0105248_100769903 | 281 |
| 255 | 3300013308 | Ga0157375_10595022 | Ga0157375_105950222 | 281 |
| 256 | 3300025922 | Ga0207646_10082584 | Ga0207646_100825842 | 281 |
| 257 | 3300025934 | Ga0207686_10223851 | Ga0207686_102238512 | 281 |
| 258 | 3300026035 | Ga0207703_10543874 | Ga0207703_105438742 | 281 |
| 259 | 3300031344 | Ga0265316_10157511 | Ga0265316_101575111 | 281 |
| 260 | 3300031711 | Ga0265314_10129545 | Ga0265314_101295452 | 281 |
| 261 | 3300046615 | Ga0495656_0095683 | Ga0495656_0095683_135_995 | 281 |
| 262 | 3300048903 | Ga0496100_0069187 | Ga0496100_0069187_397_1242 | 281 |
| 263 | 3300048904 | Ga0496101_0001075 | Ga0496101_0001075_1214_2059 | 281 |
| 264 | 3300048907 | Ga0496104_0002797 | Ga0496104_0002797_13386_14231 | 281 |
| 265 | 3300048908 | Ga0496105_0099450 | Ga0496105_0099450_298_1143 | 281 |
| 266 | 3300048909 | Ga0496106_0025090 | Ga0496106_0025090_2640_3485 | 281 |
| 267 | 3300050507 | nmdc:mga05p37_18019_c1 | nmdc:mga05p37_18019_c1_5801_6658 | 281 |
| 268 | 3300050512 | nmdc:mga0n895_49179_c1 | nmdc:mga0n895_49179_c1_2888_3748 | 281 |
| 269 | 3300050512 | nmdc:mga0n895_57664_c1 | nmdc:mga0n895_57664_c1_2768_3631 | 281 |
| 270 | 3300050513 | nmdc:mga0rr50_131113_c1 | nmdc:mga0rr50_131113_c1_1109_1963 | 281 |
| 271 | 3300050513 | nmdc:mga0rr50_36661_c1 | nmdc:mga0rr50_36661_c1_398_1258 | 281 |
| 272 | 3300050514 | nmdc:mga08x19_98642_c1 | nmdc:mga08x19_98642_c1_715_1569 | 281 |
| 273 | 3300005340 | Ga0070689_100219068 | Ga0070689_1002190681 | 282 |
| 274 | 3300005353 | Ga0070669_100097555 | Ga0070669_1000975552 | 282 |
| 275 | 3300005356 | Ga0070674_100059259 | Ga0070674_1000592592 | 282 |
| 276 | 3300005364 | Ga0070673_100041377 | Ga0070673_1000413772 | 282 |
| 277 | 3300005365 | Ga0070688_100034875 | Ga0070688_1000348752 | 282 |
| 278 | 3300005457 | Ga0070662_100094530 | Ga0070662_1000945302 | 282 |
| 279 | 3300005543 | Ga0070672_100247451 | Ga0070672_1002474512 | 282 |
| 280 | 3300005577 | Ga0068857_100142398 | Ga0068857_1001423982 | 282 |
| 281 | 3300005617 | Ga0068859_100010819 | Ga0068859_1000108192 | 282 |
| 282 | 3300005618 | Ga0068864_100649680 | Ga0068864_1006496801 | 282 |
| 283 | 3300005843 | Ga0068860_100690453 | Ga0068860_1006904531 | 282 |
| 284 | 3300006844 | Ga0075428_100001446 | Ga0075428_1000014466 | 282 |
| 285 | 3300006844 | Ga0075428_100121374 | Ga0075428_1001213743 | 282 |
| 286 | 3300006871 | Ga0075434_100018881 | Ga0075434_1000188813 | 282 |
| 287 | 3300006871 | Ga0075434_100088081 | Ga0075434_1000880812 | 282 |
| 288 | 3300006880 | Ga0075429_100004956 | Ga0075429_1000049563 | 282 |
| 289 | 3300006931 | Ga0097620_100010819 | Ga0097620_1000108192 | 282 |
| 290 | 3300009094 | Ga0111539_10194097 | Ga0111539_101940971 | 282 |
| 291 | 3300009147 | Ga0114129_10000307 | Ga0114129_1000030718 | 282 |
| 292 | 3300009147 | Ga0114129_10041136 | Ga0114129_100411363 | 282 |
| 293 | 3300009177 | Ga0105248_10093898 | Ga0105248_100938982 | 282 |
| 294 | 3300014326 | Ga0157380_10170281 | Ga0157380_101702812 | 282 |
| 295 | 3300025315 | Ga0207697_10100482 | Ga0207697_101004822 | 282 |
| 296 | 3300025918 | Ga0207662_10363168 | Ga0207662_103631681 | 282 |
| 297 | 3300025936 | Ga0207670_10063060 | Ga0207670_100630602 | 282 |
| 298 | 3300025940 | Ga0207691_10131951 | Ga0207691_101319512 | 282 |
| 299 | 3300025941 | Ga0207711_10427666 | Ga0207711_104276661 | 282 |
| 300 | 3300026095 | Ga0207676_10615925 | Ga0207676_106159251 | 282 |
| 301 | 3300027907 | Ga0207428_10265195 | Ga0207428_102651952 | 282 |
| 302 | 3300028380 | Ga0268265_10450452 | Ga0268265_104504521 | 282 |
| 303 | 3300042876 | Ga0451577_0286690 | Ga0451577_0286690_13_861 | 282 |
| 304 | 3300047320 | Ga0495672_0000242 | Ga0495672_0000242_58725_59573 | 282 |
| 305 | 3300049568 | Ga0501031_0330088 | Ga0501031_0330088_53_901 | 282 |
| 306 | 3300049577 | Ga0501041_0039182 | Ga0501041_0039182_999_1847 | 282 |
| 307 | 3300049592 | Ga0501076_0005951 | Ga0501076_0005951_6381_7229 | 282 |
| 308 | 3300049824 | Ga0501045_0074879 | Ga0501045_0074879_670_1518 | 282 |
| 309 | 3300050493 | nmdc:mga0k408_274502_c1 | nmdc:mga0k408_274502_c1_116_964 | 282 |
| 310 | 3300050493 | nmdc:mga0k408_48248_c1 | nmdc:mga0k408_48248_c1_815_1663 | 282 |
| 311 | 3300050495 | nmdc:mga04h51_112180_c1 | nmdc:mga04h51_112180_c1_48_896 | 282 |
| 312 | 3300050507 | nmdc:mga05p37_56987_c1 | nmdc:mga05p37_56987_c1_2513_3361 | 282 |
| 313 | 3300050507 | nmdc:mga05p37_6700_c1 | nmdc:mga05p37_6700_c1_12551_13420 | 282 |
| 314 | 3300050508 | nmdc:mga09592_2118_c1 | nmdc:mga09592_2118_c1_1242_2090 | 282 |
| 315 | 3300050511 | nmdc:mga08y16_594705_c1 | nmdc:mga08y16_594705_c1_107_955 | 282 |
| 316 | 3300050512 | nmdc:mga0n895_106475_c1 | nmdc:mga0n895_106475_c1_874_1743 | 282 |
| 317 | 3300050513 | nmdc:mga0rr50_183809_c1 | nmdc:mga0rr50_183809_c1_236_1084 | 282 |
| 318 | 3300050515 | nmdc:mga0a205_211484_c1 | nmdc:mga0a205_211484_c1_821_1669 | 282 |
| 319 | 3300053103 | Ga0500555_022300 | Ga0500555_022300_839_1687 | 282 |
| 320 | 3300005328 | Ga0070676_10017521 | Ga0070676_100175212 | 283 |
| 321 | 3300005330 | Ga0070690_100033059 | Ga0070690_1000330593 | 283 |
| 322 | 3300005330 | Ga0070690_100039162 | Ga0070690_1000391622 | 283 |
| 323 | 3300005334 | Ga0068869_100000964 | Ga0068869_10000096410 | 283 |
| 324 | 3300005340 | Ga0070689_100007688 | Ga0070689_1000076886 | 283 |
| 325 | 3300005347 | Ga0070668_100103380 | Ga0070668_1001033803 | 283 |
| 326 | 3300005353 | Ga0070669_100031922 | Ga0070669_1000319223 | 283 |
| 327 | 3300005354 | Ga0070675_100126870 | Ga0070675_1001268702 | 283 |
| 328 | 3300005356 | Ga0070674_100001871 | Ga0070674_1000018718 | 283 |
| 329 | 3300005365 | Ga0070688_100007851 | Ga0070688_1000078512 | 283 |
| 330 | 3300005367 | Ga0070667_100022288 | Ga0070667_1000222884 | 283 |
| 331 | 3300005406 | Ga0070703_10030703 | Ga0070703_100307032 | 283 |
| 332 | 3300005438 | Ga0070701_10040089 | Ga0070701_100400892 | 283 |
| 333 | 3300005438 | Ga0070701_10194275 | Ga0070701_101942752 | 283 |
| 334 | 3300005444 | Ga0070694_100079716 | Ga0070694_1000797162 | 283 |
| 335 | 3300005444 | Ga0070694_100402596 | Ga0070694_1004025962 | 283 |
| 336 | 3300005456 | Ga0070678_100003316 | Ga0070678_1000033162 | 283 |
| 337 | 3300005458 | Ga0070681_10427219 | Ga0070681_104272192 | 283 |
| 338 | 3300005459 | Ga0068867_100002075 | Ga0068867_1000020752 | 283 |
| 339 | 3300005467 | Ga0070706_100011704 | Ga0070706_1000117043 | 283 |
| 340 | 3300005467 | Ga0070706_100012509 | Ga0070706_1000125092 | 283 |
| 341 | 3300005468 | Ga0070707_100014338 | Ga0070707_1000143386 | 283 |
| 342 | 3300005471 | Ga0070698_100019232 | Ga0070698_1000192325 | 283 |
| 343 | 3300005471 | Ga0070698_100032063 | Ga0070698_1000320632 | 283 |
| 344 | 3300005518 | Ga0070699_100004519 | Ga0070699_1000045199 | 283 |
| 345 | 3300005518 | Ga0070699_100032818 | Ga0070699_1000328182 | 283 |
| 346 | 3300005518 | Ga0070699_100110423 | Ga0070699_1001104232 | 283 |
| 347 | 3300005536 | Ga0070697_100020652 | Ga0070697_1000206524 | 283 |
| 348 | 3300005539 | Ga0068853_100278383 | Ga0068853_1002783832 | 283 |
| 349 | 3300005543 | Ga0070672_100028622 | Ga0070672_1000286223 | 283 |
| 350 | 3300005544 | Ga0070686_100000389 | Ga0070686_10000038924 | 283 |
| 351 | 3300005544 | Ga0070686_100009670 | Ga0070686_1000096702 | 283 |
| 352 | 3300005545 | Ga0070695_100008088 | Ga0070695_1000080882 | 283 |
| 353 | 3300005546 | Ga0070696_100084821 | Ga0070696_1000848212 | 283 |
| 354 | 3300005549 | Ga0070704_100023161 | Ga0070704_1000231613 | 283 |
| 355 | 3300005549 | Ga0070704_100080914 | Ga0070704_1000809142 | 283 |
| 356 | 3300005578 | Ga0068854_100011771 | Ga0068854_1000117714 | 283 |
| 357 | 3300005614 | Ga0068856_100020616 | Ga0068856_1000206163 | 283 |
| 358 | 3300005615 | Ga0070702_100139383 | Ga0070702_1001393832 | 283 |
| 359 | 3300005617 | Ga0068859_100010205 | Ga0068859_1000102056 | 283 |
| 360 | 3300005719 | Ga0068861_100039211 | Ga0068861_1000392112 | 283 |
| 361 | 3300005840 | Ga0068870_10003571 | Ga0068870_100035713 | 283 |
| 362 | 3300005841 | Ga0068863_100007204 | Ga0068863_1000072046 | 283 |
| 363 | 3300005842 | Ga0068858_100022246 | Ga0068858_1000222462 | 283 |
| 364 | 3300005843 | Ga0068860_100017112 | Ga0068860_1000171125 | 283 |
| 365 | 3300005844 | Ga0068862_100307396 | Ga0068862_1003073962 | 283 |
| 366 | 3300006038 | Ga0075365_10001234 | Ga0075365_100012342 | 283 |
| 367 | 3300006042 | Ga0075368_10015337 | Ga0075368_100153373 | 283 |
| 368 | 3300006048 | Ga0075363_100024048 | Ga0075363_1000240482 | 283 |
| 369 | 3300006048 | Ga0075363_100127602 | Ga0075363_1001276022 | 283 |
| 370 | 3300006051 | Ga0075364_10016789 | Ga0075364_100167892 | 283 |
| 371 | 3300006051 | Ga0075364_10158757 | Ga0075364_101587572 | 283 |
| 372 | 3300006178 | Ga0075367_10000879 | Ga0075367_100008794 | 283 |
| 373 | 3300006178 | Ga0075367_10001875 | Ga0075367_100018754 | 283 |
| 374 | 3300006195 | Ga0075366_10000322 | Ga0075366_100003225 | 283 |
| 375 | 3300006353 | Ga0075370_10112040 | Ga0075370_101120402 | 283 |
| 376 | 3300006844 | Ga0075428_100009291 | Ga0075428_1000092916 | 283 |
| 377 | 3300006844 | Ga0075428_100044494 | Ga0075428_1000444942 | 283 |
| 378 | 3300006844 | Ga0075428_100049566 | Ga0075428_1000495665 | 283 |
| 379 | 3300006844 | Ga0075428_100235005 | Ga0075428_1002350052 | 283 |
| 380 | 3300006846 | Ga0075430_100041017 | Ga0075430_1000410172 | 283 |
| 381 | 3300006847 | Ga0075431_100000373 | Ga0075431_1000003739 | 283 |
| 382 | 3300006847 | Ga0075431_100200574 | Ga0075431_1002005742 | 283 |
| 383 | 3300006852 | Ga0075433_10119754 | Ga0075433_101197543 | 283 |
| 384 | 3300006852 | Ga0075433_10362897 | Ga0075433_103628972 | 283 |
| 385 | 3300006871 | Ga0075434_100116335 | Ga0075434_1001163352 | 283 |
| 386 | 3300006871 | Ga0075434_100147879 | Ga0075434_1001478792 | 283 |
| 387 | 3300006871 | Ga0075434_100232096 | Ga0075434_1002320962 | 283 |
| 388 | 3300006871 | Ga0075434_100686417 | Ga0075434_1006864172 | 283 |
| 389 | 3300006880 | Ga0075429_100057532 | Ga0075429_1000575322 | 283 |
| 390 | 3300006881 | Ga0068865_100014920 | Ga0068865_1000149205 | 283 |
| 391 | 3300006881 | Ga0068865_100454968 | Ga0068865_1004549682 | 283 |
| 392 | 3300006931 | Ga0097620_100010205 | Ga0097620_1000102056 | 283 |
| 393 | 3300007076 | Ga0075435_100003713 | Ga0075435_1000037139 | 283 |
| 394 | 3300009093 | Ga0105240_10243836 | Ga0105240_102438362 | 283 |
| 395 | 3300009093 | Ga0105240_10646204 | Ga0105240_106462041 | 283 |
| 396 | 3300009094 | Ga0111539_10000156 | Ga0111539_1000015613 | 283 |
| 397 | 3300009094 | Ga0111539_10001042 | Ga0111539_1000104220 | 283 |
| 398 | 3300009147 | Ga0114129_10105727 | Ga0114129_101057273 | 283 |
| 399 | 3300009147 | Ga0114129_10190198 | Ga0114129_101901983 | 283 |
| 400 | 3300009147 | Ga0114129_10373801 | Ga0114129_103738011 | 283 |
| 401 | 3300009148 | Ga0105243_10026757 | Ga0105243_100267573 | 283 |
| 402 | 3300009148 | Ga0105243_10032527 | Ga0105243_100325275 | 283 |
| 403 | 3300009176 | Ga0105242_10014541 | Ga0105242_100145412 | 283 |
| 404 | 3300009177 | Ga0105248_10013204 | Ga0105248_100132047 | 283 |
| 405 | 3300014745 | Ga0157377_10019370 | Ga0157377_100193702 | 283 |
| 406 | 3300014968 | Ga0157379_10172233 | Ga0157379_101722332 | 283 |
| 407 | 3300025885 | Ga0207653_10021645 | Ga0207653_100216452 | 283 |
| 408 | 3300025907 | Ga0207645_10020740 | Ga0207645_100207403 | 283 |
| 409 | 3300025908 | Ga0207643_10003545 | Ga0207643_100035453 | 283 |
| 410 | 3300025910 | Ga0207684_10002365 | Ga0207684_100023657 | 283 |
| 411 | 3300025910 | Ga0207684_10011424 | Ga0207684_100114244 | 283 |
| 412 | 3300025910 | Ga0207684_10057251 | Ga0207684_100572512 | 283 |
| 413 | 3300025913 | Ga0207695_10206287 | Ga0207695_102062872 | 283 |
| 414 | 3300025918 | Ga0207662_10010058 | Ga0207662_100100585 | 283 |
| 415 | 3300025922 | Ga0207646_10038448 | Ga0207646_100384483 | 283 |
| 416 | 3300025922 | Ga0207646_10099480 | Ga0207646_100994802 | 283 |
| 417 | 3300025923 | Ga0207681_10064591 | Ga0207681_100645912 | 283 |
| 418 | 3300025937 | Ga0207669_10023792 | Ga0207669_100237924 | 283 |
| 419 | 3300025938 | Ga0207704_10014182 | Ga0207704_100141825 | 283 |
| 420 | 3300025940 | Ga0207691_10022611 | Ga0207691_100226112 | 283 |
| 421 | 3300025941 | Ga0207711_10077122 | Ga0207711_100771222 | 283 |
| 422 | 3300025942 | Ga0207689_10005018 | Ga0207689_100050188 | 283 |
| 423 | 3300025961 | Ga0207712_10051925 | Ga0207712_100519252 | 283 |
| 424 | 3300025981 | Ga0207640_10014136 | Ga0207640_100141362 | 283 |
| 425 | 3300025986 | Ga0207658_10465473 | Ga0207658_104654732 | 283 |
| 426 | 3300026035 | Ga0207703_10008893 | Ga0207703_100088936 | 283 |
| 427 | 3300026075 | Ga0207708_10022108 | Ga0207708_100221082 | 283 |
| 428 | 3300026078 | Ga0207702_10154700 | Ga0207702_101547003 | 283 |
| 429 | 3300026088 | Ga0207641_10067332 | Ga0207641_100673322 | 283 |
| 430 | 3300026089 | Ga0207648_10021347 | Ga0207648_100213475 | 283 |
| 431 | 3300026118 | Ga0207675_100060424 | Ga0207675_1000604242 | 283 |
| 432 | 3300026121 | Ga0207683_10081641 | Ga0207683_100816413 | 283 |
| 433 | 3300027907 | Ga0207428_10000070 | Ga0207428_1000007042 | 283 |
| 434 | 3300028381 | Ga0268264_10043485 | Ga0268264_100434854 | 283 |
| 435 | 3300034816 | Ga0373930_0000070 | Ga0373930_0000070_6723_7589 | 283 |
| 436 | 3300034817 | Ga0373948_0008242 | Ga0373948_0008242_79_945 | 283 |
| 437 | 3300035088 | Ga0373940_0000640 | Ga0373940_0000640_1181_2047 | 283 |
| 438 | 3300035090 | Ga0373949_0000540 | Ga0373949_0000540_1717_2583 | 283 |
| 439 | 3300035207 | Ga0373942_0000397 | Ga0373942_0000397_4537_5403 | 283 |
| 440 | 3300035241 | Ga0373961_0001526 | Ga0373961_0001526_1541_2407 | 283 |
| 441 | 3300046460 | Ga0495638_0015021 | Ga0495638_0015021_1698_2561 | 283 |
| 442 | 3300048905 | Ga0496102_0022264 | Ga0496102_0022264_4160_5026 | 283 |
| 443 | 3300049587 | Ga0501071_0234230 | Ga0501071_0234230_492_1343 | 283 |
| 444 | 3300049741 | Ga0501079_0207115 | Ga0501079_0207115_24_875 | 283 |
| 445 | 3300049743 | Ga0501081_0110545 | Ga0501081_0110545_82_933 | 283 |
| 446 | 3300050490 | nmdc:mga03n38_109712_c1 | nmdc:mga03n38_109712_c1_130_981 | 283 |
| 447 | 3300050492 | nmdc:mga0yw44_115556_c1 | nmdc:mga0yw44_115556_c1_313_1173 | 283 |
| 448 | 3300050493 | nmdc:mga0k408_1023_c1 | nmdc:mga0k408_1023_c1_11420_12280 | 283 |
| 449 | 3300050494 | nmdc:mga06z11_2066_c1 | nmdc:mga06z11_2066_c1_123_983 | 283 |
| 450 | 3300050496 | nmdc:mga07m45_110212_c1 | nmdc:mga07m45_110212_c1_317_1177 | 283 |
| 451 | 3300050507 | nmdc:mga05p37_115943_c1 | nmdc:mga05p37_115943_c1_1376_2227 | 283 |
| 452 | 3300050507 | nmdc:mga05p37_6282_c1 | nmdc:mga05p37_6282_c1_11781_12632 | 283 |
| 453 | 3300050508 | nmdc:mga09592_39944_c1 | nmdc:mga09592_39944_c1_451_1311 | 283 |
| 454 | 3300050510 | nmdc:mga06r32_1608_c1 | nmdc:mga06r32_1608_c1_1782_2633 | 283 |
| 455 | 3300050511 | nmdc:mga08y16_15573_c1 | nmdc:mga08y16_15573_c1_6195_7046 | 283 |
| 456 | 3300050511 | nmdc:mga08y16_1915_c1 | nmdc:mga08y16_1915_c1_9346_10206 | 283 |
| 457 | 3300050512 | nmdc:mga0n895_312407_c1 | nmdc:mga0n895_312407_c1_257_1108 | 283 |
| 458 | 3300050513 | nmdc:mga0rr50_32880_c1 | nmdc:mga0rr50_32880_c1_2532_3383 | 283 |
| 459 | 3300050515 | nmdc:mga0a205_182600_c1 | nmdc:mga0a205_182600_c1_44_895 | 283 |
| 460 | 3300050515 | nmdc:mga0a205_286039_c1 | nmdc:mga0a205_286039_c1_135_986 | 283 |
| 461 | 3300050515 | nmdc:mga0a205_390141_c1 | nmdc:mga0a205_390141_c1_10_861 | 283 |
| 462 | 3300060353 | Ga0501082_0189629 | Ga0501082_0189629_443_1294 | 283 |
| 463 | 3300060353 | Ga0501082_0304890 | Ga0501082_0304890_258_1109 | 283 |
| 464 | 3300005471 | Ga0070698_100019157 | Ga0070698_1000191574 | 284 |
| 465 | 3300005844 | Ga0068862_100600230 | Ga0068862_1006002301 | 284 |
| 466 | 3300009093 | Ga0105240_10092713 | Ga0105240_100927133 | 284 |
| 467 | 3300009147 | Ga0114129_10205497 | Ga0114129_102054972 | 284 |
| 468 | 3300025913 | Ga0207695_10306351 | Ga0207695_103063512 | 284 |
| 469 | 3300026089 | Ga0207648_10126285 | Ga0207648_101262852 | 284 |
| 470 | 3300050507 | nmdc:mga05p37_217260_c1 | nmdc:mga05p37_217260_c1_189_1058 | 284 |
| 471 | 3300005328 | Ga0070676_10068840 | Ga0070676_100688402 | 285 |
| 472 | 3300005335 | Ga0070666_10106778 | Ga0070666_101067782 | 285 |
| 473 | 3300005340 | Ga0070689_100380007 | Ga0070689_1003800072 | 285 |
| 474 | 3300005353 | Ga0070669_100397713 | Ga0070669_1003977131 | 285 |
| 475 | 3300005355 | Ga0070671_100026568 | Ga0070671_1000265684 | 285 |
| 476 | 3300005365 | Ga0070688_100026468 | Ga0070688_1000264682 | 285 |
| 477 | 3300005365 | Ga0070688_100169452 | Ga0070688_1001694521 | 285 |
| 478 | 3300005367 | Ga0070667_100057268 | Ga0070667_1000572683 | 285 |
| 479 | 3300005434 | Ga0070709_10071049 | Ga0070709_100710492 | 285 |
| 480 | 3300005434 | Ga0070709_10099188 | Ga0070709_100991882 | 285 |
| 481 | 3300005435 | Ga0070714_100054657 | Ga0070714_1000546572 | 285 |
| 482 | 3300005436 | Ga0070713_100069420 | Ga0070713_1000694204 | 285 |
| 483 | 3300005439 | Ga0070711_100200363 | Ga0070711_1002003632 | 285 |
| 484 | 3300005456 | Ga0070678_100192055 | Ga0070678_1001920552 | 285 |
| 485 | 3300005459 | Ga0068867_100008030 | Ga0068867_1000080308 | 285 |
| 486 | 3300005459 | Ga0068867_100084626 | Ga0068867_1000846262 | 285 |
| 487 | 3300005471 | Ga0070698_100028041 | Ga0070698_1000280416 | 285 |
| 488 | 3300005530 | Ga0070679_100219458 | Ga0070679_1002194582 | 285 |
| 489 | 3300005539 | Ga0068853_100678191 | Ga0068853_1006781911 | 285 |
| 490 | 3300005543 | Ga0070672_100379155 | Ga0070672_1003791552 | 285 |
| 491 | 3300005543 | Ga0070672_100500864 | Ga0070672_1005008642 | 285 |
| 492 | 3300005544 | Ga0070686_100068212 | Ga0070686_1000682122 | 285 |
| 493 | 3300005547 | Ga0070693_100128802 | Ga0070693_1001288022 | 285 |
| 494 | 3300005548 | Ga0070665_100005633 | Ga0070665_1000056339 | 285 |
| 495 | 3300005549 | Ga0070704_100050537 | Ga0070704_1000505374 | 285 |
| 496 | 3300005578 | Ga0068854_100034635 | Ga0068854_1000346354 | 285 |
| 497 | 3300005615 | Ga0070702_100076128 | Ga0070702_1000761282 | 285 |
| 498 | 3300005617 | Ga0068859_100076006 | Ga0068859_1000760063 | 285 |
| 499 | 3300005618 | Ga0068864_100468257 | Ga0068864_1004682571 | 285 |
| 500 | 3300005841 | Ga0068863_100083398 | Ga0068863_1000833982 | 285 |
| 501 | 3300005841 | Ga0068863_100700121 | Ga0068863_1007001212 | 285 |
| 502 | 3300005842 | Ga0068858_100175688 | Ga0068858_1001756882 | 285 |
| 503 | 3300005842 | Ga0068858_100214731 | Ga0068858_1002147311 | 285 |
| 504 | 3300005843 | Ga0068860_100084173 | Ga0068860_1000841734 | 285 |
| 505 | 3300005844 | Ga0068862_100053930 | Ga0068862_1000539302 | 285 |
| 506 | 3300005844 | Ga0068862_100116919 | Ga0068862_1001169192 | 285 |
| 507 | 3300005844 | Ga0068862_100479580 | Ga0068862_1004795802 | 285 |
| 508 | 3300006175 | Ga0070712_100413800 | Ga0070712_1004138002 | 285 |
| 509 | 3300006237 | Ga0097621_100022037 | Ga0097621_1000220372 | 285 |
| 510 | 3300006237 | Ga0097621_100025087 | Ga0097621_1000250872 | 285 |
| 511 | 3300006237 | Ga0097621_100474135 | Ga0097621_1004741351 | 285 |
| 512 | 3300006358 | Ga0068871_100002675 | Ga0068871_1000026755 | 285 |
| 513 | 3300006844 | Ga0075428_100322682 | Ga0075428_1003226822 | 285 |
| 514 | 3300006871 | Ga0075434_100000731 | Ga0075434_1000007319 | 285 |
| 515 | 3300006881 | Ga0068865_100079374 | Ga0068865_1000793742 | 285 |
| 516 | 3300006881 | Ga0068865_100196771 | Ga0068865_1001967712 | 285 |
| 517 | 3300006881 | Ga0068865_100411148 | Ga0068865_1004111481 | 285 |
| 518 | 3300006914 | Ga0075436_100029447 | Ga0075436_1000294475 | 285 |
| 519 | 3300006931 | Ga0097620_100076008 | Ga0097620_1000760083 | 285 |
| 520 | 3300007076 | Ga0075435_100015716 | Ga0075435_1000157166 | 285 |
| 521 | 3300009093 | Ga0105240_10558426 | Ga0105240_105584262 | 285 |
| 522 | 3300009147 | Ga0114129_10233471 | Ga0114129_102334712 | 285 |
| 523 | 3300009176 | Ga0105242_10026694 | Ga0105242_100266943 | 285 |
| 524 | 3300009176 | Ga0105242_10046424 | Ga0105242_100464243 | 285 |
| 525 | 3300009176 | Ga0105242_10166914 | Ga0105242_101669142 | 285 |
| 526 | 3300009176 | Ga0105242_10626399 | Ga0105242_106263991 | 285 |
| 527 | 3300009177 | Ga0105248_10036959 | Ga0105248_100369593 | 285 |
| 528 | 3300009177 | Ga0105248_10098891 | Ga0105248_100988912 | 285 |
| 529 | 3300013308 | Ga0157375_10261724 | Ga0157375_102617242 | 285 |
| 530 | 3300014326 | Ga0157380_10037774 | Ga0157380_100377742 | 285 |
| 531 | 3300014968 | Ga0157379_10033107 | Ga0157379_100331074 | 285 |
| 532 | 3300014969 | Ga0157376_10019635 | Ga0157376_100196355 | 285 |
| 533 | 3300014969 | Ga0157376_10036751 | Ga0157376_100367514 | 285 |
| 534 | 3300014969 | Ga0157376_10144372 | Ga0157376_101443722 | 285 |
| 535 | 3300025899 | Ga0207642_10019615 | Ga0207642_100196152 | 285 |
| 536 | 3300025903 | Ga0207680_10100316 | Ga0207680_101003162 | 285 |
| 537 | 3300025918 | Ga0207662_10072333 | Ga0207662_100723332 | 285 |
| 538 | 3300025921 | Ga0207652_10196227 | Ga0207652_101962272 | 285 |
| 539 | 3300025923 | Ga0207681_10361668 | Ga0207681_103616682 | 285 |
| 540 | 3300025926 | Ga0207659_10000076 | Ga0207659_1000007658 | 285 |
| 541 | 3300025927 | Ga0207687_10008761 | Ga0207687_100087614 | 285 |
| 542 | 3300025928 | Ga0207700_10036920 | Ga0207700_100369204 | 285 |
| 543 | 3300025929 | Ga0207664_10076262 | Ga0207664_100762622 | 285 |
| 544 | 3300025931 | Ga0207644_10380629 | Ga0207644_103806292 | 285 |
| 545 | 3300025933 | Ga0207706_10105559 | Ga0207706_101055592 | 285 |
| 546 | 3300025934 | Ga0207686_10049941 | Ga0207686_100499412 | 285 |
| 547 | 3300025934 | Ga0207686_10054142 | Ga0207686_100541422 | 285 |
| 548 | 3300025935 | Ga0207709_10028376 | Ga0207709_100283764 | 285 |
| 549 | 3300025936 | Ga0207670_10373440 | Ga0207670_103734401 | 285 |
| 550 | 3300025937 | Ga0207669_10030630 | Ga0207669_100306302 | 285 |
| 551 | 3300025937 | Ga0207669_10058849 | Ga0207669_100588492 | 285 |
| 552 | 3300025937 | Ga0207669_10375172 | Ga0207669_103751722 | 285 |
| 553 | 3300025938 | Ga0207704_10045320 | Ga0207704_100453203 | 285 |
| 554 | 3300025940 | Ga0207691_10084145 | Ga0207691_100841453 | 285 |
| 555 | 3300025940 | Ga0207691_10087212 | Ga0207691_100872123 | 285 |
| 556 | 3300025940 | Ga0207691_10390183 | Ga0207691_103901832 | 285 |
| 557 | 3300025941 | Ga0207711_10100385 | Ga0207711_101003853 | 285 |
| 558 | 3300025941 | Ga0207711_10129375 | Ga0207711_101293752 | 285 |
| 559 | 3300025942 | Ga0207689_10067106 | Ga0207689_100671063 | 285 |
| 560 | 3300025960 | Ga0207651_10181184 | Ga0207651_101811842 | 285 |
| 561 | 3300025961 | Ga0207712_10249743 | Ga0207712_102497432 | 285 |
| 562 | 3300026023 | Ga0207677_10138745 | Ga0207677_101387452 | 285 |
| 563 | 3300026041 | Ga0207639_10597866 | Ga0207639_105978661 | 285 |
| 564 | 3300026088 | Ga0207641_10211034 | Ga0207641_102110341 | 285 |
| 565 | 3300026089 | Ga0207648_10024283 | Ga0207648_100242837 | 285 |
| 566 | 3300026089 | Ga0207648_10184678 | Ga0207648_101846782 | 285 |
| 567 | 3300026089 | Ga0207648_10496780 | Ga0207648_104967802 | 285 |
| 568 | 3300026121 | Ga0207683_10228387 | Ga0207683_102283872 | 285 |
| 569 | 3300027907 | Ga0207428_10018313 | Ga0207428_100183133 | 285 |
| 570 | 3300028380 | Ga0268265_10199289 | Ga0268265_101992892 | 285 |
| 571 | 3300028380 | Ga0268265_10227279 | Ga0268265_102272792 | 285 |
| 572 | 3300028381 | Ga0268264_10108713 | Ga0268264_101087132 | 285 |
| 573 | 3300028381 | Ga0268264_10133144 | Ga0268264_101331443 | 285 |
| 574 | 3300028381 | Ga0268264_10317624 | Ga0268264_103176242 | 285 |
| 575 | 3300031995 | Ga0307409_100043273 | Ga0307409_1000432733 | 285 |
| 576 | 3300032005 | Ga0307411_10157774 | Ga0307411_101577742 | 285 |
| 577 | 3300035171 | Ga0373946_0066593 | Ga0373946_0066593_123_989 | 285 |
| 578 | 3300035691 | Ga0373931_0098264 | Ga0373931_0098264_14_880 | 285 |
| 579 | 3300035724 | Ga0373933_0300647 | Ga0373933_0300647_74_940 | 285 |
| 580 | 3300035725 | Ga0373947_0155390 | Ga0373947_0155390_237_1103 | 285 |
| 581 | 3300036401 | Ga0373937_0061534 | Ga0373937_0061534_1228_2094 | 285 |
| 582 | 3300037068 | Ga0373925_0086098 | Ga0373925_0086098_1287_2153 | 285 |
| 583 | 3300037068 | Ga0373925_0140146 | Ga0373925_0140146_515_1372 | 285 |
| 584 | 3300046472 | Ga0495580_0164754 | Ga0495580_0164754_22_924 | 285 |
| 585 | 3300046511 | Ga0495608_0003061 | Ga0495608_0003061_3487_4344 | 285 |
| 586 | 3300046516 | Ga0495628_0032621 | Ga0495628_0032621_2222_3079 | 285 |
| 587 | 3300046516 | Ga0495628_0090587 | Ga0495628_0090587_394_1260 | 285 |
| 588 | 3300046517 | Ga0495630_0003233 | Ga0495630_0003233_1484_2341 | 285 |
| 589 | 3300046522 | Ga0495643_0005940 | Ga0495643_0005940_566_1423 | 285 |
| 590 | 3300046529 | Ga0495652_0105738 | Ga0495652_0105738_1385_2242 | 285 |
| 591 | 3300046535 | Ga0495586_0068635 | Ga0495586_0068635_1033_1890 | 285 |
| 592 | 3300046558 | Ga0495633_0117561 | Ga0495633_0117561_19_882 | 285 |
| 593 | 3300046642 | Ga0495634_0250667 | Ga0495634_0250667_201_1058 | 285 |
| 594 | 3300046678 | Ga0495599_0296464 | Ga0495599_0296464_44_943 | 285 |
| 595 | 3300046683 | Ga0495658_0038388 | Ga0495658_0038388_134_991 | 285 |
| 596 | 3300046684 | Ga0495669_0007871 | Ga0495669_0007871_2237_3094 | 285 |
| 597 | 3300046689 | Ga0495613_0001719 | Ga0495613_0001719_15060_15917 | 285 |
| 598 | 3300047319 | Ga0495674_0046339 | Ga0495674_0046339_259_1116 | 285 |
| 599 | 3300047319 | Ga0495674_0412679 | Ga0495674_0412679_14_913 | 285 |
| 600 | 3300047471 | Ga0495684_0000189 | Ga0495684_0000189_45189_46046 | 285 |
| 601 | 3300048904 | Ga0496101_0083968 | Ga0496101_0083968_1218_2084 | 285 |
| 602 | 3300048915 | Ga0496112_0056169 | Ga0496112_0056169_1054_1920 | 285 |
| 603 | 3300050507 | nmdc:mga05p37_296188_c1 | nmdc:mga05p37_296188_c1_758_1666 | 285 |
| 604 | 3300050508 | nmdc:mga09592_447066_c1 | nmdc:mga09592_447066_c1_31_915 | 285 |
| 605 | 3300050512 | nmdc:mga0n895_101653_c1 | nmdc:mga0n895_101653_c1_1740_2648 | 285 |
| 606 | 3300050512 | nmdc:mga0n895_228054_c1 | nmdc:mga0n895_228054_c1_888_1760 | 285 |
| 607 | 3300050513 | nmdc:mga0rr50_93444_c1 | nmdc:mga0rr50_93444_c1_217_1125 | 285 |
| 608 | 3300050514 | nmdc:mga08x19_9112_c1 | nmdc:mga08x19_9112_c1_2772_3680 | 285 |
| 609 | 3300053077 | Ga0495601_0026265 | Ga0495601_0026265_1277_2134 | 285 |
| 610 | 3300053077 | Ga0495601_0056226 | Ga0495601_0056226_903_1802 | 285 |
| 611 | 3300053077 | Ga0495601_0074765 | Ga0495601_0074765_343_1209 | 285 |
| 612 | 3300053085 | Ga0495619_0004868 | Ga0495619_0004868_7554_8411 | 285 |
| 613 | 3300005295 | Ga0065707_10000798 | Ga0065707_100007983 | 286 |
| 614 | 3300005353 | Ga0070669_100043051 | Ga0070669_1000430513 | 286 |
| 615 | 3300005353 | Ga0070669_100137527 | Ga0070669_1001375272 | 286 |
| 616 | 3300005444 | Ga0070694_100049731 | Ga0070694_1000497312 | 286 |
| 617 | 3300005543 | Ga0070672_100094880 | Ga0070672_1000948802 | 286 |
| 618 | 3300005549 | Ga0070704_100378791 | Ga0070704_1003787912 | 286 |
| 619 | 3300005841 | Ga0068863_100075448 | Ga0068863_1000754482 | 286 |
| 620 | 3300005841 | Ga0068863_100176568 | Ga0068863_1001765683 | 286 |
| 621 | 3300005844 | Ga0068862_100039812 | Ga0068862_1000398122 | 286 |
| 622 | 3300005844 | Ga0068862_100115564 | Ga0068862_1001155642 | 286 |
| 623 | 3300005937 | Ga0081455_10073814 | Ga0081455_100738143 | 286 |
| 624 | 3300006051 | Ga0075364_10052859 | Ga0075364_100528592 | 286 |
| 625 | 3300006237 | Ga0097621_100050591 | Ga0097621_1000505912 | 286 |
| 626 | 3300006358 | Ga0068871_100005949 | Ga0068871_1000059494 | 286 |
| 627 | 3300006358 | Ga0068871_100010750 | Ga0068871_1000107505 | 286 |
| 628 | 3300006358 | Ga0068871_100220821 | Ga0068871_1002208212 | 286 |
| 629 | 3300006844 | Ga0075428_100125903 | Ga0075428_1001259033 | 286 |
| 630 | 3300006852 | Ga0075433_10021172 | Ga0075433_100211725 | 286 |
| 631 | 3300006871 | Ga0075434_100055954 | Ga0075434_1000559542 | 286 |
| 632 | 3300006871 | Ga0075434_100213999 | Ga0075434_1002139993 | 286 |
| 633 | 3300006914 | Ga0075436_100001874 | Ga0075436_10000187412 | 286 |
| 634 | 3300007076 | Ga0075435_100000052 | Ga0075435_10000005228 | 286 |
| 635 | 3300009094 | Ga0111539_10006977 | Ga0111539_100069777 | 286 |
| 636 | 3300009094 | Ga0111539_10175052 | Ga0111539_101750523 | 286 |
| 637 | 3300009147 | Ga0114129_10000789 | Ga0114129_1000078922 | 286 |
| 638 | 3300009147 | Ga0114129_10022026 | Ga0114129_100220264 | 286 |
| 639 | 3300009177 | Ga0105248_10085756 | Ga0105248_100857562 | 286 |
| 640 | 3300009545 | Ga0105237_10163863 | Ga0105237_101638633 | 286 |
| 641 | 3300009553 | Ga0105249_10201704 | Ga0105249_102017042 | 286 |
| 642 | 3300013308 | Ga0157375_10504432 | Ga0157375_105044322 | 286 |
| 643 | 3300014326 | Ga0157380_10356277 | Ga0157380_103562771 | 286 |
| 644 | 3300025905 | Ga0207685_10073529 | Ga0207685_100735292 | 286 |
| 645 | 3300025923 | Ga0207681_10025744 | Ga0207681_100257444 | 286 |
| 646 | 3300025923 | Ga0207681_10110831 | Ga0207681_101108312 | 286 |
| 647 | 3300025941 | Ga0207711_10033049 | Ga0207711_100330494 | 286 |
| 648 | 3300026035 | Ga0207703_10046292 | Ga0207703_100462922 | 286 |
| 649 | 3300026075 | Ga0207708_10166396 | Ga0207708_101663963 | 286 |
| 650 | 3300026088 | Ga0207641_10002582 | Ga0207641_100025827 | 286 |
| 651 | 3300026088 | Ga0207641_10123881 | Ga0207641_101238813 | 286 |
| 652 | 3300026089 | Ga0207648_10209558 | Ga0207648_102095582 | 286 |
| 653 | 3300027907 | Ga0207428_10058479 | Ga0207428_100584792 | 286 |
| 654 | 3300028380 | Ga0268265_10016423 | Ga0268265_100164232 | 286 |
| 655 | 3300028380 | Ga0268265_10027810 | Ga0268265_100278103 | 286 |
| 656 | 3300032002 | Ga0307416_100218624 | Ga0307416_1002186242 | 286 |
| 657 | 3300044712 | Ga0453684_0089560 | Ga0453684_0089560_196_1056 | 286 |
| 658 | 3300046459 | Ga0495629_0286003 | Ga0495629_0286003_137_1006 | 286 |
| 659 | 3300046472 | Ga0495580_0079243 | Ga0495580_0079243_293_1162 | 286 |
| 660 | 3300047315 | Ga0495581_0154224 | Ga0495581_0154224_368_1237 | 286 |
| 661 | 3300047320 | Ga0495672_0099714 | Ga0495672_0099714_263_1123 | 286 |
| 662 | 3300048907 | Ga0496104_0484677 | Ga0496104_0484677_111_986 | 286 |
| 663 | 3300048909 | Ga0496106_0149327 | Ga0496106_0149327_149_1030 | 286 |
| 664 | 3300049571 | Ga0501034_0185918 | Ga0501034_0185918_249_1109 | 286 |
| 665 | 3300049572 | Ga0501036_0031898 | Ga0501036_0031898_2295_3158 | 286 |
| 666 | 3300049577 | Ga0501041_0041088 | Ga0501041_0041088_1871_2734 | 286 |
| 667 | 3300049591 | Ga0501075_0207427 | Ga0501075_0207427_192_1052 | 286 |
| 668 | 3300049592 | Ga0501076_0046145 | Ga0501076_0046145_518_1381 | 286 |
| 669 | 3300049743 | Ga0501081_0065096 | Ga0501081_0065096_992_1855 | 286 |
| 670 | 3300049824 | Ga0501045_0024604 | Ga0501045_0024604_3362_4225 | 286 |
| 671 | 3300050491 | nmdc:mga00v17_14970_c1 | nmdc:mga00v17_14970_c1_2925_3785 | 286 |
| 672 | 3300050494 | nmdc:mga06z11_48067_c1 | nmdc:mga06z11_48067_c1_471_1331 | 286 |
| 673 | 3300050507 | nmdc:mga05p37_14644_c2 | nmdc:mga05p37_14644_c2_6562_7437 | 286 |
| 674 | 3300050507 | nmdc:mga05p37_158217_c1 | nmdc:mga05p37_158217_c1_913_1788 | 286 |
| 675 | 3300050507 | nmdc:mga05p37_18668_c1 | nmdc:mga05p37_18668_c1_4090_4965 | 286 |
| 676 | 3300050511 | nmdc:mga08y16_26035_c1 | nmdc:mga08y16_26035_c1_4378_5253 | 286 |
| 677 | 3300050512 | nmdc:mga0n895_8_c1 | nmdc:mga0n895_8_c1_112081_112953 | 286 |
| 678 | 3300050513 | nmdc:mga0rr50_23_c1 | nmdc:mga0rr50_23_c1_31999_32871 | 286 |
| 679 | 3300050514 | nmdc:mga08x19_12493_c1 | nmdc:mga08x19_12493_c1_348_1238 | 286 |
| 680 | 3300050514 | nmdc:mga08x19_165_c1 | nmdc:mga08x19_165_c1_22121_22993 | 286 |
| 681 | 3300050515 | nmdc:mga0a205_41360_c1 | nmdc:mga0a205_41360_c1_95_970 | 286 |
| 682 | 3300053085 | Ga0495619_0301359 | Ga0495619_0301359_182_1051 | 286 |
| 683 | 3300053139 | Ga0500568_0008892 | Ga0500568_0008892_3383_4243 | 286 |
| 684 | 3300060353 | Ga0501082_0420906 | Ga0501082_0420906_220_1083 | 286 |
| 685 | 3300061734 | Ga0530510_0018199 | Ga0530510_0018199_2081_2944 | 286 |
| 686 | 3300061734 | Ga0530510_0092617 | Ga0530510_0092617_420_1280 | 286 |
| 687 | 3300061734 | Ga0530510_0126753 | Ga0530510_0126753_995_1855 | 286 |
| 688 | 3300005441 | Ga0070700_100018153 | Ga0070700_1000181533 | 287 |
| 689 | 3300005844 | Ga0068862_100448362 | Ga0068862_1004483622 | 287 |
| 690 | 3300009147 | Ga0114129_10187299 | Ga0114129_101872993 | 287 |
| 691 | 3300014326 | Ga0157380_10013458 | Ga0157380_100134587 | 287 |
| 692 | 3300025937 | Ga0207669_10411576 | Ga0207669_104115762 | 287 |
| 693 | 3300026075 | Ga0207708_10007104 | Ga0207708_100071043 | 287 |
| 694 | 3300026121 | Ga0207683_10342453 | Ga0207683_103424532 | 287 |
| 695 | 3300035114 | Ga0373939_0010136 | Ga0373939_0010136_833_1696 | 287 |
| 696 | 3300042125 | Ga0450923_006411 | Ga0450923_006411_857_1720 | 287 |
| 697 | 3300049578 | Ga0501042_0062972 | Ga0501042_0062972_863_1726 | 287 |
| 698 | 3300049580 | Ga0501046_0229602 | Ga0501046_0229602_459_1322 | 287 |
| 699 | 3300049582 | Ga0501048_0077509 | Ga0501048_0077509_851_1714 | 287 |
| 700 | 3300049588 | Ga0501072_0314510 | Ga0501072_0314510_82_945 | 287 |
| 701 | 3300049592 | Ga0501076_0036858 | Ga0501076_0036858_633_1496 | 287 |
| 702 | 3300049741 | Ga0501079_0426243 | Ga0501079_0426243_154_1017 | 287 |
| 703 | 3300050507 | nmdc:mga05p37_118376_c1 | nmdc:mga05p37_118376_c1_1105_1968 | 287 |
| 704 | 3300050511 | nmdc:mga08y16_280484_c1 | nmdc:mga08y16_280484_c1_216_1079 | 287 |
| 705 | 3300050511 | nmdc:mga08y16_616171_c1 | nmdc:mga08y16_616171_c1_198_1061 | 287 |
| 706 | 3300050512 | nmdc:mga0n895_66748_c1 | nmdc:mga0n895_66748_c1_2176_3039 | 287 |
| 707 | 3300003203 | JGI25406J46586_10009006 | JGI25406J46586_100090064 | 288 |
| 708 | 3300005288 | Ga0065714_10138713 | Ga0065714_101387131 | 288 |
| 709 | 3300005290 | Ga0065712_10001067 | Ga0065712_100010676 | 288 |
| 710 | 3300005293 | Ga0065715_10270509 | Ga0065715_102705091 | 288 |
| 711 | 3300005295 | Ga0065707_10284468 | Ga0065707_102844682 | 288 |
| 712 | 3300005340 | Ga0070689_100164729 | Ga0070689_1001647292 | 288 |
| 713 | 3300005343 | Ga0070687_100038685 | Ga0070687_1000386853 | 288 |
| 714 | 3300005354 | Ga0070675_100005236 | Ga0070675_1000052367 | 288 |
| 715 | 3300005354 | Ga0070675_100053786 | Ga0070675_1000537863 | 288 |
| 716 | 3300005365 | Ga0070688_100250071 | Ga0070688_1002500711 | 288 |
| 717 | 3300005457 | Ga0070662_100147453 | Ga0070662_1001474532 | 288 |
| 718 | 3300005617 | Ga0068859_100401924 | Ga0068859_1004019242 | 288 |
| 719 | 3300006844 | Ga0075428_100035422 | Ga0075428_1000354223 | 288 |
| 720 | 3300006846 | Ga0075430_100029567 | Ga0075430_1000295675 | 288 |
| 721 | 3300006871 | Ga0075434_100078644 | Ga0075434_1000786441 | 288 |
| 722 | 3300006880 | Ga0075429_100021887 | Ga0075429_1000218876 | 288 |
| 723 | 3300006880 | Ga0075429_100059596 | Ga0075429_1000595964 | 288 |
| 724 | 3300006881 | Ga0068865_100118849 | Ga0068865_1001188492 | 288 |
| 725 | 3300006931 | Ga0097620_100401942 | Ga0097620_1004019422 | 288 |
| 726 | 3300009094 | Ga0111539_10004422 | Ga0111539_100044227 | 288 |
| 727 | 3300009094 | Ga0111539_10008296 | Ga0111539_100082969 | 288 |
| 728 | 3300009094 | Ga0111539_10013117 | Ga0111539_100131176 | 288 |
| 729 | 3300009094 | Ga0111539_10248669 | Ga0111539_102486692 | 288 |
| 730 | 3300009094 | Ga0111539_10392133 | Ga0111539_103921332 | 288 |
| 731 | 3300009147 | Ga0114129_10306477 | Ga0114129_103064773 | 288 |
| 732 | 3300009147 | Ga0114129_10764197 | Ga0114129_107641971 | 288 |
| 733 | 3300009177 | Ga0105248_10781633 | Ga0105248_107816332 | 288 |
| 734 | 3300013308 | Ga0157375_11017378 | Ga0157375_110173781 | 288 |
| 735 | 3300025901 | Ga0207688_10038394 | Ga0207688_100383942 | 288 |
| 736 | 3300025908 | Ga0207643_10038629 | Ga0207643_100386293 | 288 |
| 737 | 3300025918 | Ga0207662_10011304 | Ga0207662_100113044 | 288 |
| 738 | 3300025933 | Ga0207706_10040920 | Ga0207706_100409204 | 288 |
| 739 | 3300025936 | Ga0207670_10028759 | Ga0207670_100287593 | 288 |
| 740 | 3300025936 | Ga0207670_10257510 | Ga0207670_102575102 | 288 |
| 741 | 3300025942 | Ga0207689_10106293 | Ga0207689_101062932 | 288 |
| 742 | 3300025960 | Ga0207651_10050157 | Ga0207651_100501572 | 288 |
| 743 | 3300026088 | Ga0207641_10360096 | Ga0207641_103600961 | 288 |
| 744 | 3300026116 | Ga0207674_10226012 | Ga0207674_102260122 | 288 |
| 745 | 3300026121 | Ga0207683_10026222 | Ga0207683_100262224 | 288 |
| 746 | 3300027907 | Ga0207428_10000400 | Ga0207428_1000040020 | 288 |
| 747 | 3300028380 | Ga0268265_10532082 | Ga0268265_105320822 | 288 |
| 748 | 3300031995 | Ga0307409_100130442 | Ga0307409_1001304422 | 288 |
| 749 | 3300032005 | Ga0307411_10356225 | Ga0307411_103562252 | 288 |
| 750 | 3300046674 | Ga0495588_0023407 | Ga0495588_0023407_2016_2882 | 288 |
| 751 | 3300048912 | Ga0496109_0036244 | Ga0496109_0036244_3055_3942 | 288 |
| 752 | 3300049577 | Ga0501041_0011415 | Ga0501041_0011415_3993_4859 | 288 |
| 753 | 3300049578 | Ga0501042_0096475 | Ga0501042_0096475_1080_1946 | 288 |
| 754 | 3300049582 | Ga0501048_0019805 | Ga0501048_0019805_1868_2734 | 288 |
| 755 | 3300049588 | Ga0501072_0055293 | Ga0501072_0055293_18_884 | 288 |
| 756 | 3300049590 | Ga0501074_0030646 | Ga0501074_0030646_705_1571 | 288 |
| 757 | 3300049591 | Ga0501075_0247947 | Ga0501075_0247947_379_1245 | 288 |
| 758 | 3300049592 | Ga0501076_0016675 | Ga0501076_0016675_2262_3128 | 288 |
| 759 | 3300049593 | Ga0501077_0214540 | Ga0501077_0214540_143_1009 | 288 |
| 760 | 3300049741 | Ga0501079_0017221 | Ga0501079_0017221_2100_2966 | 288 |
| 761 | 3300049824 | Ga0501045_0031651 | Ga0501045_0031651_1978_2844 | 288 |
| 762 | 3300050507 | nmdc:mga05p37_639316_c1 | nmdc:mga05p37_639316_c1_67_954 | 288 |
| 763 | 3300050507 | nmdc:mga05p37_83007_c1 | nmdc:mga05p37_83007_c1_2944_3810 | 288 |
| 764 | 3300050508 | nmdc:mga09592_21193_c1 | nmdc:mga09592_21193_c1_607_1494 | 288 |
| 765 | 3300050508 | nmdc:mga09592_21228_c1 | nmdc:mga09592_21228_c1_3738_4604 | 288 |
| 766 | 3300050509 | nmdc:mga0qj67_9878_c1 | nmdc:mga0qj67_9878_c1_3590_4456 | 288 |
| 767 | 3300050510 | nmdc:mga06r32_239846_c1 | nmdc:mga06r32_239846_c1_199_1065 | 288 |
| 768 | 3300050511 | nmdc:mga08y16_35677_c1 | nmdc:mga08y16_35677_c1_72_938 | 288 |
| 769 | 3300050511 | nmdc:mga08y16_389_c1 | nmdc:mga08y16_389_c1_14270_15136 | 288 |
| 770 | 3300050511 | nmdc:mga08y16_5683_c1 | nmdc:mga08y16_5683_c1_7396_8283 | 288 |
| 771 | 3300050512 | nmdc:mga0n895_61907_c1 | nmdc:mga0n895_61907_c1_1905_2792 | 288 |
| 772 | 3300054114 | Ga0501084_0038281 | Ga0501084_0038281_1341_2207 | 288 |
| 773 | 3300061734 | Ga0530510_0039134 | Ga0530510_0039134_2188_3054 | 288 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7a0g-assembly1.cif.gz_DDD | structure of the smhb pore of the tripartite alpha-pore forming toxin, smh, from serratia marcescens. | 0.8384 | 224 | 279 |
| 4dec-assembly1.cif.gz_A-2 | crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate (udp) and phosphoglyceric acid (pga) | 0.8186 | 6 | 220 |
| 7pe4-assembly1.cif.gz_A-2 | crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 in complex with udp-glucose | 0.8177 | 6 | 220 |
| 7pdo-assembly1.cif.gz_A-2 | crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 in complex with udp | 0.8175 | 6 | 220 |
| 5jqx-assembly1.cif.gz_A | crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with phosphoglyceric acid (pga) - gpgs*pga | 0.8162 | 6 | 220 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WMY1_2_214_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8678 | 4 | 218 | 3.90.550.10 |
| af_P9WMY1_2_214_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8567 | 4 | 218 | 3.90.550.10 |
| af_O53493_586_855_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8553 | 2 | 218 | 3.90.550.10 |
| af_P40350_49_327_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8432 | 3 | 218 | 3.90.550.10 |
| af_Q58619_2_238_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8331 | 1 | 218 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C3D639-F1-model_v4 | Glycosyltransferase family 2 protein | 0.9795 | 6 | 103 |
GO:0016757
|
| AF-A0A7C1P333-F1-model_v4 | deleted | 0.9472 | 7 | 284 |
|
| AF-A0A661JIX6-F1-model_v4 | Glycosyltransferase family 2 protein | 0.9407 | 2 | 115 |
GO:0016757
|
| AF-A0A2E8LG35-F1-model_v4 | Glycosyltransferase 2-like domain-containing protein | 0.939 | 5 | 218 |
|
| AF-A0A3M1DRI3-F1-model_v4 | Glycosyltransferase family 2 protein | 0.9333 | 7 | 173 |
GO:0016757
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar