F480161

General Info

Members Datasets Scaffolds Average Seq Length
773 283 773 283

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100000731|Ga0075434_1000007319
Length 302
Sequence MAHVPVATATVSRDAISPNAAATSIVIPALDEAASIASVVAGFRAAAPWREILVVDDGSHDETGREAEAAGARVLRHPYNIGNGAAVKNGIRNASGTFVLIADADGQHRPADAVRLVSRLDQYDLVVGTRSSQSQATSARRLGNTVLNWLASYLTGQPVPDLTSGFRAARRDHLAEFLHLLPNGFSTPTTTTLAFMKAGYRVRFEPIDAAQRSGASKIRLGADGVRFFVILLKVITIFSPLRIFMPVSAASFALGAAYAVWTIITQSHVTNSSVLLILLSVVIFLVGLVSEQISSLRFEGRR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
168 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
169 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
170 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
171 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
172 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
173 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
174 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
177 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
178 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
179 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
180 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
181 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
182 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
206 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
207 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
210 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
211 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
212 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
246 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
249 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
250 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
251 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
254 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
257 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
258 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
259 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
260 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
261 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
262 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
263 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
274 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
275 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
276 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
277 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
280 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
281 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
283 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.36
Nodule 0
Rhizoplane 2.98
Rhizosphere 93.66
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10009006 3300003203 Bacteria 4486
2 Ga0065714_10138713 3300005288 Unclassified 1188
3 Ga0065712_10001067 3300005290 Bacteria 7125
4 Ga0065712_10072264 3300005290 Bacteria 4834
5 Ga0065712_10107967 3300005290 Bacteria 1885
6 Ga0065712_10207944 3300005290 Bacteria 1083
7 Ga0065715_10001723 3300005293 Bacteria 6503
8 Ga0065715_10270509 3300005293 Bacteria 1112
9 Ga0065707_10000798 3300005295 Bacteria 12363
10 Ga0065707_10284468 3300005295 Bacteria 1040
11 Ga0070676_10000699 3300005328 Bacteria 16384
12 Ga0070676_10017521 3300005328 Bacteria 3965
13 Ga0070676_10068840 3300005328 Bacteria 2120
14 Ga0070683_100112517 3300005329 Bacteria 2569
15 Ga0070690_100033059 3300005330 Bacteria 3235
16 Ga0070690_100039162 3300005330 Unclassified 2994
17 Ga0070670_100098656 3300005331 Bacteria 2514
18 Ga0070670_100238307 3300005331 Bacteria 1584
19 Ga0068869_100000964 3300005334 Bacteria 16738
20 Ga0070666_10106778 3300005335 Bacteria 1934
21 Ga0068868_100136478 3300005338 Unclassified 2011
22 Ga0070689_100007688 3300005340 Bacteria 7550
23 Ga0070689_100164729 3300005340 Unclassified 1794
24 Ga0070689_100219068 3300005340 Bacteria 1560
25 Ga0070689_100380007 3300005340 Bacteria 1190
26 Ga0070691_10003375 3300005341 Bacteria 7177
27 Ga0070687_100038685 3300005343 Bacteria 2392
28 Ga0070687_100168436 3300005343 Bacteria 1302
29 Ga0070668_100103380 3300005347 Unclassified 2260
30 Ga0070669_100031922 3300005353 Bacteria 3805
31 Ga0070669_100043051 3300005353 Bacteria 3287
32 Ga0070669_100097555 3300005353 Bacteria 2212
33 Ga0070669_100137527 3300005353 Unclassified 1880
34 Ga0070669_100397713 3300005353 Bacteria 1127
35 Ga0070675_100005236 3300005354 Bacteria 9898
36 Ga0070675_100053786 3300005354 Bacteria 3312
37 Ga0070675_100126870 3300005354 Bacteria 2171
38 Ga0070675_100573310 3300005354 Unclassified 1022
39 Ga0070671_100026568 3300005355 Bacteria 4759
40 Ga0070674_100001871 3300005356 Bacteria 11420
41 Ga0070674_100059259 3300005356 Bacteria 2665
42 Ga0070674_100417024 3300005356 Unclassified 1100
43 Ga0070673_100041377 3300005364 Bacteria 3544
44 Ga0070673_100445383 3300005364 Bacteria 1164
45 Ga0070688_100007851 3300005365 Bacteria 5770
46 Ga0070688_100026468 3300005365 Bacteria 3446
47 Ga0070688_100034875 3300005365 Bacteria 3052
48 Ga0070688_100169452 3300005365 Bacteria 1505
49 Ga0070688_100250071 3300005365 Unclassified 1262
50 Ga0070667_100022288 3300005367 Bacteria 5255
51 Ga0070667_100057268 3300005367 Bacteria 3294
52 Ga0070667_100205627 3300005367 Bacteria 1748
53 Ga0070703_10030703 3300005406 Unclassified 1621
54 Ga0070709_10071049 3300005434 Bacteria 2246
55 Ga0070709_10099188 3300005434 Unclassified 1937
56 Ga0070714_100054657 3300005435 Bacteria 3411
57 Ga0070713_100069420 3300005436 Unclassified 2971
58 Ga0070701_10040089 3300005438 Bacteria 2379
59 Ga0070701_10148322 3300005438 Bacteria 1348
60 Ga0070701_10194275 3300005438 Bacteria 1196
61 Ga0070711_100200363 3300005439 Bacteria 1540
62 Ga0070705_100022317 3300005440 Bacteria 3381
63 Ga0070700_100018153 3300005441 Bacteria 4039
64 Ga0070694_100012406 3300005444 Bacteria 5296
65 Ga0070694_100018659 3300005444 Bacteria 4405
66 Ga0070694_100049731 3300005444 Bacteria 2824
67 Ga0070694_100079716 3300005444 Bacteria 2274
68 Ga0070694_100402596 3300005444 Bacteria 1072
69 Ga0070708_100505920 3300005445 Unclassified 1139
70 Ga0070678_100003316 3300005456 Bacteria 8955
71 Ga0070678_100192055 3300005456 Bacteria 1679
72 Ga0070662_100094530 3300005457 Bacteria 2251
73 Ga0070662_100147453 3300005457 Bacteria 1829
74 Ga0070662_100242114 3300005457 Bacteria 1447
75 Ga0070681_10427219 3300005458 Unclassified 1237
76 Ga0068867_100002075 3300005459 Bacteria 14042
77 Ga0068867_100006297 3300005459 Bacteria 8396
78 Ga0068867_100008030 3300005459 Bacteria 7459
79 Ga0068867_100084626 3300005459 Bacteria 2396
80 Ga0070706_100011704 3300005467 Bacteria 8143
81 Ga0070706_100012509 3300005467 Bacteria 7860
82 Ga0070706_100192377 3300005467 Bacteria 1906
83 Ga0070706_100310088 3300005467 Bacteria 1472
84 Ga0070707_100014338 3300005468 Bacteria 7430
85 Ga0070707_100220807 3300005468 Bacteria 1846
86 Ga0070698_100019157 3300005471 Bacteria 7194
87 Ga0070698_100019232 3300005471 Bacteria 7176
88 Ga0070698_100028041 3300005471 Bacteria 5852
89 Ga0070698_100032063 3300005471 Bacteria 5445
90 Ga0070698_100200224 3300005471 Bacteria 1933
91 Ga0070699_100001478 3300005518 Bacteria 21521
92 Ga0070699_100004519 3300005518 Bacteria 12311
93 Ga0070699_100032818 3300005518 Bacteria 4484
94 Ga0070699_100071834 3300005518 Bacteria 3010
95 Ga0070699_100110423 3300005518 Bacteria 2414
96 Ga0070679_100219458 3300005530 Bacteria 1863
97 Ga0070684_100181808 3300005535 Bacteria 1912
98 Ga0070697_100020652 3300005536 Bacteria 5213
99 Ga0070697_100092703 3300005536 Bacteria 2500
100 Ga0070697_100095605 3300005536 Bacteria 2464
101 Ga0070697_100394030 3300005536 Bacteria 1201
102 Ga0068853_100278383 3300005539 Bacteria 1542
103 Ga0068853_100678191 3300005539 Bacteria 982
104 Ga0070672_100028622 3300005543 Bacteria 4170
105 Ga0070672_100062270 3300005543 Bacteria 2944
106 Ga0070672_100094880 3300005543 Bacteria 2412
107 Ga0070672_100247451 3300005543 Bacteria 1501
108 Ga0070672_100379155 3300005543 Bacteria 1209
109 Ga0070672_100500864 3300005543 Bacteria 1051
110 Ga0070686_100000389 3300005544 Bacteria 28031
111 Ga0070686_100009670 3300005544 Bacteria 5421
112 Ga0070686_100068212 3300005544 Bacteria 2319
113 Ga0070695_100006557 3300005545 Bacteria 6878
114 Ga0070695_100008088 3300005545 Bacteria 6231
115 Ga0070695_100009348 3300005545 Bacteria 5832
116 Ga0070695_100050006 3300005545 Bacteria 2678
117 Ga0070696_100014340 3300005546 Bacteria 5315
118 Ga0070696_100037917 3300005546 Bacteria 3325
119 Ga0070696_100084821 3300005546 Bacteria 2248
120 Ga0070696_100206394 3300005546 Bacteria 1469
121 Ga0070696_100276345 3300005546 Bacteria 1279
122 Ga0070693_100128802 3300005547 Bacteria 1579
123 Ga0070665_100001535 3300005548 Bacteria 26671
124 Ga0070665_100005633 3300005548 Bacteria 12877
125 Ga0070665_100464003 3300005548 Bacteria 1277
126 Ga0070704_100003916 3300005549 Bacteria 8569
127 Ga0070704_100023161 3300005549 Bacteria 4050
128 Ga0070704_100050537 3300005549 Bacteria 2923
129 Ga0070704_100080914 3300005549 Bacteria 2391
130 Ga0070704_100146523 3300005549 Bacteria 1851
131 Ga0070704_100378791 3300005549 Unclassified 1201
132 Ga0070664_100018344 3300005564 Bacteria 5747
133 Ga0068857_100142398 3300005577 Bacteria 2168
134 Ga0068857_100524412 3300005577 Bacteria 1114
135 Ga0068854_100011771 3300005578 Bacteria 5710
136 Ga0068854_100034635 3300005578 Bacteria 3528
137 Ga0068854_100224822 3300005578 Bacteria 1487
138 Ga0068856_100020616 3300005614 Bacteria 6405
139 Ga0070702_100000153 3300005615 Bacteria 21550
140 Ga0070702_100076128 3300005615 Bacteria 1997
141 Ga0070702_100139383 3300005615 Bacteria 1543
142 Ga0068859_100002430 3300005617 Bacteria 18973
143 Ga0068859_100010205 3300005617 Bacteria 9453
144 Ga0068859_100010819 3300005617 Bacteria 9184
145 Ga0068859_100076006 3300005617 Bacteria 3399
146 Ga0068859_100213567 3300005617 Bacteria 2016
147 Ga0068859_100401924 3300005617 Bacteria 1466
148 Ga0068859_100862943 3300005617 Bacteria 991
149 Ga0068864_100017239 3300005618 Bacteria 6022
150 Ga0068864_100468257 3300005618 Bacteria 1208
151 Ga0068864_100649680 3300005618 Bacteria 1027
152 Ga0068861_100009190 3300005719 Bacteria 6816
153 Ga0068861_100039211 3300005719 Bacteria 3534
154 Ga0068861_100258100 3300005719 Bacteria 1491
155 Ga0068870_10003571 3300005840 Bacteria 6593
156 Ga0068870_10211075 3300005840 Bacteria 1183
157 Ga0068863_100007204 3300005841 Bacteria 10910
158 Ga0068863_100075448 3300005841 Bacteria 3190
159 Ga0068863_100083398 3300005841 Bacteria 3029
160 Ga0068863_100176568 3300005841 Bacteria 2050
161 Ga0068863_100700121 3300005841 Bacteria 1007
162 Ga0068858_100017801 3300005842 Bacteria 6652
163 Ga0068858_100021737 3300005842 Bacteria 5994
164 Ga0068858_100022246 3300005842 Bacteria 5920
165 Ga0068858_100062574 3300005842 Bacteria 3441
166 Ga0068858_100079687 3300005842 Bacteria 3043
167 Ga0068858_100175688 3300005842 Bacteria 2021
168 Ga0068858_100214731 3300005842 Bacteria 1821
169 Ga0068860_100017112 3300005843 Bacteria 7067
170 Ga0068860_100084173 3300005843 Bacteria 3025
171 Ga0068860_100237809 3300005843 Unclassified 1771
172 Ga0068860_100690453 3300005843 Bacteria 1030
173 Ga0068862_100039812 3300005844 Bacteria 3994
174 Ga0068862_100053930 3300005844 Bacteria 3442
175 Ga0068862_100115564 3300005844 Bacteria 2360
176 Ga0068862_100116919 3300005844 Bacteria 2346
177 Ga0068862_100202123 3300005844 Bacteria 1792
178 Ga0068862_100307396 3300005844 Unclassified 1460
179 Ga0068862_100309333 3300005844 Bacteria 1456
180 Ga0068862_100448362 3300005844 Bacteria 1216
181 Ga0068862_100479580 3300005844 Bacteria 1177
182 Ga0068862_100600230 3300005844 Bacteria 1057
183 Ga0081455_10073814 3300005937 Bacteria 2819
184 Ga0081455_10152618 3300005937 Unclassified 1779
185 Ga0081538_10046027 3300005981 Bacteria 2697
186 Ga0081539_10000093 3300005985 Bacteria 207314
187 Ga0081539_10018173 3300005985 Bacteria 4893
188 Ga0075365_10001234 3300006038 Bacteria 11312
189 Ga0075368_10015337 3300006042 Bacteria 2842
190 Ga0075363_100024048 3300006048 Bacteria 3094
191 Ga0075363_100127602 3300006048 Bacteria 1425
192 Ga0075364_10016789 3300006051 Bacteria 4560
193 Ga0075364_10052859 3300006051 Bacteria 2655
194 Ga0075364_10068331 3300006051 Unclassified 2337
195 Ga0075364_10158757 3300006051 Bacteria 1526
196 Ga0070712_100413800 3300006175 Bacteria 1116
197 Ga0075367_10000879 3300006178 Bacteria 12052
198 Ga0075367_10001875 3300006178 Bacteria 9299
199 Ga0075366_10000322 3300006195 Bacteria 21867
200 Ga0097621_100022037 3300006237 Bacteria 4940
201 Ga0097621_100025087 3300006237 Bacteria 4662
202 Ga0097621_100050591 3300006237 Bacteria 3379
203 Ga0097621_100051939 3300006237 Bacteria 3337
204 Ga0097621_100474135 3300006237 Bacteria 1130
205 Ga0075370_10112040 3300006353 Unclassified 1585
206 Ga0068871_100002675 3300006358 Bacteria 12162
207 Ga0068871_100005949 3300006358 Bacteria 8586
208 Ga0068871_100010750 3300006358 Bacteria 6694
209 Ga0068871_100055165 3300006358 Bacteria 3226
210 Ga0068871_100220821 3300006358 Bacteria 1642
211 Ga0075428_100000185 3300006844 Bacteria 58526
212 Ga0075428_100001446 3300006844 Bacteria 25375
213 Ga0075428_100006198 3300006844 Bacteria 13304
214 Ga0075428_100009291 3300006844 Bacteria 10901
215 Ga0075428_100035422 3300006844 Bacteria 5503
216 Ga0075428_100044494 3300006844 Bacteria 4879
217 Ga0075428_100049566 3300006844 Bacteria 4607
218 Ga0075428_100121374 3300006844 Bacteria 2846
219 Ga0075428_100125903 3300006844 Bacteria 2788
220 Ga0075428_100235005 3300006844 Bacteria 1978
221 Ga0075428_100322682 3300006844 Bacteria 1659
222 Ga0075430_100029567 3300006846 Bacteria 4649
223 Ga0075430_100041017 3300006846 Bacteria 3917
224 Ga0075431_100000373 3300006847 Bacteria 35683
225 Ga0075431_100200574 3300006847 Unclassified 2041
226 Ga0075433_10002985 3300006852 Bacteria 12993
227 Ga0075433_10021172 3300006852 Bacteria 5449
228 Ga0075433_10119754 3300006852 Bacteria 2337
229 Ga0075433_10196348 3300006852 Bacteria 1795
230 Ga0075433_10362897 3300006852 Bacteria 1279
231 Ga0075434_100000731 3300006871 Bacteria 25794
232 Ga0075434_100018881 3300006871 Bacteria 6665
233 Ga0075434_100046329 3300006871 Bacteria 4315
234 Ga0075434_100055954 3300006871 Bacteria 3920
235 Ga0075434_100078644 3300006871 Bacteria 3294
236 Ga0075434_100088081 3300006871 Bacteria 3105
237 Ga0075434_100103133 3300006871 Bacteria 2860
238 Ga0075434_100116335 3300006871 Bacteria 2687
239 Ga0075434_100139413 3300006871 Bacteria 2444
240 Ga0075434_100147879 3300006871 Bacteria 2370
241 Ga0075434_100213999 3300006871 Bacteria 1947
242 Ga0075434_100232096 3300006871 Bacteria 1865
243 Ga0075434_100686417 3300006871 Bacteria 1042
244 Ga0075429_100004956 3300006880 Bacteria 11469
245 Ga0075429_100021887 3300006880 Bacteria 5542
246 Ga0075429_100057532 3300006880 Unclassified 3385
247 Ga0075429_100059596 3300006880 Bacteria 3325
248 Ga0075429_100182682 3300006880 Bacteria 1838
249 Ga0068865_100014920 3300006881 Bacteria 4946
250 Ga0068865_100052129 3300006881 Bacteria 2835
251 Ga0068865_100079374 3300006881 Bacteria 2351
252 Ga0068865_100118849 3300006881 Unclassified 1962
253 Ga0068865_100196771 3300006881 Bacteria 1562
254 Ga0068865_100411148 3300006881 Bacteria 1110
255 Ga0068865_100454968 3300006881 Bacteria 1059
256 Ga0075436_100001874 3300006914 Bacteria 14448
257 Ga0075436_100009966 3300006914 Bacteria 6501
258 Ga0075436_100029447 3300006914 Bacteria 3776
259 Ga0075436_100043595 3300006914 Bacteria 3093
260 Ga0075436_100058963 3300006914 Bacteria 2651
261 Ga0097620_100002430 3300006931 Bacteria 18973
262 Ga0097620_100010205 3300006931 Bacteria 9453
263 Ga0097620_100010819 3300006931 Bacteria 9184
264 Ga0097620_100076008 3300006931 Bacteria 3399
265 Ga0097620_100213557 3300006931 Bacteria 2016
266 Ga0097620_100401942 3300006931 Bacteria 1466
267 Ga0097620_100863149 3300006931 Bacteria 991
268 Ga0075435_100000052 3300007076 Bacteria 58955
269 Ga0075435_100000404 3300007076 Bacteria 26487
270 Ga0075435_100003568 3300007076 Bacteria 10570
271 Ga0075435_100003713 3300007076 Bacteria 10397
272 Ga0075435_100015716 3300007076 Bacteria 5694
273 Ga0075435_100089258 3300007076 Bacteria 2541
274 Ga0075435_100529093 3300007076 Bacteria 1020
275 Ga0099794_10047989 3300007265 Bacteria 2049
276 Ga0105240_10080775 3300009093 Bacteria 3997
277 Ga0105240_10092713 3300009093 Bacteria 3688
278 Ga0105240_10243836 3300009093 Bacteria 2082
279 Ga0105240_10262018 3300009093 Bacteria 1994
280 Ga0105240_10558426 3300009093 Unclassified 1266
281 Ga0105240_10646204 3300009093 Bacteria 1160
282 Ga0111539_10000156 3300009094 Bacteria 77946
283 Ga0111539_10000160 3300009094 Bacteria 76643
284 Ga0111539_10000602 3300009094 Bacteria 46554
285 Ga0111539_10000696 3300009094 Bacteria 43539
286 Ga0111539_10001042 3300009094 Bacteria 36422
287 Ga0111539_10004422 3300009094 Bacteria 18377
288 Ga0111539_10006977 3300009094 Bacteria 14496
289 Ga0111539_10008296 3300009094 Bacteria 13224
290 Ga0111539_10013117 3300009094 Bacteria 10365
291 Ga0111539_10060587 3300009094 Bacteria 4485
292 Ga0111539_10175052 3300009094 Bacteria 2506
293 Ga0111539_10194097 3300009094 Bacteria 2368
294 Ga0111539_10248669 3300009094 Unclassified 2070
295 Ga0111539_10358186 3300009094 Unclassified 1698
296 Ga0111539_10392133 3300009094 Bacteria 1617
297 Ga0105245_10011551 3300009098 Bacteria 7692
298 Ga0105245_10128529 3300009098 Bacteria 2374
299 Ga0105247_10009155 3300009101 Bacteria 6027
300 Ga0114129_10000307 3300009147 Bacteria 57086
301 Ga0114129_10000789 3300009147 Bacteria 40604
302 Ga0114129_10022026 3300009147 Bacteria 9044
303 Ga0114129_10031216 3300009147 Bacteria 7534
304 Ga0114129_10041136 3300009147 Bacteria 6515
305 Ga0114129_10072173 3300009147 Bacteria 4813
306 Ga0114129_10074016 3300009147 Bacteria 4745
307 Ga0114129_10105727 3300009147 Bacteria 3889
308 Ga0114129_10187299 3300009147 Bacteria 2812
309 Ga0114129_10190198 3300009147 Bacteria 2788
310 Ga0114129_10205497 3300009147 Bacteria 2665
311 Ga0114129_10233471 3300009147 Bacteria 2476
312 Ga0114129_10306477 3300009147 Bacteria 2115
313 Ga0114129_10373801 3300009147 Unclassified 1883
314 Ga0114129_10609664 3300009147 Bacteria 1413
315 Ga0114129_10764197 3300009147 Unclassified 1236
316 Ga0105243_10026757 3300009148 Bacteria 4417
317 Ga0105243_10032527 3300009148 Bacteria 4031
318 Ga0105242_10009242 3300009176 Bacteria 7563
319 Ga0105242_10014541 3300009176 Bacteria 6098
320 Ga0105242_10026694 3300009176 Bacteria 4578
321 Ga0105242_10046424 3300009176 Bacteria 3523
322 Ga0105242_10166914 3300009176 Bacteria 1932
323 Ga0105242_10211456 3300009176 Bacteria 1729
324 Ga0105242_10626399 3300009176 Bacteria 1043
325 Ga0105248_10000664 3300009177 Bacteria 39095
326 Ga0105248_10013204 3300009177 Bacteria 9093
327 Ga0105248_10022913 3300009177 Bacteria 6935
328 Ga0105248_10036959 3300009177 Bacteria 5462
329 Ga0105248_10076990 3300009177 Bacteria 3749
330 Ga0105248_10085756 3300009177 Bacteria 3543
331 Ga0105248_10093898 3300009177 Bacteria 3379
332 Ga0105248_10098891 3300009177 Bacteria 3287
333 Ga0105248_10102078 3300009177 Bacteria 3233
334 Ga0105248_10781633 3300009177 Bacteria 1077
335 Ga0105237_10163863 3300009545 Bacteria 2222
336 Ga0105238_10209861 3300009551 Bacteria 1923
337 Ga0105249_10174424 3300009553 Bacteria 2087
338 Ga0105249_10201704 3300009553 Unclassified 1947
339 Ga0105239_10408535 3300010375 Unclassified 1537
340 Ga0157374_10002073 3300013296 Bacteria 16874
341 Ga0163162_10300551 3300013306 Unclassified 1737
342 Ga0157375_10231243 3300013308 Bacteria 2008
343 Ga0157375_10261724 3300013308 Bacteria 1891
344 Ga0157375_10504432 3300013308 Bacteria 1374
345 Ga0157375_10595022 3300013308 Bacteria 1265
346 Ga0157375_11017378 3300013308 Bacteria 968
347 Ga0163163_10000071 3300014325 Bacteria 112778
348 Ga0163163_10015069 3300014325 Bacteria 7131
349 Ga0163163_10068131 3300014325 Bacteria 3540
350 Ga0163163_10298179 3300014325 Unclassified 1664
351 Ga0157380_10013458 3300014326 Bacteria 5964
352 Ga0157380_10037774 3300014326 Bacteria 3744
353 Ga0157380_10095651 3300014326 Bacteria 2461
354 Ga0157380_10170281 3300014326 Bacteria 1902
355 Ga0157380_10356277 3300014326 Bacteria 1371
356 Ga0157377_10019370 3300014745 Bacteria 3554
357 Ga0157379_10033107 3300014968 Bacteria 4608
358 Ga0157379_10033243 3300014968 Bacteria 4600
359 Ga0157379_10044852 3300014968 Bacteria 3946
360 Ga0157379_10172233 3300014968 Bacteria 1954
361 Ga0157376_10019635 3300014969 Bacteria 5214
362 Ga0157376_10036751 3300014969 Bacteria 3970
363 Ga0157376_10144372 3300014969 Bacteria 2139
364 Ga0157376_10148821 3300014969 Bacteria 2109
365 Ga0157376_10338809 3300014969 Bacteria 1435
366 Ga0157376_10341882 3300014969 Bacteria 1429
367 Ga0157376_10669417 3300014969 Bacteria 1040
368 Ga0207697_10080375 3300025315 Bacteria 1373
369 Ga0207697_10100482 3300025315 Bacteria 1232
370 Ga0207653_10021645 3300025885 Unclassified 2039
371 Ga0207642_10019615 3300025899 Bacteria 2622
372 Ga0207710_10052606 3300025900 Bacteria 1831
373 Ga0207688_10038394 3300025901 Bacteria 2657
374 Ga0207680_10100316 3300025903 Bacteria 1859
375 Ga0207680_10268807 3300025903 Unclassified 1182
376 Ga0207680_10395067 3300025903 Bacteria 976
377 Ga0207685_10073529 3300025905 Bacteria 1393
378 Ga0207645_10000703 3300025907 Bacteria 27863
379 Ga0207645_10020740 3300025907 Bacteria 4297
380 Ga0207643_10003545 3300025908 Bacteria 8401
381 Ga0207643_10038629 3300025908 Bacteria 2682
382 Ga0207684_10002365 3300025910 Bacteria 19093
383 Ga0207684_10011424 3300025910 Bacteria 7769
384 Ga0207684_10057251 3300025910 Bacteria 3307
385 Ga0207684_10166296 3300025910 Bacteria 1901
386 Ga0207695_10206287 3300025913 Bacteria 1878
387 Ga0207695_10306351 3300025913 Bacteria 1479
388 Ga0207662_10010058 3300025918 Bacteria 5215
389 Ga0207662_10011304 3300025918 Bacteria 4945
390 Ga0207662_10072333 3300025918 Bacteria 2089
391 Ga0207662_10124767 3300025918 Bacteria 1618
392 Ga0207662_10217663 3300025918 Bacteria 1242
393 Ga0207662_10363168 3300025918 Bacteria 975
394 Ga0207652_10196227 3300025921 Bacteria 1816
395 Ga0207646_10038448 3300025922 Bacteria 4310
396 Ga0207646_10082584 3300025922 Bacteria 2873
397 Ga0207646_10099480 3300025922 Bacteria 2606
398 Ga0207646_10159188 3300025922 Bacteria 2037
399 Ga0207681_10025744 3300025923 Bacteria 3787
400 Ga0207681_10064591 3300025923 Bacteria 2528
401 Ga0207681_10110831 3300025923 Bacteria 1996
402 Ga0207681_10255692 3300025923 Bacteria 1369
403 Ga0207681_10361668 3300025923 Bacteria 1164
404 Ga0207650_10003830 3300025925 Bacteria 10286
405 Ga0207659_10000076 3300025926 Bacteria 62373
406 Ga0207659_10448836 3300025926 Bacteria 1086
407 Ga0207687_10008761 3300025927 Bacteria 6612
408 Ga0207687_10009881 3300025927 Bacteria 6247
409 Ga0207700_10036920 3300025928 Bacteria 3534
410 Ga0207664_10076262 3300025929 Bacteria 2713
411 Ga0207644_10380629 3300025931 Bacteria 1151
412 Ga0207706_10040920 3300025933 Bacteria 4108
413 Ga0207706_10105559 3300025933 Bacteria 2479
414 Ga0207706_10252015 3300025933 Bacteria 1542
415 Ga0207686_10004368 3300025934 Bacteria 7578
416 Ga0207686_10049941 3300025934 Bacteria 2599
417 Ga0207686_10054142 3300025934 Bacteria 2512
418 Ga0207686_10223851 3300025934 Bacteria 1360
419 Ga0207709_10028376 3300025935 Bacteria 3235
420 Ga0207670_10028759 3300025936 Bacteria 3534
421 Ga0207670_10063060 3300025936 Bacteria 2535
422 Ga0207670_10154530 3300025936 Bacteria 1706
423 Ga0207670_10257510 3300025936 Bacteria 1351
424 Ga0207670_10373440 3300025936 Bacteria 1134
425 Ga0207669_10023792 3300025937 Bacteria 3279
426 Ga0207669_10030630 3300025937 Bacteria 2992
427 Ga0207669_10058849 3300025937 Bacteria 2347
428 Ga0207669_10375172 3300025937 Bacteria 1107
429 Ga0207669_10411576 3300025937 Bacteria 1062
430 Ga0207704_10014182 3300025938 Bacteria 4017
431 Ga0207704_10045320 3300025938 Bacteria 2612
432 Ga0207691_10022611 3300025940 Bacteria 5929
433 Ga0207691_10084145 3300025940 Bacteria 2856
434 Ga0207691_10087212 3300025940 Bacteria 2800
435 Ga0207691_10131951 3300025940 Bacteria 2206
436 Ga0207691_10390183 3300025940 Bacteria 1188
437 Ga0207711_10033049 3300025941 Bacteria 4376
438 Ga0207711_10077122 3300025941 Unclassified 2904
439 Ga0207711_10100385 3300025941 Bacteria 2560
440 Ga0207711_10129375 3300025941 Bacteria 2262
441 Ga0207711_10427666 3300025941 Bacteria 1232
442 Ga0207689_10005018 3300025942 Bacteria 11923
443 Ga0207689_10067106 3300025942 Bacteria 2949
444 Ga0207689_10067247 3300025942 Bacteria 2945
445 Ga0207689_10106293 3300025942 Unclassified 2306
446 Ga0207679_10010589 3300025945 Bacteria 5941
447 Ga0207679_10074596 3300025945 Bacteria 2571
448 Ga0207651_10050157 3300025960 Bacteria 2832
449 Ga0207651_10056443 3300025960 Bacteria 2703
450 Ga0207651_10181184 3300025960 Bacteria 1671
451 Ga0207712_10051925 3300025961 Unclassified 2869
452 Ga0207712_10249743 3300025961 Bacteria 1433
453 Ga0207640_10014136 3300025981 Bacteria 4589
454 Ga0207640_10284612 3300025981 Bacteria 1300
455 Ga0207658_10357747 3300025986 Bacteria 1273
456 Ga0207658_10465473 3300025986 Unclassified 1121
457 Ga0207677_10113727 3300026023 Bacteria 2021
458 Ga0207677_10138745 3300026023 Bacteria 1858
459 Ga0207703_10008893 3300026035 Bacteria 7913
460 Ga0207703_10021021 3300026035 Bacteria 5107
461 Ga0207703_10024671 3300026035 Bacteria 4731
462 Ga0207703_10046292 3300026035 Bacteria 3503
463 Ga0207703_10100743 3300026035 Bacteria 2448
464 Ga0207703_10242630 3300026035 Bacteria 1620
465 Ga0207703_10543874 3300026035 Bacteria 1094
466 Ga0207703_10702541 3300026035 Unclassified 962
467 Ga0207639_10597866 3300026041 Bacteria 1017
468 Ga0207708_10007104 3300026075 Bacteria 8270
469 Ga0207708_10022108 3300026075 Bacteria 4803
470 Ga0207708_10053476 3300026075 Bacteria 3077
471 Ga0207708_10166396 3300026075 Bacteria 1743
472 Ga0207702_10154700 3300026078 Bacteria 2089
473 Ga0207641_10002582 3300026088 Bacteria 16638
474 Ga0207641_10067332 3300026088 Unclassified 3067
475 Ga0207641_10123881 3300026088 Bacteria 2311
476 Ga0207641_10211034 3300026088 Bacteria 1796
477 Ga0207641_10360096 3300026088 Bacteria 1389
478 Ga0207641_10541862 3300026088 Bacteria 1134
479 Ga0207648_10021347 3300026089 Bacteria 5820
480 Ga0207648_10024283 3300026089 Bacteria 5414
481 Ga0207648_10126285 3300026089 Unclassified 2250
482 Ga0207648_10184678 3300026089 Bacteria 1846
483 Ga0207648_10209558 3300026089 Bacteria 1730
484 Ga0207648_10496780 3300026089 Bacteria 1116
485 Ga0207676_10014449 3300026095 Bacteria 5681
486 Ga0207676_10107590 3300026095 Bacteria 2326
487 Ga0207676_10615925 3300026095 Bacteria 1044
488 Ga0207674_10226012 3300026116 Bacteria 1820
489 Ga0207674_10374976 3300026116 Bacteria 1375
490 Ga0207675_100012476 3300026118 Bacteria 7937
491 Ga0207675_100060424 3300026118 Bacteria 3538
492 Ga0207675_100062193 3300026118 Bacteria 3486
493 Ga0207675_100140677 3300026118 Bacteria 2293
494 Ga0207675_100177556 3300026118 Bacteria 2038
495 Ga0207683_10026222 3300026121 Bacteria 5031
496 Ga0207683_10081641 3300026121 Bacteria 2870
497 Ga0207683_10228387 3300026121 Bacteria 1697
498 Ga0207683_10342453 3300026121 Bacteria 1371
499 Ga0207428_10000070 3300027907 Bacteria 147650
500 Ga0207428_10000234 3300027907 Bacteria 76592
501 Ga0207428_10000400 3300027907 Bacteria 53869
502 Ga0207428_10001302 3300027907 Bacteria 26596
503 Ga0207428_10018313 3300027907 Bacteria 5984
504 Ga0207428_10058479 3300027907 Bacteria 3059
505 Ga0207428_10265195 3300027907 Bacteria 1278
506 Ga0268266_10003216 3300028379 Bacteria 16509
507 Ga0268265_10016423 3300028380 Bacteria 5085
508 Ga0268265_10027810 3300028380 Bacteria 4041
509 Ga0268265_10162126 3300028380 Bacteria 1901
510 Ga0268265_10199289 3300028380 Bacteria 1735
511 Ga0268265_10227279 3300028380 Bacteria 1637
512 Ga0268265_10450452 3300028380 Bacteria 1202
513 Ga0268265_10532082 3300028380 Bacteria 1113
514 Ga0268264_10043485 3300028381 Bacteria 3722
515 Ga0268264_10108713 3300028381 Bacteria 2425
516 Ga0268264_10133144 3300028381 Bacteria 2207
517 Ga0268264_10158713 3300028381 Bacteria 2035
518 Ga0268264_10317624 3300028381 Bacteria 1472
519 Ga0265316_10157511 3300031344 Bacteria 1699
520 Ga0307408_100044867 3300031548 Bacteria 3153
521 Ga0307408_100076075 3300031548 Bacteria 2496
522 Ga0307408_100169148 3300031548 Bacteria 1744
523 Ga0265314_10129545 3300031711 Bacteria 1576
524 Ga0307409_100043273 3300031995 Bacteria 3380
525 Ga0307409_100130442 3300031995 Bacteria 2147
526 Ga0307416_100144179 3300032002 Bacteria 2171
527 Ga0307416_100218624 3300032002 Unclassified 1825
528 Ga0307411_10157774 3300032005 Bacteria 1695
529 Ga0307411_10356225 3300032005 Bacteria 1195
530 Ga0307415_100230100 3300032126 Bacteria 1492
531 Ga0373930_0000070 3300034816 Bacteria 9941
532 Ga0373948_0008242 3300034817 Bacteria 1770
533 Ga0373958_0000542 3300034819 Bacteria 4712
534 Ga0373934_0000325 3300035086 Bacteria 16805
535 Ga0373940_0000640 3300035088 Bacteria 5594
536 Ga0373949_0000540 3300035090 Bacteria 12471
537 Ga0373951_0000475 3300035091 Bacteria 11487
538 Ga0373952_0001255 3300035092 Bacteria 4629
539 Ga0373939_0005973 3300035114 Bacteria 2917
540 Ga0373939_0010136 3300035114 Bacteria 2349
541 Ga0373941_0004778 3300035115 Bacteria 3151
542 Ga0373956_0046774 3300035119 Bacteria 1934
543 Ga0373957_0004234 3300035120 Bacteria 4349
544 Ga0373946_0066593 3300035171 Bacteria 1545
545 Ga0373942_0000397 3300035207 Bacteria 12081
546 Ga0373961_0001526 3300035241 Bacteria 6709
547 Ga0373962_0000747 3300035242 Bacteria 7374
548 Ga0373924_0079333 3300035410 Bacteria 1394
549 Ga0373931_0000745 3300035691 Bacteria 13573
550 Ga0373931_0098264 3300035691 Bacteria 1643
551 Ga0373933_0082877 3300035724 Bacteria 1969
552 Ga0373933_0300647 3300035724 Unclassified 1039
553 Ga0373947_0155390 3300035725 Bacteria 1476
554 Ga0373937_0000553 3300036401 Bacteria 33171
555 Ga0373937_0061534 3300036401 Bacteria 3451
556 Ga0373937_0099930 3300036401 Bacteria 2691
557 Ga0373937_0153381 3300036401 Bacteria 2159
558 Ga0373937_0283328 3300036401 Unclassified 1565
559 Ga0373937_0386871 3300036401 Bacteria 1327
560 Ga0373925_0086098 3300037068 Bacteria 2397
561 Ga0373925_0140146 3300037068 Bacteria 1892
562 Ga0395901_0413018 3300038443 Unclassified 1385
563 Ga0450923_006411 3300042125 Bacteria 1950
564 Ga0451577_0286690 3300042876 Unclassified 1492
565 Ga0453684_0089560 3300044712 Bacteria 3805
566 Ga0451576_0219836 3300045051 Bacteria 1983
567 Ga0451576_0789040 3300045051 Bacteria 997
568 Ga0466967_0246898 3300045976 Bacteria 1704
569 Ga0495629_0286003 3300046459 Bacteria 1131
570 Ga0495638_0015021 3300046460 Bacteria 5213
571 Ga0495580_0079243 3300046472 Bacteria 2291
572 Ga0495580_0164754 3300046472 Bacteria 1534
573 Ga0495608_0003061 3300046511 Bacteria 11950
574 Ga0495628_0032621 3300046516 Bacteria 4203
575 Ga0495628_0090587 3300046516 Unclassified 2368
576 Ga0495630_0003233 3300046517 Bacteria 11349
577 Ga0495643_0005940 3300046522 Bacteria 8145
578 Ga0495652_0105738 3300046529 Bacteria 2274
579 Ga0495586_0068635 3300046535 Bacteria 1934
580 Ga0495645_0000493 3300046543 Bacteria 27347
581 Ga0495633_0117561 3300046558 Bacteria 1232
582 Ga0495656_0095683 3300046615 Bacteria 1366
583 Ga0495634_0250667 3300046642 Bacteria 1083
584 Ga0495635_0048819 3300046663 Bacteria 2918
585 Ga0495659_0112090 3300046664 Bacteria 1066
586 Ga0495588_0023407 3300046674 Bacteria 3058
587 Ga0495599_0296464 3300046678 Bacteria 977
588 Ga0495647_0100015 3300046681 Bacteria 1200
589 Ga0495658_0038388 3300046683 Bacteria 2652
590 Ga0495669_0007871 3300046684 Bacteria 4471
591 Ga0495613_0001719 3300046689 Bacteria 16660
592 Ga0495581_0154224 3300047315 Bacteria 1342
593 Ga0495674_0046339 3300047319 Bacteria 3859
594 Ga0495674_0054062 3300047319 Bacteria 3528
595 Ga0495674_0412679 3300047319 Unclassified 1089
596 Ga0495672_0000242 3300047320 Bacteria 76766
597 Ga0495672_0099714 3300047320 Bacteria 1578
598 Ga0495676_0147614 3300047321 Bacteria 1678
599 Ga0495680_0109726 3300047322 Bacteria 2046
600 Ga0495684_0000189 3300047471 Bacteria 47374
601 Ga0495684_0009207 3300047471 Bacteria 7622
602 Ga0496100_0069187 3300048903 Unclassified 2350
603 Ga0496101_0001075 3300048904 Bacteria 16188
604 Ga0496101_0083968 3300048904 Bacteria 2358
605 Ga0496101_0292003 3300048904 Bacteria 1276
606 Ga0496102_0022264 3300048905 Bacteria 5615
607 Ga0496102_0144120 3300048905 Bacteria 2235
608 Ga0496102_0185098 3300048905 Bacteria 1963
609 Ga0496104_0002797 3300048907 Bacteria 15033
610 Ga0496104_0082849 3300048907 Bacteria 3059
611 Ga0496104_0203622 3300048907 Unclassified 1891
612 Ga0496104_0484677 3300048907 Bacteria 1148
613 Ga0496105_0099450 3300048908 Bacteria 2402
614 Ga0496106_0025090 3300048909 Bacteria 4434
615 Ga0496106_0149327 3300048909 Bacteria 1843
616 Ga0496108_0006264 3300048911 Bacteria 9640
617 Ga0496109_0036244 3300048912 Bacteria 4453
618 Ga0496109_0078971 3300048912 Bacteria 3031
619 Ga0496110_0042319 3300048913 Bacteria 3976
620 Ga0496110_0083633 3300048913 Bacteria 2848
621 Ga0496112_0056169 3300048915 Bacteria 3874
622 Ga0496112_0141479 3300048915 Bacteria 2375
623 Ga0496113_0007690 3300048916 Bacteria 6955
624 Ga0496114_0025974 3300048917 Bacteria 4792
625 Ga0501031_0330088 3300049568 Bacteria 988
626 Ga0501034_0185918 3300049571 Bacteria 2041
627 Ga0501036_0017503 3300049572 Bacteria 5993
628 Ga0501036_0031898 3300049572 Bacteria 4451
629 Ga0501036_0042741 3300049572 Bacteria 3837
630 Ga0501040_0440721 3300049576 Bacteria 937
631 Ga0501041_0011415 3300049577 Bacteria 5250
632 Ga0501041_0039182 3300049577 Bacteria 2876
633 Ga0501041_0041088 3300049577 Bacteria 2808
634 Ga0501041_0094191 3300049577 Bacteria 1850
635 Ga0501042_0062972 3300049578 Bacteria 2651
636 Ga0501042_0096475 3300049578 Unclassified 2124
637 Ga0501046_0229602 3300049580 Bacteria 1372
638 Ga0501047_0032690 3300049581 Bacteria 5023
639 Ga0501048_0019805 3300049582 Bacteria 4934
640 Ga0501048_0077509 3300049582 Bacteria 2346
641 Ga0501068_0029322 3300049584 Bacteria 3257
642 Ga0501070_0236651 3300049586 Bacteria 1495
643 Ga0501071_0234230 3300049587 Bacteria 1384
644 Ga0501071_0477442 3300049587 Bacteria 955
645 Ga0501072_0055293 3300049588 Bacteria 3128
646 Ga0501072_0266474 3300049588 Bacteria 1363
647 Ga0501072_0314510 3300049588 Bacteria 1244
648 Ga0501074_0030646 3300049590 Bacteria 3898
649 Ga0501075_0120646 3300049591 Bacteria 1995
650 Ga0501075_0207427 3300049591 Bacteria 1495
651 Ga0501075_0247947 3300049591 Unclassified 1357
652 Ga0501076_0005951 3300049592 Bacteria 8808
653 Ga0501076_0016675 3300049592 Bacteria 5571
654 Ga0501076_0036858 3300049592 Bacteria 3834
655 Ga0501076_0046145 3300049592 Bacteria 3442
656 Ga0501077_0214540 3300049593 Bacteria 1223
657 Ga0501079_0017221 3300049741 Bacteria 5517
658 Ga0501079_0207115 3300049741 Bacteria 1532
659 Ga0501079_0426243 3300049741 Bacteria 1041
660 Ga0501080_0073196 3300049742 Bacteria 3187
661 Ga0501081_0065096 3300049743 Bacteria 2533
662 Ga0501081_0070876 3300049743 Bacteria 2429
663 Ga0501081_0110545 3300049743 Bacteria 1950
664 Ga0501083_0020813 3300049744 Bacteria 4560
665 Ga0501044_0357331 3300049823 Bacteria 1379
666 Ga0501045_0024604 3300049824 Bacteria 4324
667 Ga0501045_0031651 3300049824 Bacteria 3831
668 Ga0501045_0074879 3300049824 Bacteria 2493
669 nmdc:mga03n38_109712_c1 3300050490 Bacteria 1342
670 nmdc:mga00v17_14970_c1 3300050491 Bacteria 4344
671 nmdc:mga00v17_77327_c1 3300050491 Unclassified 2072
672 nmdc:mga0yw44_115556_c1 3300050492 Unclassified 1724
673 nmdc:mga0k408_1023_c1 3300050493 Bacteria 15335
674 nmdc:mga0k408_274502_c1 3300050493 Bacteria 1006
675 nmdc:mga0k408_48248_c1 3300050493 Bacteria 2462
676 nmdc:mga06z11_2066_c1 3300050494 Bacteria 7623
677 nmdc:mga06z11_48067_c1 3300050494 Bacteria 2170
678 nmdc:mga04h51_112180_c1 3300050495 Unclassified 1006
679 nmdc:mga07m45_110212_c1 3300050496 Unclassified 1585
680 nmdc:mga05p37_115943_c1 3300050507 Bacteria 3292
681 nmdc:mga05p37_118376_c1 3300050507 Bacteria 3255
682 nmdc:mga05p37_14644_c2 3300050507 Bacteria 8790
683 nmdc:mga05p37_158217_c1 3300050507 Bacteria 2768
684 nmdc:mga05p37_18019_c1 3300050507 Bacteria 8529
685 nmdc:mga05p37_18668_c1 3300050507 Bacteria 8381
686 nmdc:mga05p37_217260_c1 3300050507 Unclassified 2308
687 nmdc:mga05p37_225835_c1 3300050507 Bacteria 2258
688 nmdc:mga05p37_296188_c1 3300050507 Bacteria 1924
689 nmdc:mga05p37_34620_c1 3300050507 Bacteria 6187
690 nmdc:mga05p37_478104_c1 3300050507 Bacteria 1436
691 nmdc:mga05p37_56987_c1 3300050507 Bacteria 4812
692 nmdc:mga05p37_6282_c1 3300050507 Bacteria 13986
693 nmdc:mga05p37_639316_c1 3300050507 Bacteria 1194
694 nmdc:mga05p37_66740_c1 3300050507 Bacteria 4425
695 nmdc:mga05p37_6700_c1 3300050507 Bacteria 13572
696 nmdc:mga05p37_83007_c1 3300050507 Bacteria 3948
697 nmdc:mga05p37_96163_c2 3300050507 Bacteria 3055
698 nmdc:mga09592_2118_c1 3300050508 Bacteria 16016
699 nmdc:mga09592_21193_c1 3300050508 Bacteria 5355
700 nmdc:mga09592_21228_c1 3300050508 Bacteria 5351
701 nmdc:mga09592_39944_c1 3300050508 Bacteria 3942
702 nmdc:mga09592_447066_c1 3300050508 Bacteria 1115
703 nmdc:mga0qj67_9878_c1 3300050509 Bacteria 7115
704 nmdc:mga06r32_1608_c1 3300050510 Bacteria 20365
705 nmdc:mga06r32_239846_c1 3300050510 Bacteria 1801
706 nmdc:mga08y16_10_c1 3300050511 Bacteria 470512
707 nmdc:mga08y16_12823_c1 3300050511 Bacteria 8812
708 nmdc:mga08y16_15573_c1 3300050511 Bacteria 7995
709 nmdc:mga08y16_173550_c1 3300050511 Unclassified 2239
710 nmdc:mga08y16_1915_c1 3300050511 Bacteria 21221
711 nmdc:mga08y16_26035_c1 3300050511 Bacteria 6170
712 nmdc:mga08y16_280484_c1 3300050511 Bacteria 1719
713 nmdc:mga08y16_35677_c1 3300050511 Bacteria 5223
714 nmdc:mga08y16_389_c1 3300050511 Bacteria 40159
715 nmdc:mga08y16_5423_c1 3300050511 Bacteria 13335
716 nmdc:mga08y16_5683_c1 3300050511 Bacteria 13067
717 nmdc:mga08y16_594705_c1 3300050511 Bacteria 1116
718 nmdc:mga08y16_616171_c1 3300050511 Bacteria 1093
719 nmdc:mga08y16_882_c1 3300050511 Bacteria 28902
720 nmdc:mga0n895_101653_c1 3300050512 Bacteria 2885
721 nmdc:mga0n895_106475_c1 3300050512 Bacteria 2817
722 nmdc:mga0n895_223635_c1 3300050512 Bacteria 1911
723 nmdc:mga0n895_228054_c1 3300050512 Bacteria 1891
724 nmdc:mga0n895_312407_c1 3300050512 Bacteria 1593
725 nmdc:mga0n895_389462_c1 3300050512 Bacteria 1410
726 nmdc:mga0n895_49179_c1 3300050512 Bacteria 4130
727 nmdc:mga0n895_57664_c1 3300050512 Bacteria 3828
728 nmdc:mga0n895_61907_c1 3300050512 Bacteria 3696
729 nmdc:mga0n895_620916_c1 3300050512 Bacteria 1082
730 nmdc:mga0n895_66748_c1 3300050512 Bacteria 3562
731 nmdc:mga0n895_8_c1 3300050512 Bacteria 121439
732 nmdc:mga0rr50_131113_c1 3300050513 Bacteria 2007
733 nmdc:mga0rr50_183809_c1 3300050513 Bacteria 1710
734 nmdc:mga0rr50_23_c1 3300050513 Bacteria 116800
735 nmdc:mga0rr50_32880_c1 3300050513 Bacteria 3701
736 nmdc:mga0rr50_36661_c1 3300050513 Bacteria 3534
737 nmdc:mga0rr50_399644_c1 3300050513 Bacteria 1161
738 nmdc:mga0rr50_618_c1 3300050513 Bacteria 19051
739 nmdc:mga0rr50_629376_c1 3300050513 Bacteria 915
740 nmdc:mga0rr50_93444_c1 3300050513 Bacteria 2347
741 nmdc:mga08x19_100971_c1 3300050514 Bacteria 1914
742 nmdc:mga08x19_12493_c1 3300050514 Bacteria 5119
743 nmdc:mga08x19_165_c1 3300050514 Bacteria 54991
744 nmdc:mga08x19_9112_c1 3300050514 Bacteria 5925
745 nmdc:mga08x19_98642_c1 3300050514 Bacteria 1936
746 nmdc:mga0a205_132634_c1 3300050515 Bacteria 2391
747 nmdc:mga0a205_17674_c1 3300050515 Bacteria 6693
748 nmdc:mga0a205_182600_c1 3300050515 Bacteria 1991
749 nmdc:mga0a205_211484_c1 3300050515 Bacteria 1828
750 nmdc:mga0a205_255077_c1 3300050515 Bacteria 1633
751 nmdc:mga0a205_286039_c1 3300050515 Bacteria 1524
752 nmdc:mga0a205_390141_c1 3300050515 Unclassified 1257
753 nmdc:mga0a205_41360_c1 3300050515 Bacteria 4438
754 Ga0495601_0026265 3300053077 Bacteria 3594
755 Ga0495601_0056226 3300053077 Bacteria 2492
756 Ga0495601_0074765 3300053077 Bacteria 2168
757 Ga0495619_0004868 3300053085 Bacteria 8524
758 Ga0495619_0301359 3300053085 Unclassified 1110
759 Ga0500651_0242992 3300053093 Unclassified 1049
760 Ga0500555_022300 3300053103 Bacteria 1820
761 Ga0500568_0008892 3300053139 Bacteria 4804
762 Ga0501084_0038281 3300054114 Bacteria 4009
763 Ga0590071_000286 3300059421 Bacteria 14746
764 Ga0590074_002198 3300059423 Bacteria 3202
765 Ga0590077_000879 3300059426 Bacteria 7697
766 Ga0501082_0189629 3300060353 Bacteria 1789
767 Ga0501082_0196572 3300060353 Bacteria 1754
768 Ga0501082_0304890 3300060353 Bacteria 1387
769 Ga0501082_0420906 3300060353 Bacteria 1166
770 Ga0530510_0018199 3300061734 Bacteria 4981
771 Ga0530510_0039134 3300061734 Bacteria 3423
772 Ga0530510_0092617 3300061734 Bacteria 2206
773 Ga0530510_0126753 3300061734 Bacteria 1877

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014969 Ga0157376_10341882 Ga0157376_103418821 243
2 3300038443 Ga0395901_0413018 Ga0395901_0413018_60_917 244
3 3300036401 Ga0373937_0153381 Ga0373937_0153381_14_811 246
4 3300050507 nmdc:mga05p37_225835_c1 nmdc:mga05p37_225835_c1_11_802 246
5 3300009094 Ga0111539_10358186 Ga0111539_103581862 249
6 3300050511 nmdc:mga08y16_173550_c1 nmdc:mga08y16_173550_c1_1276_2103 249
7 3300049576 Ga0501040_0440721 Ga0501040_0440721_162_917 250
8 3300049587 Ga0501071_0477442 Ga0501071_0477442_187_942 250
9 3300005290 Ga0065712_10107967 Ga0065712_101079672 255
10 3300005536 Ga0070697_100394030 Ga0070697_1003940302 255
11 3300006914 Ga0075436_100043595 Ga0075436_1000435952 255
12 3300035086 Ga0373934_0000325 Ga0373934_0000325_6375_7235 255
13 3300035119 Ga0373956_0046774 Ga0373956_0046774_74_934 255
14 3300035120 Ga0373957_0004234 Ga0373957_0004234_687_1547 255
15 3300035410 Ga0373924_0079333 Ga0373924_0079333_53_913 255
16 3300035724 Ga0373933_0082877 Ga0373933_0082877_855_1715 255
17 3300036401 Ga0373937_0000553 Ga0373937_0000553_23060_23920 255
18 3300050513 nmdc:mga0rr50_399644_c1 nmdc:mga0rr50_399644_c1_11_895 255
19 3300050515 nmdc:mga0a205_132634_c1 nmdc:mga0a205_132634_c1_280_1158 255
20 3300053093 Ga0500651_0242992 Ga0500651_0242992_154_1014 256
21 3300005518 Ga0070699_100071834 Ga0070699_1000718343 258
22 3300006871 Ga0075434_100103133 Ga0075434_1001031333 260
23 3300045976 Ga0466967_0246898 Ga0466967_0246898_102_977 260
24 3300050512 nmdc:mga0n895_223635_c1 nmdc:mga0n895_223635_c1_1017_1901 260
25 3300005440 Ga0070705_100022317 Ga0070705_1000223174 262
26 3300006051 Ga0075364_10068331 Ga0075364_100683312 262
27 3300050491 nmdc:mga00v17_77327_c1 nmdc:mga00v17_77327_c1_454_1314 262
28 3300025918 Ga0207662_10217663 Ga0207662_102176632 263
29 3300059423 Ga0590074_002198 Ga0590074_002198_140_997 263
30 3300059426 Ga0590077_000879 Ga0590077_000879_6687_7544 263
31 3300005985 Ga0081539_10018173 Ga0081539_100181731 264
32 3300006871 Ga0075434_100139413 Ga0075434_1001394132 264
33 3300007076 Ga0075435_100000404 Ga0075435_10000040419 264
34 3300009094 Ga0111539_10060587 Ga0111539_100605872 264
35 3300009147 Ga0114129_10031216 Ga0114129_100312166 264
36 3300009147 Ga0114129_10072173 Ga0114129_100721734 264
37 3300034819 Ga0373958_0000542 Ga0373958_0000542_3351_4217 264
38 3300035091 Ga0373951_0000475 Ga0373951_0000475_1226_2092 264
39 3300035092 Ga0373952_0001255 Ga0373952_0001255_1395_2261 264
40 3300035114 Ga0373939_0005973 Ga0373939_0005973_1395_2261 264
41 3300035115 Ga0373941_0004778 Ga0373941_0004778_1093_1959 264
42 3300035242 Ga0373962_0000747 Ga0373962_0000747_5285_6151 264
43 3300035691 Ga0373931_0000745 Ga0373931_0000745_5834_6700 264
44 3300045051 Ga0451576_0219836 Ga0451576_0219836_880_1746 264
45 3300050507 nmdc:mga05p37_34620_c1 nmdc:mga05p37_34620_c1_2625_3539 264
46 3300050513 nmdc:mga0rr50_618_c1 nmdc:mga0rr50_618_c1_3498_4364 264
47 3300050514 nmdc:mga08x19_100971_c1 nmdc:mga08x19_100971_c1_157_1023 264
48 3300005356 Ga0070674_100417024 Ga0070674_1004170241 265
49 3300005457 Ga0070662_100242114 Ga0070662_1002421142 265
50 3300005578 Ga0068854_100224822 Ga0068854_1002248222 265
51 3300005842 Ga0068858_100079687 Ga0068858_1000796873 265
52 3300009093 Ga0105240_10080775 Ga0105240_100807752 265
53 3300014326 Ga0157380_10095651 Ga0157380_100956511 265
54 3300025933 Ga0207706_10252015 Ga0207706_102520152 265
55 3300025981 Ga0207640_10284612 Ga0207640_102846122 265
56 3300026035 Ga0207703_10021021 Ga0207703_100210214 265
57 3300026118 Ga0207675_100062193 Ga0207675_1000621934 265
58 3300031548 Ga0307408_100076075 Ga0307408_1000760753 266
59 3300048904 Ga0496101_0292003 Ga0496101_0292003_185_1048 266
60 3300005329 Ga0070683_100112517 Ga0070683_1001125172 267
61 3300005290 Ga0065712_10072264 Ga0065712_100722643 269
62 3300005844 Ga0068862_100202123 Ga0068862_1002021232 269
63 3300025315 Ga0207697_10080375 Ga0207697_100803752 269
64 3300028380 Ga0268265_10162126 Ga0268265_101621262 269
65 3300048912 Ga0496109_0078971 Ga0496109_0078971_494_1360 269
66 3300048913 Ga0496110_0083633 Ga0496110_0083633_1913_2779 269
67 3300014969 Ga0157376_10338809 Ga0157376_103388092 270
68 3300031548 Ga0307408_100044867 Ga0307408_1000448673 270
69 3300032126 Ga0307415_100230100 Ga0307415_1002301002 270
70 3300048905 Ga0496102_0144120 Ga0496102_0144120_459_1328 270
71 3300050512 nmdc:mga0n895_620916_c1 nmdc:mga0n895_620916_c1_154_1014 270
72 3300005328 Ga0070676_10000699 Ga0070676_100006997 271
73 3300005341 Ga0070691_10003375 Ga0070691_100033755 271
74 3300005444 Ga0070694_100012406 Ga0070694_1000124066 271
75 3300005459 Ga0068867_100006297 Ga0068867_1000062977 271
76 3300005545 Ga0070695_100009348 Ga0070695_1000093486 271
77 3300005546 Ga0070696_100014340 Ga0070696_1000143402 271
78 3300005549 Ga0070704_100003916 Ga0070704_1000039164 271
79 3300005615 Ga0070702_100000153 Ga0070702_1000001532 271
80 3300005617 Ga0068859_100862943 Ga0068859_1008629432 271
81 3300005719 Ga0068861_100009190 Ga0068861_1000091904 271
82 3300006931 Ga0097620_100863149 Ga0097620_1008631492 271
83 3300025907 Ga0207645_10000703 Ga0207645_1000070311 271
84 3300025960 Ga0207651_10056443 Ga0207651_100564431 271
85 3300026075 Ga0207708_10053476 Ga0207708_100534765 271
86 3300026118 Ga0207675_100012476 Ga0207675_1000124765 271
87 3300005331 Ga0070670_100238307 Ga0070670_1002383072 272
88 3300005981 Ga0081538_10046027 Ga0081538_100460272 272
89 3300009094 Ga0111539_10000602 Ga0111539_1000060213 272
90 3300009147 Ga0114129_10074016 Ga0114129_100740163 272
91 3300013306 Ga0163162_10300551 Ga0163162_103005512 272
92 3300026088 Ga0207641_10541862 Ga0207641_105418621 272
93 3300027907 Ga0207428_10001302 Ga0207428_1000130221 272
94 3300031548 Ga0307408_100169148 Ga0307408_1001691482 272
95 3300032002 Ga0307416_100144179 Ga0307416_1001441792 272
96 3300048905 Ga0496102_0185098 Ga0496102_0185098_227_1099 272
97 3300050507 nmdc:mga05p37_66740_c1 nmdc:mga05p37_66740_c1_1939_2787 272
98 3300050511 nmdc:mga08y16_882_c1 nmdc:mga08y16_882_c1_15534_16394 272
99 3300005343 Ga0070687_100168436 Ga0070687_1001684362 273
100 3300006844 Ga0075428_100000185 Ga0075428_10000018538 273
101 3300009094 Ga0111539_10000160 Ga0111539_1000016017 273
102 3300009553 Ga0105249_10174424 Ga0105249_101744242 273
103 3300027907 Ga0207428_10000234 Ga0207428_1000023417 273
104 3300050511 nmdc:mga08y16_10_c1 nmdc:mga08y16_10_c1_14672_15535 273
105 3300050511 nmdc:mga08y16_12823_c1 nmdc:mga08y16_12823_c1_6780_7601 273
106 3300005290 Ga0065712_10207944 Ga0065712_102079442 274
107 3300005331 Ga0070670_100098656 Ga0070670_1000986562 274
108 3300005367 Ga0070667_100205627 Ga0070667_1002056271 274
109 3300005536 Ga0070697_100092703 Ga0070697_1000927032 274
110 3300005543 Ga0070672_100062270 Ga0070672_1000622702 274
111 3300005548 Ga0070665_100001535 Ga0070665_1000015355 274
112 3300005549 Ga0070704_100146523 Ga0070704_1001465232 274
113 3300005564 Ga0070664_100018344 Ga0070664_1000183443 274
114 3300005577 Ga0068857_100524412 Ga0068857_1005244122 274
115 3300005719 Ga0068861_100258100 Ga0068861_1002581002 274
116 3300005842 Ga0068858_100017801 Ga0068858_1000178015 274
117 3300005843 Ga0068860_100237809 Ga0068860_1002378092 274
118 3300006237 Ga0097621_100051939 Ga0097621_1000519393 274
119 3300006358 Ga0068871_100055165 Ga0068871_1000551652 274
120 3300006844 Ga0075428_100006198 Ga0075428_10000619814 274
121 3300006852 Ga0075433_10002985 Ga0075433_100029857 274
122 3300006880 Ga0075429_100182682 Ga0075429_1001826822 274
123 3300007076 Ga0075435_100529093 Ga0075435_1005290932 274
124 3300009093 Ga0105240_10262018 Ga0105240_102620182 274
125 3300009094 Ga0111539_10000696 Ga0111539_1000069614 274
126 3300009098 Ga0105245_10011551 Ga0105245_100115514 274
127 3300009176 Ga0105242_10009242 Ga0105242_100092424 274
128 3300009177 Ga0105248_10022913 Ga0105248_100229133 274
129 3300010375 Ga0105239_10408535 Ga0105239_104085352 274
130 3300013296 Ga0157374_10002073 Ga0157374_100020735 274
131 3300013308 Ga0157375_10231243 Ga0157375_102312431 274
132 3300014325 Ga0163163_10298179 Ga0163163_102981792 274
133 3300014968 Ga0157379_10044852 Ga0157379_100448523 274
134 3300014969 Ga0157376_10148821 Ga0157376_101488213 274
135 3300025903 Ga0207680_10395067 Ga0207680_103950672 274
136 3300025918 Ga0207662_10124767 Ga0207662_101247672 274
137 3300025923 Ga0207681_10255692 Ga0207681_102556921 274
138 3300025925 Ga0207650_10003830 Ga0207650_100038302 274
139 3300025926 Ga0207659_10448836 Ga0207659_104488362 274
140 3300025927 Ga0207687_10009881 Ga0207687_100098815 274
141 3300025934 Ga0207686_10004368 Ga0207686_100043684 274
142 3300025936 Ga0207670_10154530 Ga0207670_101545302 274
143 3300025945 Ga0207679_10010589 Ga0207679_100105894 274
144 3300025986 Ga0207658_10357747 Ga0207658_103577471 274
145 3300026023 Ga0207677_10113727 Ga0207677_101137272 274
146 3300026035 Ga0207703_10242630 Ga0207703_102426301 274
147 3300026095 Ga0207676_10107590 Ga0207676_101075903 274
148 3300026116 Ga0207674_10374976 Ga0207674_103749762 274
149 3300026118 Ga0207675_100140677 Ga0207675_1001406773 274
150 3300028379 Ga0268266_10003216 Ga0268266_100032169 274
151 3300028381 Ga0268264_10158713 Ga0268264_101587133 274
152 3300036401 Ga0373937_0099930 Ga0373937_0099930_293_1165 274
153 3300046543 Ga0495645_0000493 Ga0495645_0000493_8875_9747 274
154 3300046663 Ga0495635_0048819 Ga0495635_0048819_1300_2172 274
155 3300047319 Ga0495674_0054062 Ga0495674_0054062_1376_2248 274
156 3300047322 Ga0495680_0109726 Ga0495680_0109726_773_1645 274
157 3300047471 Ga0495684_0009207 Ga0495684_0009207_3754_4626 274
158 3300048907 Ga0496104_0203622 Ga0496104_0203622_756_1628 274
159 3300048917 Ga0496114_0025974 Ga0496114_0025974_1380_2252 274
160 3300050507 nmdc:mga05p37_96163_c2 nmdc:mga05p37_96163_c2_1131_1955 274
161 3300050511 nmdc:mga08y16_5423_c1 nmdc:mga08y16_5423_c1_892_1716 274
162 3300050513 nmdc:mga0rr50_629376_c1 nmdc:mga0rr50_629376_c1_23_847 274
163 3300050515 nmdc:mga0a205_17674_c1 nmdc:mga0a205_17674_c1_2632_3456 274
164 3300005338 Ga0068868_100136478 Ga0068868_1001364782 275
165 3300005354 Ga0070675_100573310 Ga0070675_1005733101 275
166 3300005548 Ga0070665_100464003 Ga0070665_1004640032 275
167 3300005618 Ga0068864_100017239 Ga0068864_1000172396 275
168 3300005840 Ga0068870_10211075 Ga0068870_102110752 275
169 3300005842 Ga0068858_100021737 Ga0068858_1000217372 275
170 3300005985 Ga0081539_10000093 Ga0081539_10000093174 275
171 3300009101 Ga0105247_10009155 Ga0105247_100091555 275
172 3300009177 Ga0105248_10000664 Ga0105248_1000066412 275
173 3300009551 Ga0105238_10209861 Ga0105238_102098612 275
174 3300014325 Ga0163163_10068131 Ga0163163_100681313 275
175 3300025900 Ga0207710_10052606 Ga0207710_100526062 275
176 3300025903 Ga0207680_10268807 Ga0207680_102688072 275
177 3300025945 Ga0207679_10074596 Ga0207679_100745963 275
178 3300026035 Ga0207703_10024671 Ga0207703_100246712 275
179 3300026095 Ga0207676_10014449 Ga0207676_100144496 275
180 3300048907 Ga0496104_0082849 Ga0496104_0082849_981_1853 275
181 3300048911 Ga0496108_0006264 Ga0496108_0006264_7044_7916 275
182 3300048916 Ga0496113_0007690 Ga0496113_0007690_1809_2681 275
183 3300059421 Ga0590071_000286 Ga0590071_000286_3375_4202 275
184 3300048913 Ga0496110_0042319 Ga0496110_0042319_2612_3487 276
185 3300048915 Ga0496112_0141479 Ga0496112_0141479_868_1740 276
186 3300005536 Ga0070697_100095605 Ga0070697_1000956052 277
187 3300005546 Ga0070696_100206394 Ga0070696_1002063942 277
188 3300005617 Ga0068859_100002430 Ga0068859_10000243015 277
189 3300006931 Ga0097620_100002430 Ga0097620_10000243015 277
190 3300009098 Ga0105245_10128529 Ga0105245_101285292 277
191 3300009147 Ga0114129_10609664 Ga0114129_106096642 277
192 3300025922 Ga0207646_10159188 Ga0207646_101591882 277
193 3300036401 Ga0373937_0283328 Ga0373937_0283328_68_901 277
194 3300036401 Ga0373937_0386871 Ga0373937_0386871_466_1299 277
195 3300046664 Ga0495659_0112090 Ga0495659_0112090_58_891 277
196 3300049572 Ga0501036_0042741 Ga0501036_0042741_2108_2968 277
197 3300049577 Ga0501041_0094191 Ga0501041_0094191_610_1470 277
198 3300049591 Ga0501075_0120646 Ga0501075_0120646_143_1003 277
199 3300049743 Ga0501081_0070876 Ga0501081_0070876_1093_1953 277
200 3300050507 nmdc:mga05p37_478104_c1 nmdc:mga05p37_478104_c1_98_931 277
201 3300050512 nmdc:mga0n895_389462_c1 nmdc:mga0n895_389462_c1_198_1031 277
202 3300050515 nmdc:mga0a205_255077_c1 nmdc:mga0a205_255077_c1_267_1100 277
203 3300009176 Ga0105242_10211456 Ga0105242_102114562 278
204 3300014325 Ga0163163_10000071 Ga0163163_1000007119 278
205 3300045051 Ga0451576_0789040 Ga0451576_0789040_100_975 278
206 3300049572 Ga0501036_0017503 Ga0501036_0017503_3996_4856 278
207 3300049581 Ga0501047_0032690 Ga0501047_0032690_3680_4540 278
208 3300049584 Ga0501068_0029322 Ga0501068_0029322_86_946 278
209 3300049586 Ga0501070_0236651 Ga0501070_0236651_525_1385 278
210 3300049742 Ga0501080_0073196 Ga0501080_0073196_618_1478 278
211 3300049744 Ga0501083_0020813 Ga0501083_0020813_3240_4100 278
212 3300049823 Ga0501044_0357331 Ga0501044_0357331_429_1289 278
213 3300060353 Ga0501082_0196572 Ga0501082_0196572_565_1425 278
214 3300006914 Ga0075436_100058963 Ga0075436_1000589633 279
215 3300009177 Ga0105248_10102078 Ga0105248_101020782 279
216 3300014969 Ga0157376_10669417 Ga0157376_106694171 279
217 3300025942 Ga0207689_10067247 Ga0207689_100672472 279
218 3300046681 Ga0495647_0100015 Ga0495647_0100015_303_1163 279
219 3300047321 Ga0495676_0147614 Ga0495676_0147614_725_1585 279
220 3300049588 Ga0501072_0266474 Ga0501072_0266474_463_1323 279
221 3300005293 Ga0065715_10001723 Ga0065715_100017237 280
222 3300005364 Ga0070673_100445383 Ga0070673_1004453832 280
223 3300005438 Ga0070701_10148322 Ga0070701_101483222 280
224 3300005467 Ga0070706_100192377 Ga0070706_1001923772 280
225 3300005545 Ga0070695_100006557 Ga0070695_1000065576 280
226 3300005546 Ga0070696_100276345 Ga0070696_1002763451 280
227 3300005842 Ga0068858_100062574 Ga0068858_1000625743 280
228 3300005937 Ga0081455_10152618 Ga0081455_101526182 280
229 3300014325 Ga0163163_10015069 Ga0163163_100150697 280
230 3300014968 Ga0157379_10033243 Ga0157379_100332434 280
231 3300025910 Ga0207684_10166296 Ga0207684_101662962 280
232 3300026035 Ga0207703_10100743 Ga0207703_101007433 280
233 3300026035 Ga0207703_10702541 Ga0207703_107025411 280
234 3300026118 Ga0207675_100177556 Ga0207675_1001775562 280
235 3300005444 Ga0070694_100018659 Ga0070694_1000186593 281
236 3300005445 Ga0070708_100505920 Ga0070708_1005059202 281
237 3300005467 Ga0070706_100310088 Ga0070706_1003100882 281
238 3300005468 Ga0070707_100220807 Ga0070707_1002208071 281
239 3300005471 Ga0070698_100200224 Ga0070698_1002002242 281
240 3300005518 Ga0070699_100001478 Ga0070699_1000014785 281
241 3300005535 Ga0070684_100181808 Ga0070684_1001818082 281
242 3300005545 Ga0070695_100050006 Ga0070695_1000500062 281
243 3300005546 Ga0070696_100037917 Ga0070696_1000379172 281
244 3300005617 Ga0068859_100213567 Ga0068859_1002135672 281
245 3300005844 Ga0068862_100309333 Ga0068862_1003093332 281
246 3300006852 Ga0075433_10196348 Ga0075433_101963483 281
247 3300006871 Ga0075434_100046329 Ga0075434_1000463294 281
248 3300006881 Ga0068865_100052129 Ga0068865_1000521293 281
249 3300006914 Ga0075436_100009966 Ga0075436_1000099666 281
250 3300006931 Ga0097620_100213557 Ga0097620_1002135572 281
251 3300007076 Ga0075435_100003568 Ga0075435_1000035688 281
252 3300007076 Ga0075435_100089258 Ga0075435_1000892582 281
253 3300007265 Ga0099794_10047989 Ga0099794_100479892 281
254 3300009177 Ga0105248_10076990 Ga0105248_100769903 281
255 3300013308 Ga0157375_10595022 Ga0157375_105950222 281
256 3300025922 Ga0207646_10082584 Ga0207646_100825842 281
257 3300025934 Ga0207686_10223851 Ga0207686_102238512 281
258 3300026035 Ga0207703_10543874 Ga0207703_105438742 281
259 3300031344 Ga0265316_10157511 Ga0265316_101575111 281
260 3300031711 Ga0265314_10129545 Ga0265314_101295452 281
261 3300046615 Ga0495656_0095683 Ga0495656_0095683_135_995 281
262 3300048903 Ga0496100_0069187 Ga0496100_0069187_397_1242 281
263 3300048904 Ga0496101_0001075 Ga0496101_0001075_1214_2059 281
264 3300048907 Ga0496104_0002797 Ga0496104_0002797_13386_14231 281
265 3300048908 Ga0496105_0099450 Ga0496105_0099450_298_1143 281
266 3300048909 Ga0496106_0025090 Ga0496106_0025090_2640_3485 281
267 3300050507 nmdc:mga05p37_18019_c1 nmdc:mga05p37_18019_c1_5801_6658 281
268 3300050512 nmdc:mga0n895_49179_c1 nmdc:mga0n895_49179_c1_2888_3748 281
269 3300050512 nmdc:mga0n895_57664_c1 nmdc:mga0n895_57664_c1_2768_3631 281
270 3300050513 nmdc:mga0rr50_131113_c1 nmdc:mga0rr50_131113_c1_1109_1963 281
271 3300050513 nmdc:mga0rr50_36661_c1 nmdc:mga0rr50_36661_c1_398_1258 281
272 3300050514 nmdc:mga08x19_98642_c1 nmdc:mga08x19_98642_c1_715_1569 281
273 3300005340 Ga0070689_100219068 Ga0070689_1002190681 282
274 3300005353 Ga0070669_100097555 Ga0070669_1000975552 282
275 3300005356 Ga0070674_100059259 Ga0070674_1000592592 282
276 3300005364 Ga0070673_100041377 Ga0070673_1000413772 282
277 3300005365 Ga0070688_100034875 Ga0070688_1000348752 282
278 3300005457 Ga0070662_100094530 Ga0070662_1000945302 282
279 3300005543 Ga0070672_100247451 Ga0070672_1002474512 282
280 3300005577 Ga0068857_100142398 Ga0068857_1001423982 282
281 3300005617 Ga0068859_100010819 Ga0068859_1000108192 282
282 3300005618 Ga0068864_100649680 Ga0068864_1006496801 282
283 3300005843 Ga0068860_100690453 Ga0068860_1006904531 282
284 3300006844 Ga0075428_100001446 Ga0075428_1000014466 282
285 3300006844 Ga0075428_100121374 Ga0075428_1001213743 282
286 3300006871 Ga0075434_100018881 Ga0075434_1000188813 282
287 3300006871 Ga0075434_100088081 Ga0075434_1000880812 282
288 3300006880 Ga0075429_100004956 Ga0075429_1000049563 282
289 3300006931 Ga0097620_100010819 Ga0097620_1000108192 282
290 3300009094 Ga0111539_10194097 Ga0111539_101940971 282
291 3300009147 Ga0114129_10000307 Ga0114129_1000030718 282
292 3300009147 Ga0114129_10041136 Ga0114129_100411363 282
293 3300009177 Ga0105248_10093898 Ga0105248_100938982 282
294 3300014326 Ga0157380_10170281 Ga0157380_101702812 282
295 3300025315 Ga0207697_10100482 Ga0207697_101004822 282
296 3300025918 Ga0207662_10363168 Ga0207662_103631681 282
297 3300025936 Ga0207670_10063060 Ga0207670_100630602 282
298 3300025940 Ga0207691_10131951 Ga0207691_101319512 282
299 3300025941 Ga0207711_10427666 Ga0207711_104276661 282
300 3300026095 Ga0207676_10615925 Ga0207676_106159251 282
301 3300027907 Ga0207428_10265195 Ga0207428_102651952 282
302 3300028380 Ga0268265_10450452 Ga0268265_104504521 282
303 3300042876 Ga0451577_0286690 Ga0451577_0286690_13_861 282
304 3300047320 Ga0495672_0000242 Ga0495672_0000242_58725_59573 282
305 3300049568 Ga0501031_0330088 Ga0501031_0330088_53_901 282
306 3300049577 Ga0501041_0039182 Ga0501041_0039182_999_1847 282
307 3300049592 Ga0501076_0005951 Ga0501076_0005951_6381_7229 282
308 3300049824 Ga0501045_0074879 Ga0501045_0074879_670_1518 282
309 3300050493 nmdc:mga0k408_274502_c1 nmdc:mga0k408_274502_c1_116_964 282
310 3300050493 nmdc:mga0k408_48248_c1 nmdc:mga0k408_48248_c1_815_1663 282
311 3300050495 nmdc:mga04h51_112180_c1 nmdc:mga04h51_112180_c1_48_896 282
312 3300050507 nmdc:mga05p37_56987_c1 nmdc:mga05p37_56987_c1_2513_3361 282
313 3300050507 nmdc:mga05p37_6700_c1 nmdc:mga05p37_6700_c1_12551_13420 282
314 3300050508 nmdc:mga09592_2118_c1 nmdc:mga09592_2118_c1_1242_2090 282
315 3300050511 nmdc:mga08y16_594705_c1 nmdc:mga08y16_594705_c1_107_955 282
316 3300050512 nmdc:mga0n895_106475_c1 nmdc:mga0n895_106475_c1_874_1743 282
317 3300050513 nmdc:mga0rr50_183809_c1 nmdc:mga0rr50_183809_c1_236_1084 282
318 3300050515 nmdc:mga0a205_211484_c1 nmdc:mga0a205_211484_c1_821_1669 282
319 3300053103 Ga0500555_022300 Ga0500555_022300_839_1687 282
320 3300005328 Ga0070676_10017521 Ga0070676_100175212 283
321 3300005330 Ga0070690_100033059 Ga0070690_1000330593 283
322 3300005330 Ga0070690_100039162 Ga0070690_1000391622 283
323 3300005334 Ga0068869_100000964 Ga0068869_10000096410 283
324 3300005340 Ga0070689_100007688 Ga0070689_1000076886 283
325 3300005347 Ga0070668_100103380 Ga0070668_1001033803 283
326 3300005353 Ga0070669_100031922 Ga0070669_1000319223 283
327 3300005354 Ga0070675_100126870 Ga0070675_1001268702 283
328 3300005356 Ga0070674_100001871 Ga0070674_1000018718 283
329 3300005365 Ga0070688_100007851 Ga0070688_1000078512 283
330 3300005367 Ga0070667_100022288 Ga0070667_1000222884 283
331 3300005406 Ga0070703_10030703 Ga0070703_100307032 283
332 3300005438 Ga0070701_10040089 Ga0070701_100400892 283
333 3300005438 Ga0070701_10194275 Ga0070701_101942752 283
334 3300005444 Ga0070694_100079716 Ga0070694_1000797162 283
335 3300005444 Ga0070694_100402596 Ga0070694_1004025962 283
336 3300005456 Ga0070678_100003316 Ga0070678_1000033162 283
337 3300005458 Ga0070681_10427219 Ga0070681_104272192 283
338 3300005459 Ga0068867_100002075 Ga0068867_1000020752 283
339 3300005467 Ga0070706_100011704 Ga0070706_1000117043 283
340 3300005467 Ga0070706_100012509 Ga0070706_1000125092 283
341 3300005468 Ga0070707_100014338 Ga0070707_1000143386 283
342 3300005471 Ga0070698_100019232 Ga0070698_1000192325 283
343 3300005471 Ga0070698_100032063 Ga0070698_1000320632 283
344 3300005518 Ga0070699_100004519 Ga0070699_1000045199 283
345 3300005518 Ga0070699_100032818 Ga0070699_1000328182 283
346 3300005518 Ga0070699_100110423 Ga0070699_1001104232 283
347 3300005536 Ga0070697_100020652 Ga0070697_1000206524 283
348 3300005539 Ga0068853_100278383 Ga0068853_1002783832 283
349 3300005543 Ga0070672_100028622 Ga0070672_1000286223 283
350 3300005544 Ga0070686_100000389 Ga0070686_10000038924 283
351 3300005544 Ga0070686_100009670 Ga0070686_1000096702 283
352 3300005545 Ga0070695_100008088 Ga0070695_1000080882 283
353 3300005546 Ga0070696_100084821 Ga0070696_1000848212 283
354 3300005549 Ga0070704_100023161 Ga0070704_1000231613 283
355 3300005549 Ga0070704_100080914 Ga0070704_1000809142 283
356 3300005578 Ga0068854_100011771 Ga0068854_1000117714 283
357 3300005614 Ga0068856_100020616 Ga0068856_1000206163 283
358 3300005615 Ga0070702_100139383 Ga0070702_1001393832 283
359 3300005617 Ga0068859_100010205 Ga0068859_1000102056 283
360 3300005719 Ga0068861_100039211 Ga0068861_1000392112 283
361 3300005840 Ga0068870_10003571 Ga0068870_100035713 283
362 3300005841 Ga0068863_100007204 Ga0068863_1000072046 283
363 3300005842 Ga0068858_100022246 Ga0068858_1000222462 283
364 3300005843 Ga0068860_100017112 Ga0068860_1000171125 283
365 3300005844 Ga0068862_100307396 Ga0068862_1003073962 283
366 3300006038 Ga0075365_10001234 Ga0075365_100012342 283
367 3300006042 Ga0075368_10015337 Ga0075368_100153373 283
368 3300006048 Ga0075363_100024048 Ga0075363_1000240482 283
369 3300006048 Ga0075363_100127602 Ga0075363_1001276022 283
370 3300006051 Ga0075364_10016789 Ga0075364_100167892 283
371 3300006051 Ga0075364_10158757 Ga0075364_101587572 283
372 3300006178 Ga0075367_10000879 Ga0075367_100008794 283
373 3300006178 Ga0075367_10001875 Ga0075367_100018754 283
374 3300006195 Ga0075366_10000322 Ga0075366_100003225 283
375 3300006353 Ga0075370_10112040 Ga0075370_101120402 283
376 3300006844 Ga0075428_100009291 Ga0075428_1000092916 283
377 3300006844 Ga0075428_100044494 Ga0075428_1000444942 283
378 3300006844 Ga0075428_100049566 Ga0075428_1000495665 283
379 3300006844 Ga0075428_100235005 Ga0075428_1002350052 283
380 3300006846 Ga0075430_100041017 Ga0075430_1000410172 283
381 3300006847 Ga0075431_100000373 Ga0075431_1000003739 283
382 3300006847 Ga0075431_100200574 Ga0075431_1002005742 283
383 3300006852 Ga0075433_10119754 Ga0075433_101197543 283
384 3300006852 Ga0075433_10362897 Ga0075433_103628972 283
385 3300006871 Ga0075434_100116335 Ga0075434_1001163352 283
386 3300006871 Ga0075434_100147879 Ga0075434_1001478792 283
387 3300006871 Ga0075434_100232096 Ga0075434_1002320962 283
388 3300006871 Ga0075434_100686417 Ga0075434_1006864172 283
389 3300006880 Ga0075429_100057532 Ga0075429_1000575322 283
390 3300006881 Ga0068865_100014920 Ga0068865_1000149205 283
391 3300006881 Ga0068865_100454968 Ga0068865_1004549682 283
392 3300006931 Ga0097620_100010205 Ga0097620_1000102056 283
393 3300007076 Ga0075435_100003713 Ga0075435_1000037139 283
394 3300009093 Ga0105240_10243836 Ga0105240_102438362 283
395 3300009093 Ga0105240_10646204 Ga0105240_106462041 283
396 3300009094 Ga0111539_10000156 Ga0111539_1000015613 283
397 3300009094 Ga0111539_10001042 Ga0111539_1000104220 283
398 3300009147 Ga0114129_10105727 Ga0114129_101057273 283
399 3300009147 Ga0114129_10190198 Ga0114129_101901983 283
400 3300009147 Ga0114129_10373801 Ga0114129_103738011 283
401 3300009148 Ga0105243_10026757 Ga0105243_100267573 283
402 3300009148 Ga0105243_10032527 Ga0105243_100325275 283
403 3300009176 Ga0105242_10014541 Ga0105242_100145412 283
404 3300009177 Ga0105248_10013204 Ga0105248_100132047 283
405 3300014745 Ga0157377_10019370 Ga0157377_100193702 283
406 3300014968 Ga0157379_10172233 Ga0157379_101722332 283
407 3300025885 Ga0207653_10021645 Ga0207653_100216452 283
408 3300025907 Ga0207645_10020740 Ga0207645_100207403 283
409 3300025908 Ga0207643_10003545 Ga0207643_100035453 283
410 3300025910 Ga0207684_10002365 Ga0207684_100023657 283
411 3300025910 Ga0207684_10011424 Ga0207684_100114244 283
412 3300025910 Ga0207684_10057251 Ga0207684_100572512 283
413 3300025913 Ga0207695_10206287 Ga0207695_102062872 283
414 3300025918 Ga0207662_10010058 Ga0207662_100100585 283
415 3300025922 Ga0207646_10038448 Ga0207646_100384483 283
416 3300025922 Ga0207646_10099480 Ga0207646_100994802 283
417 3300025923 Ga0207681_10064591 Ga0207681_100645912 283
418 3300025937 Ga0207669_10023792 Ga0207669_100237924 283
419 3300025938 Ga0207704_10014182 Ga0207704_100141825 283
420 3300025940 Ga0207691_10022611 Ga0207691_100226112 283
421 3300025941 Ga0207711_10077122 Ga0207711_100771222 283
422 3300025942 Ga0207689_10005018 Ga0207689_100050188 283
423 3300025961 Ga0207712_10051925 Ga0207712_100519252 283
424 3300025981 Ga0207640_10014136 Ga0207640_100141362 283
425 3300025986 Ga0207658_10465473 Ga0207658_104654732 283
426 3300026035 Ga0207703_10008893 Ga0207703_100088936 283
427 3300026075 Ga0207708_10022108 Ga0207708_100221082 283
428 3300026078 Ga0207702_10154700 Ga0207702_101547003 283
429 3300026088 Ga0207641_10067332 Ga0207641_100673322 283
430 3300026089 Ga0207648_10021347 Ga0207648_100213475 283
431 3300026118 Ga0207675_100060424 Ga0207675_1000604242 283
432 3300026121 Ga0207683_10081641 Ga0207683_100816413 283
433 3300027907 Ga0207428_10000070 Ga0207428_1000007042 283
434 3300028381 Ga0268264_10043485 Ga0268264_100434854 283
435 3300034816 Ga0373930_0000070 Ga0373930_0000070_6723_7589 283
436 3300034817 Ga0373948_0008242 Ga0373948_0008242_79_945 283
437 3300035088 Ga0373940_0000640 Ga0373940_0000640_1181_2047 283
438 3300035090 Ga0373949_0000540 Ga0373949_0000540_1717_2583 283
439 3300035207 Ga0373942_0000397 Ga0373942_0000397_4537_5403 283
440 3300035241 Ga0373961_0001526 Ga0373961_0001526_1541_2407 283
441 3300046460 Ga0495638_0015021 Ga0495638_0015021_1698_2561 283
442 3300048905 Ga0496102_0022264 Ga0496102_0022264_4160_5026 283
443 3300049587 Ga0501071_0234230 Ga0501071_0234230_492_1343 283
444 3300049741 Ga0501079_0207115 Ga0501079_0207115_24_875 283
445 3300049743 Ga0501081_0110545 Ga0501081_0110545_82_933 283
446 3300050490 nmdc:mga03n38_109712_c1 nmdc:mga03n38_109712_c1_130_981 283
447 3300050492 nmdc:mga0yw44_115556_c1 nmdc:mga0yw44_115556_c1_313_1173 283
448 3300050493 nmdc:mga0k408_1023_c1 nmdc:mga0k408_1023_c1_11420_12280 283
449 3300050494 nmdc:mga06z11_2066_c1 nmdc:mga06z11_2066_c1_123_983 283
450 3300050496 nmdc:mga07m45_110212_c1 nmdc:mga07m45_110212_c1_317_1177 283
451 3300050507 nmdc:mga05p37_115943_c1 nmdc:mga05p37_115943_c1_1376_2227 283
452 3300050507 nmdc:mga05p37_6282_c1 nmdc:mga05p37_6282_c1_11781_12632 283
453 3300050508 nmdc:mga09592_39944_c1 nmdc:mga09592_39944_c1_451_1311 283
454 3300050510 nmdc:mga06r32_1608_c1 nmdc:mga06r32_1608_c1_1782_2633 283
455 3300050511 nmdc:mga08y16_15573_c1 nmdc:mga08y16_15573_c1_6195_7046 283
456 3300050511 nmdc:mga08y16_1915_c1 nmdc:mga08y16_1915_c1_9346_10206 283
457 3300050512 nmdc:mga0n895_312407_c1 nmdc:mga0n895_312407_c1_257_1108 283
458 3300050513 nmdc:mga0rr50_32880_c1 nmdc:mga0rr50_32880_c1_2532_3383 283
459 3300050515 nmdc:mga0a205_182600_c1 nmdc:mga0a205_182600_c1_44_895 283
460 3300050515 nmdc:mga0a205_286039_c1 nmdc:mga0a205_286039_c1_135_986 283
461 3300050515 nmdc:mga0a205_390141_c1 nmdc:mga0a205_390141_c1_10_861 283
462 3300060353 Ga0501082_0189629 Ga0501082_0189629_443_1294 283
463 3300060353 Ga0501082_0304890 Ga0501082_0304890_258_1109 283
464 3300005471 Ga0070698_100019157 Ga0070698_1000191574 284
465 3300005844 Ga0068862_100600230 Ga0068862_1006002301 284
466 3300009093 Ga0105240_10092713 Ga0105240_100927133 284
467 3300009147 Ga0114129_10205497 Ga0114129_102054972 284
468 3300025913 Ga0207695_10306351 Ga0207695_103063512 284
469 3300026089 Ga0207648_10126285 Ga0207648_101262852 284
470 3300050507 nmdc:mga05p37_217260_c1 nmdc:mga05p37_217260_c1_189_1058 284
471 3300005328 Ga0070676_10068840 Ga0070676_100688402 285
472 3300005335 Ga0070666_10106778 Ga0070666_101067782 285
473 3300005340 Ga0070689_100380007 Ga0070689_1003800072 285
474 3300005353 Ga0070669_100397713 Ga0070669_1003977131 285
475 3300005355 Ga0070671_100026568 Ga0070671_1000265684 285
476 3300005365 Ga0070688_100026468 Ga0070688_1000264682 285
477 3300005365 Ga0070688_100169452 Ga0070688_1001694521 285
478 3300005367 Ga0070667_100057268 Ga0070667_1000572683 285
479 3300005434 Ga0070709_10071049 Ga0070709_100710492 285
480 3300005434 Ga0070709_10099188 Ga0070709_100991882 285
481 3300005435 Ga0070714_100054657 Ga0070714_1000546572 285
482 3300005436 Ga0070713_100069420 Ga0070713_1000694204 285
483 3300005439 Ga0070711_100200363 Ga0070711_1002003632 285
484 3300005456 Ga0070678_100192055 Ga0070678_1001920552 285
485 3300005459 Ga0068867_100008030 Ga0068867_1000080308 285
486 3300005459 Ga0068867_100084626 Ga0068867_1000846262 285
487 3300005471 Ga0070698_100028041 Ga0070698_1000280416 285
488 3300005530 Ga0070679_100219458 Ga0070679_1002194582 285
489 3300005539 Ga0068853_100678191 Ga0068853_1006781911 285
490 3300005543 Ga0070672_100379155 Ga0070672_1003791552 285
491 3300005543 Ga0070672_100500864 Ga0070672_1005008642 285
492 3300005544 Ga0070686_100068212 Ga0070686_1000682122 285
493 3300005547 Ga0070693_100128802 Ga0070693_1001288022 285
494 3300005548 Ga0070665_100005633 Ga0070665_1000056339 285
495 3300005549 Ga0070704_100050537 Ga0070704_1000505374 285
496 3300005578 Ga0068854_100034635 Ga0068854_1000346354 285
497 3300005615 Ga0070702_100076128 Ga0070702_1000761282 285
498 3300005617 Ga0068859_100076006 Ga0068859_1000760063 285
499 3300005618 Ga0068864_100468257 Ga0068864_1004682571 285
500 3300005841 Ga0068863_100083398 Ga0068863_1000833982 285
501 3300005841 Ga0068863_100700121 Ga0068863_1007001212 285
502 3300005842 Ga0068858_100175688 Ga0068858_1001756882 285
503 3300005842 Ga0068858_100214731 Ga0068858_1002147311 285
504 3300005843 Ga0068860_100084173 Ga0068860_1000841734 285
505 3300005844 Ga0068862_100053930 Ga0068862_1000539302 285
506 3300005844 Ga0068862_100116919 Ga0068862_1001169192 285
507 3300005844 Ga0068862_100479580 Ga0068862_1004795802 285
508 3300006175 Ga0070712_100413800 Ga0070712_1004138002 285
509 3300006237 Ga0097621_100022037 Ga0097621_1000220372 285
510 3300006237 Ga0097621_100025087 Ga0097621_1000250872 285
511 3300006237 Ga0097621_100474135 Ga0097621_1004741351 285
512 3300006358 Ga0068871_100002675 Ga0068871_1000026755 285
513 3300006844 Ga0075428_100322682 Ga0075428_1003226822 285
514 3300006871 Ga0075434_100000731 Ga0075434_1000007319 285
515 3300006881 Ga0068865_100079374 Ga0068865_1000793742 285
516 3300006881 Ga0068865_100196771 Ga0068865_1001967712 285
517 3300006881 Ga0068865_100411148 Ga0068865_1004111481 285
518 3300006914 Ga0075436_100029447 Ga0075436_1000294475 285
519 3300006931 Ga0097620_100076008 Ga0097620_1000760083 285
520 3300007076 Ga0075435_100015716 Ga0075435_1000157166 285
521 3300009093 Ga0105240_10558426 Ga0105240_105584262 285
522 3300009147 Ga0114129_10233471 Ga0114129_102334712 285
523 3300009176 Ga0105242_10026694 Ga0105242_100266943 285
524 3300009176 Ga0105242_10046424 Ga0105242_100464243 285
525 3300009176 Ga0105242_10166914 Ga0105242_101669142 285
526 3300009176 Ga0105242_10626399 Ga0105242_106263991 285
527 3300009177 Ga0105248_10036959 Ga0105248_100369593 285
528 3300009177 Ga0105248_10098891 Ga0105248_100988912 285
529 3300013308 Ga0157375_10261724 Ga0157375_102617242 285
530 3300014326 Ga0157380_10037774 Ga0157380_100377742 285
531 3300014968 Ga0157379_10033107 Ga0157379_100331074 285
532 3300014969 Ga0157376_10019635 Ga0157376_100196355 285
533 3300014969 Ga0157376_10036751 Ga0157376_100367514 285
534 3300014969 Ga0157376_10144372 Ga0157376_101443722 285
535 3300025899 Ga0207642_10019615 Ga0207642_100196152 285
536 3300025903 Ga0207680_10100316 Ga0207680_101003162 285
537 3300025918 Ga0207662_10072333 Ga0207662_100723332 285
538 3300025921 Ga0207652_10196227 Ga0207652_101962272 285
539 3300025923 Ga0207681_10361668 Ga0207681_103616682 285
540 3300025926 Ga0207659_10000076 Ga0207659_1000007658 285
541 3300025927 Ga0207687_10008761 Ga0207687_100087614 285
542 3300025928 Ga0207700_10036920 Ga0207700_100369204 285
543 3300025929 Ga0207664_10076262 Ga0207664_100762622 285
544 3300025931 Ga0207644_10380629 Ga0207644_103806292 285
545 3300025933 Ga0207706_10105559 Ga0207706_101055592 285
546 3300025934 Ga0207686_10049941 Ga0207686_100499412 285
547 3300025934 Ga0207686_10054142 Ga0207686_100541422 285
548 3300025935 Ga0207709_10028376 Ga0207709_100283764 285
549 3300025936 Ga0207670_10373440 Ga0207670_103734401 285
550 3300025937 Ga0207669_10030630 Ga0207669_100306302 285
551 3300025937 Ga0207669_10058849 Ga0207669_100588492 285
552 3300025937 Ga0207669_10375172 Ga0207669_103751722 285
553 3300025938 Ga0207704_10045320 Ga0207704_100453203 285
554 3300025940 Ga0207691_10084145 Ga0207691_100841453 285
555 3300025940 Ga0207691_10087212 Ga0207691_100872123 285
556 3300025940 Ga0207691_10390183 Ga0207691_103901832 285
557 3300025941 Ga0207711_10100385 Ga0207711_101003853 285
558 3300025941 Ga0207711_10129375 Ga0207711_101293752 285
559 3300025942 Ga0207689_10067106 Ga0207689_100671063 285
560 3300025960 Ga0207651_10181184 Ga0207651_101811842 285
561 3300025961 Ga0207712_10249743 Ga0207712_102497432 285
562 3300026023 Ga0207677_10138745 Ga0207677_101387452 285
563 3300026041 Ga0207639_10597866 Ga0207639_105978661 285
564 3300026088 Ga0207641_10211034 Ga0207641_102110341 285
565 3300026089 Ga0207648_10024283 Ga0207648_100242837 285
566 3300026089 Ga0207648_10184678 Ga0207648_101846782 285
567 3300026089 Ga0207648_10496780 Ga0207648_104967802 285
568 3300026121 Ga0207683_10228387 Ga0207683_102283872 285
569 3300027907 Ga0207428_10018313 Ga0207428_100183133 285
570 3300028380 Ga0268265_10199289 Ga0268265_101992892 285
571 3300028380 Ga0268265_10227279 Ga0268265_102272792 285
572 3300028381 Ga0268264_10108713 Ga0268264_101087132 285
573 3300028381 Ga0268264_10133144 Ga0268264_101331443 285
574 3300028381 Ga0268264_10317624 Ga0268264_103176242 285
575 3300031995 Ga0307409_100043273 Ga0307409_1000432733 285
576 3300032005 Ga0307411_10157774 Ga0307411_101577742 285
577 3300035171 Ga0373946_0066593 Ga0373946_0066593_123_989 285
578 3300035691 Ga0373931_0098264 Ga0373931_0098264_14_880 285
579 3300035724 Ga0373933_0300647 Ga0373933_0300647_74_940 285
580 3300035725 Ga0373947_0155390 Ga0373947_0155390_237_1103 285
581 3300036401 Ga0373937_0061534 Ga0373937_0061534_1228_2094 285
582 3300037068 Ga0373925_0086098 Ga0373925_0086098_1287_2153 285
583 3300037068 Ga0373925_0140146 Ga0373925_0140146_515_1372 285
584 3300046472 Ga0495580_0164754 Ga0495580_0164754_22_924 285
585 3300046511 Ga0495608_0003061 Ga0495608_0003061_3487_4344 285
586 3300046516 Ga0495628_0032621 Ga0495628_0032621_2222_3079 285
587 3300046516 Ga0495628_0090587 Ga0495628_0090587_394_1260 285
588 3300046517 Ga0495630_0003233 Ga0495630_0003233_1484_2341 285
589 3300046522 Ga0495643_0005940 Ga0495643_0005940_566_1423 285
590 3300046529 Ga0495652_0105738 Ga0495652_0105738_1385_2242 285
591 3300046535 Ga0495586_0068635 Ga0495586_0068635_1033_1890 285
592 3300046558 Ga0495633_0117561 Ga0495633_0117561_19_882 285
593 3300046642 Ga0495634_0250667 Ga0495634_0250667_201_1058 285
594 3300046678 Ga0495599_0296464 Ga0495599_0296464_44_943 285
595 3300046683 Ga0495658_0038388 Ga0495658_0038388_134_991 285
596 3300046684 Ga0495669_0007871 Ga0495669_0007871_2237_3094 285
597 3300046689 Ga0495613_0001719 Ga0495613_0001719_15060_15917 285
598 3300047319 Ga0495674_0046339 Ga0495674_0046339_259_1116 285
599 3300047319 Ga0495674_0412679 Ga0495674_0412679_14_913 285
600 3300047471 Ga0495684_0000189 Ga0495684_0000189_45189_46046 285
601 3300048904 Ga0496101_0083968 Ga0496101_0083968_1218_2084 285
602 3300048915 Ga0496112_0056169 Ga0496112_0056169_1054_1920 285
603 3300050507 nmdc:mga05p37_296188_c1 nmdc:mga05p37_296188_c1_758_1666 285
604 3300050508 nmdc:mga09592_447066_c1 nmdc:mga09592_447066_c1_31_915 285
605 3300050512 nmdc:mga0n895_101653_c1 nmdc:mga0n895_101653_c1_1740_2648 285
606 3300050512 nmdc:mga0n895_228054_c1 nmdc:mga0n895_228054_c1_888_1760 285
607 3300050513 nmdc:mga0rr50_93444_c1 nmdc:mga0rr50_93444_c1_217_1125 285
608 3300050514 nmdc:mga08x19_9112_c1 nmdc:mga08x19_9112_c1_2772_3680 285
609 3300053077 Ga0495601_0026265 Ga0495601_0026265_1277_2134 285
610 3300053077 Ga0495601_0056226 Ga0495601_0056226_903_1802 285
611 3300053077 Ga0495601_0074765 Ga0495601_0074765_343_1209 285
612 3300053085 Ga0495619_0004868 Ga0495619_0004868_7554_8411 285
613 3300005295 Ga0065707_10000798 Ga0065707_100007983 286
614 3300005353 Ga0070669_100043051 Ga0070669_1000430513 286
615 3300005353 Ga0070669_100137527 Ga0070669_1001375272 286
616 3300005444 Ga0070694_100049731 Ga0070694_1000497312 286
617 3300005543 Ga0070672_100094880 Ga0070672_1000948802 286
618 3300005549 Ga0070704_100378791 Ga0070704_1003787912 286
619 3300005841 Ga0068863_100075448 Ga0068863_1000754482 286
620 3300005841 Ga0068863_100176568 Ga0068863_1001765683 286
621 3300005844 Ga0068862_100039812 Ga0068862_1000398122 286
622 3300005844 Ga0068862_100115564 Ga0068862_1001155642 286
623 3300005937 Ga0081455_10073814 Ga0081455_100738143 286
624 3300006051 Ga0075364_10052859 Ga0075364_100528592 286
625 3300006237 Ga0097621_100050591 Ga0097621_1000505912 286
626 3300006358 Ga0068871_100005949 Ga0068871_1000059494 286
627 3300006358 Ga0068871_100010750 Ga0068871_1000107505 286
628 3300006358 Ga0068871_100220821 Ga0068871_1002208212 286
629 3300006844 Ga0075428_100125903 Ga0075428_1001259033 286
630 3300006852 Ga0075433_10021172 Ga0075433_100211725 286
631 3300006871 Ga0075434_100055954 Ga0075434_1000559542 286
632 3300006871 Ga0075434_100213999 Ga0075434_1002139993 286
633 3300006914 Ga0075436_100001874 Ga0075436_10000187412 286
634 3300007076 Ga0075435_100000052 Ga0075435_10000005228 286
635 3300009094 Ga0111539_10006977 Ga0111539_100069777 286
636 3300009094 Ga0111539_10175052 Ga0111539_101750523 286
637 3300009147 Ga0114129_10000789 Ga0114129_1000078922 286
638 3300009147 Ga0114129_10022026 Ga0114129_100220264 286
639 3300009177 Ga0105248_10085756 Ga0105248_100857562 286
640 3300009545 Ga0105237_10163863 Ga0105237_101638633 286
641 3300009553 Ga0105249_10201704 Ga0105249_102017042 286
642 3300013308 Ga0157375_10504432 Ga0157375_105044322 286
643 3300014326 Ga0157380_10356277 Ga0157380_103562771 286
644 3300025905 Ga0207685_10073529 Ga0207685_100735292 286
645 3300025923 Ga0207681_10025744 Ga0207681_100257444 286
646 3300025923 Ga0207681_10110831 Ga0207681_101108312 286
647 3300025941 Ga0207711_10033049 Ga0207711_100330494 286
648 3300026035 Ga0207703_10046292 Ga0207703_100462922 286
649 3300026075 Ga0207708_10166396 Ga0207708_101663963 286
650 3300026088 Ga0207641_10002582 Ga0207641_100025827 286
651 3300026088 Ga0207641_10123881 Ga0207641_101238813 286
652 3300026089 Ga0207648_10209558 Ga0207648_102095582 286
653 3300027907 Ga0207428_10058479 Ga0207428_100584792 286
654 3300028380 Ga0268265_10016423 Ga0268265_100164232 286
655 3300028380 Ga0268265_10027810 Ga0268265_100278103 286
656 3300032002 Ga0307416_100218624 Ga0307416_1002186242 286
657 3300044712 Ga0453684_0089560 Ga0453684_0089560_196_1056 286
658 3300046459 Ga0495629_0286003 Ga0495629_0286003_137_1006 286
659 3300046472 Ga0495580_0079243 Ga0495580_0079243_293_1162 286
660 3300047315 Ga0495581_0154224 Ga0495581_0154224_368_1237 286
661 3300047320 Ga0495672_0099714 Ga0495672_0099714_263_1123 286
662 3300048907 Ga0496104_0484677 Ga0496104_0484677_111_986 286
663 3300048909 Ga0496106_0149327 Ga0496106_0149327_149_1030 286
664 3300049571 Ga0501034_0185918 Ga0501034_0185918_249_1109 286
665 3300049572 Ga0501036_0031898 Ga0501036_0031898_2295_3158 286
666 3300049577 Ga0501041_0041088 Ga0501041_0041088_1871_2734 286
667 3300049591 Ga0501075_0207427 Ga0501075_0207427_192_1052 286
668 3300049592 Ga0501076_0046145 Ga0501076_0046145_518_1381 286
669 3300049743 Ga0501081_0065096 Ga0501081_0065096_992_1855 286
670 3300049824 Ga0501045_0024604 Ga0501045_0024604_3362_4225 286
671 3300050491 nmdc:mga00v17_14970_c1 nmdc:mga00v17_14970_c1_2925_3785 286
672 3300050494 nmdc:mga06z11_48067_c1 nmdc:mga06z11_48067_c1_471_1331 286
673 3300050507 nmdc:mga05p37_14644_c2 nmdc:mga05p37_14644_c2_6562_7437 286
674 3300050507 nmdc:mga05p37_158217_c1 nmdc:mga05p37_158217_c1_913_1788 286
675 3300050507 nmdc:mga05p37_18668_c1 nmdc:mga05p37_18668_c1_4090_4965 286
676 3300050511 nmdc:mga08y16_26035_c1 nmdc:mga08y16_26035_c1_4378_5253 286
677 3300050512 nmdc:mga0n895_8_c1 nmdc:mga0n895_8_c1_112081_112953 286
678 3300050513 nmdc:mga0rr50_23_c1 nmdc:mga0rr50_23_c1_31999_32871 286
679 3300050514 nmdc:mga08x19_12493_c1 nmdc:mga08x19_12493_c1_348_1238 286
680 3300050514 nmdc:mga08x19_165_c1 nmdc:mga08x19_165_c1_22121_22993 286
681 3300050515 nmdc:mga0a205_41360_c1 nmdc:mga0a205_41360_c1_95_970 286
682 3300053085 Ga0495619_0301359 Ga0495619_0301359_182_1051 286
683 3300053139 Ga0500568_0008892 Ga0500568_0008892_3383_4243 286
684 3300060353 Ga0501082_0420906 Ga0501082_0420906_220_1083 286
685 3300061734 Ga0530510_0018199 Ga0530510_0018199_2081_2944 286
686 3300061734 Ga0530510_0092617 Ga0530510_0092617_420_1280 286
687 3300061734 Ga0530510_0126753 Ga0530510_0126753_995_1855 286
688 3300005441 Ga0070700_100018153 Ga0070700_1000181533 287
689 3300005844 Ga0068862_100448362 Ga0068862_1004483622 287
690 3300009147 Ga0114129_10187299 Ga0114129_101872993 287
691 3300014326 Ga0157380_10013458 Ga0157380_100134587 287
692 3300025937 Ga0207669_10411576 Ga0207669_104115762 287
693 3300026075 Ga0207708_10007104 Ga0207708_100071043 287
694 3300026121 Ga0207683_10342453 Ga0207683_103424532 287
695 3300035114 Ga0373939_0010136 Ga0373939_0010136_833_1696 287
696 3300042125 Ga0450923_006411 Ga0450923_006411_857_1720 287
697 3300049578 Ga0501042_0062972 Ga0501042_0062972_863_1726 287
698 3300049580 Ga0501046_0229602 Ga0501046_0229602_459_1322 287
699 3300049582 Ga0501048_0077509 Ga0501048_0077509_851_1714 287
700 3300049588 Ga0501072_0314510 Ga0501072_0314510_82_945 287
701 3300049592 Ga0501076_0036858 Ga0501076_0036858_633_1496 287
702 3300049741 Ga0501079_0426243 Ga0501079_0426243_154_1017 287
703 3300050507 nmdc:mga05p37_118376_c1 nmdc:mga05p37_118376_c1_1105_1968 287
704 3300050511 nmdc:mga08y16_280484_c1 nmdc:mga08y16_280484_c1_216_1079 287
705 3300050511 nmdc:mga08y16_616171_c1 nmdc:mga08y16_616171_c1_198_1061 287
706 3300050512 nmdc:mga0n895_66748_c1 nmdc:mga0n895_66748_c1_2176_3039 287
707 3300003203 JGI25406J46586_10009006 JGI25406J46586_100090064 288
708 3300005288 Ga0065714_10138713 Ga0065714_101387131 288
709 3300005290 Ga0065712_10001067 Ga0065712_100010676 288
710 3300005293 Ga0065715_10270509 Ga0065715_102705091 288
711 3300005295 Ga0065707_10284468 Ga0065707_102844682 288
712 3300005340 Ga0070689_100164729 Ga0070689_1001647292 288
713 3300005343 Ga0070687_100038685 Ga0070687_1000386853 288
714 3300005354 Ga0070675_100005236 Ga0070675_1000052367 288
715 3300005354 Ga0070675_100053786 Ga0070675_1000537863 288
716 3300005365 Ga0070688_100250071 Ga0070688_1002500711 288
717 3300005457 Ga0070662_100147453 Ga0070662_1001474532 288
718 3300005617 Ga0068859_100401924 Ga0068859_1004019242 288
719 3300006844 Ga0075428_100035422 Ga0075428_1000354223 288
720 3300006846 Ga0075430_100029567 Ga0075430_1000295675 288
721 3300006871 Ga0075434_100078644 Ga0075434_1000786441 288
722 3300006880 Ga0075429_100021887 Ga0075429_1000218876 288
723 3300006880 Ga0075429_100059596 Ga0075429_1000595964 288
724 3300006881 Ga0068865_100118849 Ga0068865_1001188492 288
725 3300006931 Ga0097620_100401942 Ga0097620_1004019422 288
726 3300009094 Ga0111539_10004422 Ga0111539_100044227 288
727 3300009094 Ga0111539_10008296 Ga0111539_100082969 288
728 3300009094 Ga0111539_10013117 Ga0111539_100131176 288
729 3300009094 Ga0111539_10248669 Ga0111539_102486692 288
730 3300009094 Ga0111539_10392133 Ga0111539_103921332 288
731 3300009147 Ga0114129_10306477 Ga0114129_103064773 288
732 3300009147 Ga0114129_10764197 Ga0114129_107641971 288
733 3300009177 Ga0105248_10781633 Ga0105248_107816332 288
734 3300013308 Ga0157375_11017378 Ga0157375_110173781 288
735 3300025901 Ga0207688_10038394 Ga0207688_100383942 288
736 3300025908 Ga0207643_10038629 Ga0207643_100386293 288
737 3300025918 Ga0207662_10011304 Ga0207662_100113044 288
738 3300025933 Ga0207706_10040920 Ga0207706_100409204 288
739 3300025936 Ga0207670_10028759 Ga0207670_100287593 288
740 3300025936 Ga0207670_10257510 Ga0207670_102575102 288
741 3300025942 Ga0207689_10106293 Ga0207689_101062932 288
742 3300025960 Ga0207651_10050157 Ga0207651_100501572 288
743 3300026088 Ga0207641_10360096 Ga0207641_103600961 288
744 3300026116 Ga0207674_10226012 Ga0207674_102260122 288
745 3300026121 Ga0207683_10026222 Ga0207683_100262224 288
746 3300027907 Ga0207428_10000400 Ga0207428_1000040020 288
747 3300028380 Ga0268265_10532082 Ga0268265_105320822 288
748 3300031995 Ga0307409_100130442 Ga0307409_1001304422 288
749 3300032005 Ga0307411_10356225 Ga0307411_103562252 288
750 3300046674 Ga0495588_0023407 Ga0495588_0023407_2016_2882 288
751 3300048912 Ga0496109_0036244 Ga0496109_0036244_3055_3942 288
752 3300049577 Ga0501041_0011415 Ga0501041_0011415_3993_4859 288
753 3300049578 Ga0501042_0096475 Ga0501042_0096475_1080_1946 288
754 3300049582 Ga0501048_0019805 Ga0501048_0019805_1868_2734 288
755 3300049588 Ga0501072_0055293 Ga0501072_0055293_18_884 288
756 3300049590 Ga0501074_0030646 Ga0501074_0030646_705_1571 288
757 3300049591 Ga0501075_0247947 Ga0501075_0247947_379_1245 288
758 3300049592 Ga0501076_0016675 Ga0501076_0016675_2262_3128 288
759 3300049593 Ga0501077_0214540 Ga0501077_0214540_143_1009 288
760 3300049741 Ga0501079_0017221 Ga0501079_0017221_2100_2966 288
761 3300049824 Ga0501045_0031651 Ga0501045_0031651_1978_2844 288
762 3300050507 nmdc:mga05p37_639316_c1 nmdc:mga05p37_639316_c1_67_954 288
763 3300050507 nmdc:mga05p37_83007_c1 nmdc:mga05p37_83007_c1_2944_3810 288
764 3300050508 nmdc:mga09592_21193_c1 nmdc:mga09592_21193_c1_607_1494 288
765 3300050508 nmdc:mga09592_21228_c1 nmdc:mga09592_21228_c1_3738_4604 288
766 3300050509 nmdc:mga0qj67_9878_c1 nmdc:mga0qj67_9878_c1_3590_4456 288
767 3300050510 nmdc:mga06r32_239846_c1 nmdc:mga06r32_239846_c1_199_1065 288
768 3300050511 nmdc:mga08y16_35677_c1 nmdc:mga08y16_35677_c1_72_938 288
769 3300050511 nmdc:mga08y16_389_c1 nmdc:mga08y16_389_c1_14270_15136 288
770 3300050511 nmdc:mga08y16_5683_c1 nmdc:mga08y16_5683_c1_7396_8283 288
771 3300050512 nmdc:mga0n895_61907_c1 nmdc:mga0n895_61907_c1_1905_2792 288
772 3300054114 Ga0501084_0038281 Ga0501084_0038281_1341_2207 288
773 3300061734 Ga0530510_0039134 Ga0530510_0039134_2188_3054 288

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

24

178

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7a0g-assembly1.cif.gz_DDD structure of the smhb pore of the tripartite alpha-pore forming toxin, smh, from serratia marcescens. 0.8384 224 279
4dec-assembly1.cif.gz_A-2 crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate (udp) and phosphoglyceric acid (pga) 0.8186 6 220
7pe4-assembly1.cif.gz_A-2 crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 in complex with udp-glucose 0.8177 6 220
7pdo-assembly1.cif.gz_A-2 crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 in complex with udp 0.8175 6 220
5jqx-assembly1.cif.gz_A crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with phosphoglyceric acid (pga) - gpgs*pga 0.8162 6 220
ID Description Score Start End Superfamily
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8678 4 218 3.90.550.10
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8567 4 218 3.90.550.10
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8553 2 218 3.90.550.10
af_P40350_49_327_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8432 3 218 3.90.550.10
af_Q58619_2_238_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8331 1 218 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A7C3D639-F1-model_v4 Glycosyltransferase family 2 protein 0.9795 6 103 GO:0016757
AF-A0A7C1P333-F1-model_v4 deleted 0.9472 7 284
AF-A0A661JIX6-F1-model_v4 Glycosyltransferase family 2 protein 0.9407 2 115 GO:0016757
AF-A0A2E8LG35-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.939 5 218
AF-A0A3M1DRI3-F1-model_v4 Glycosyltransferase family 2 protein 0.9333 7 173 GO:0016757

Feature Viewer

pLDDT pTM Quality
86.82 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map