F480180

General Info

Members Datasets Scaffolds Average Seq Length
773 317 1546 178

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0222261|Ga0466970_0222261_375_959
Length 194
Sequence VRRGSGEGGVTRKVRDMSIIRVHDKDFEPYLPAEQITKKIKEIAVRMDADYEGKKPLFVAILNGSFMFASDLFKSLTIEAEICFIKLASYKGTKSSGQVITAIGLDTDMHGRHVVILEDIVDTGKTLSEFLPQLEHQQPASLKIAALLHKPEATVYPISVDYLGFSVPNKFLLGYGLDYDGLGRNIPSIYKLVE

Samples

Sample ID Description Type Environment
1 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
106 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
108 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
109 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
172 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
175 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
176 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
177 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
178 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
191 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
192 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
193 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
194 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
195 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
196 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
197 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
198 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
199 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
200 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
201 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
202 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
203 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
206 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
207 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
208 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
209 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
212 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
213 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
214 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
215 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
216 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
217 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
220 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
221 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
222 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
223 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
226 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
227 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
228 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
229 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
230 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
231 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
232 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
237 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
252 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
260 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
261 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
262 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
268 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
272 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
273 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
274 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
275 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
276 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
277 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
278 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
279 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
280 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
281 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
282 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
283 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
284 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
285 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
286 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
287 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
288 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
289 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
290 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
291 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
292 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
293 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
294 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
295 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
296 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
297 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
298 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
299 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
301 2738541278 Niastella sp. CF465 Isolate Unclassified
302 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
303 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
304 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
305 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
306 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
307 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
308 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
309 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
310 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
311 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
312 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
313 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
314 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
315 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
316 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
317 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.67
Metatranscriptomes 0.13
Isolates 2.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.48
Nodule 0
Rhizoplane 1.68
Rhizosphere 80.6
Stem 0
Stem Tuber 0
Unclassified 15.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466970_0222261 3300044765 Bacteria 1054
2 CNXas_1006850 3300000545 Bacteria 804
3 JGI24739J22299_10007316 3300001989 Unclassified 4145
4 JGI24743J22301_10078264 3300001991 Bacteria 696
5 JGI25154J39366_1000004 3300002738 Bacteria 346460
6 JGI25157J39369_1012508 3300002741 Bacteria 1078
7 JGI25153J46596_10002511 3300003215 Bacteria 10532
8 JGI25153J46596_10016838 3300003215 Bacteria 2908
9 rootH1_10052946 3300003316 Bacteria 4683
10 rootH1_10097560 3300003316 Bacteria 3727
11 rootH2_10009025 3300003320 Bacteria 27408
12 rootH2_10049413 3300003320 Bacteria 18448
13 rootH2_10082932 3300003320 Bacteria 3347
14 rootH2_10088799 3300003320 Bacteria 3837
15 rootL2_10002103 3300003322 Bacteria 5592
16 rootL2_10118243 3300003322 Bacteria 3173
17 rootL2_10161687 3300003322 Bacteria 4293
18 rootL2_10190022 3300003322 Bacteria 2580
19 rootL2_10316744 3300003322 Unclassified 2216
20 rootH1_10005517 3300003323 Bacteria 4511
21 rootH1_10044609 3300003323 Bacteria 6762
22 rootH1_10097553 3300003323 Bacteria 3525
23 rootH1_10136237 3300003323 Bacteria 2039
24 rootH1_10219635 3300003323 Bacteria 2383
25 JGI25160J50197_1004814 3300003354 Bacteria 5756
26 JGI25160J50197_1007518 3300003354 Bacteria 4254
27 Ga0055542_1006351 3300003762 Bacteria 2537
28 Ga0055528_1000663 3300003790 Bacteria 25012
29 Ga0055530_10002672 3300003791 Bacteria 11124
30 Ga0055531_10000171 3300003794 Bacteria 73046
31 Ga0065165_1000503 3300005262 Bacteria 60427
32 Ga0065165_1004318 3300005262 Bacteria 8935
33 Ga0065165_1063152 3300005262 Bacteria 1007
34 Ga0065704_10174357 3300005289 Bacteria 1273
35 Ga0065712_10142270 3300005290 Unclassified 1439
36 Ga0065712_10149970 3300005290 Bacteria 1377
37 Ga0065715_10291611 3300005293 Bacteria 1062
38 Ga0070658_10000526 3300005327 Bacteria 33186
39 Ga0070658_10016658 3300005327 Bacteria 5883
40 Ga0070658_10596992 3300005327 Bacteria 957
41 Ga0070676_10006484 3300005328 Bacteria 6252
42 Ga0070683_100078858 3300005329 Bacteria 3082
43 Ga0070683_100218468 3300005329 Unclassified 1811
44 Ga0070670_100056311 3300005331 Unclassified 3374
45 Ga0070670_100097783 3300005331 Bacteria 2525
46 Ga0070670_100102345 3300005331 Bacteria 2467
47 Ga0070670_100105346 3300005331 Bacteria 2430
48 Ga0070670_100106421 3300005331 Bacteria 2417
49 Ga0070670_101315574 3300005331 Bacteria 662
50 Ga0068869_100052369 3300005334 Bacteria 2964
51 Ga0068869_100095978 3300005334 Unclassified 2237
52 Ga0068869_100498591 3300005334 Bacteria 1016
53 Ga0068869_100823745 3300005334 Bacteria 799
54 Ga0070666_10000165 3300005335 Bacteria 45323
55 Ga0070666_10005184 3300005335 Bacteria 7981
56 Ga0070666_10110656 3300005335 Unclassified 1899
57 Ga0070666_10231958 3300005335 Bacteria 1304
58 Ga0070666_10288128 3300005335 Bacteria 1168
59 Ga0070680_100000079 3300005336 Bacteria 52745
60 Ga0070682_100000037 3300005337 Bacteria 147526
61 Ga0070682_100059539 3300005337 Bacteria 2413
62 Ga0070682_100111418 3300005337 Bacteria 1824
63 Ga0068868_100000064 3300005338 Bacteria 61762
64 Ga0068868_100013122 3300005338 Bacteria 6068
65 Ga0068868_100016798 3300005338 Bacteria 5443
66 Ga0068868_100489735 3300005338 Bacteria 1075
67 Ga0070691_10001320 3300005341 Bacteria 10540
68 Ga0070668_100005340 3300005347 Bacteria 9541
69 Ga0070668_101341578 3300005347 Bacteria 651
70 Ga0070675_100077152 3300005354 Bacteria 2773
71 Ga0070671_100014859 3300005355 Bacteria 6289
72 Ga0070671_100154150 3300005355 Unclassified 1941
73 Ga0070671_100213266 3300005355 Unclassified 1638
74 Ga0070671_100298392 3300005355 Bacteria 1372
75 Ga0070671_100484050 3300005355 Bacteria 1063
76 Ga0070671_101169732 3300005355 Unclassified 676
77 Ga0070673_100000225 3300005364 Bacteria 28328
78 Ga0070673_100066236 3300005364 Unclassified 2885
79 Ga0070673_100640124 3300005364 Unclassified 972
80 Ga0070659_100135562 3300005366 Bacteria 2002
81 Ga0070667_100000557 3300005367 Bacteria 36978
82 Ga0070667_100012935 3300005367 Bacteria 6899
83 Ga0070667_100069557 3300005367 Bacteria 2996
84 Ga0070667_100098632 3300005367 Unclassified 2521
85 Ga0070667_100146966 3300005367 Bacteria 2068
86 Ga0070667_100440041 3300005367 Bacteria 1190
87 Ga0070667_100479913 3300005367 Bacteria 1138
88 Ga0070663_101007672 3300005455 Bacteria 724
89 Ga0070678_100332182 3300005456 Unclassified 1301
90 Ga0070678_100422086 3300005456 Bacteria 1163
91 Ga0070662_100014952 3300005457 Bacteria 5190
92 Ga0070681_10026471 3300005458 Bacteria 5828
93 Ga0070681_10039494 3300005458 Bacteria 4731
94 Ga0068867_100002721 3300005459 Bacteria 12472
95 Ga0068867_100155730 3300005459 Bacteria 1798
96 Ga0068867_100844266 3300005459 Unclassified 820
97 Ga0068867_100993992 3300005459 Unclassified 760
98 Ga0068867_101140596 3300005459 Bacteria 713
99 Ga0070685_10094145 3300005466 Unclassified 1819
100 Ga0070707_100482598 3300005468 Bacteria 1201
101 Ga0070698_101251224 3300005471 Bacteria 692
102 Ga0070699_100405290 3300005518 Bacteria 1233
103 Ga0070679_100015634 3300005530 Bacteria 7294
104 Ga0070684_100000916 3300005535 Bacteria 20926
105 Ga0068853_100002721 3300005539 Bacteria 13351
106 Ga0068853_100013829 3300005539 Bacteria 6597
107 Ga0068853_100044966 3300005539 Bacteria 3781
108 Ga0068853_100047572 3300005539 Bacteria 3681
109 Ga0068853_100077605 3300005539 Bacteria 2902
110 Ga0068853_100120463 3300005539 Bacteria 2340
111 Ga0068853_100148886 3300005539 Unclassified 2106
112 Ga0068853_100220163 3300005539 Bacteria 1733
113 Ga0068853_100279812 3300005539 Unclassified 1538
114 Ga0070672_100000052 3300005543 Bacteria 51529
115 Ga0070672_100042644 3300005543 Bacteria 3494
116 Ga0070672_100173215 3300005543 Bacteria 1795
117 Ga0070686_100316532 3300005544 Bacteria 1162
118 Ga0070693_100827059 3300005547 Unclassified 688
119 Ga0070665_100000001 3300005548 Bacteria 1083363
120 Ga0070665_100000903 3300005548 Bacteria 38097
121 Ga0068855_100000210 3300005563 Bacteria 74786
122 Ga0068855_100019394 3300005563 Bacteria 8171
123 Ga0068855_100084561 3300005563 Bacteria 3673
124 Ga0068855_100135938 3300005563 Bacteria 2805
125 Ga0068855_100191869 3300005563 Unclassified 2304
126 Ga0068855_100464613 3300005563 Bacteria 1379
127 Ga0068855_100777592 3300005563 Bacteria 1019
128 Ga0070664_100017672 3300005564 Bacteria 5856
129 Ga0070664_100093595 3300005564 Unclassified 2604
130 Ga0070664_100107927 3300005564 Bacteria 2427
131 Ga0070664_100390039 3300005564 Bacteria 1272
132 Ga0070664_100695736 3300005564 Bacteria 947
133 Ga0068857_100140977 3300005577 Bacteria 2179
134 Ga0068857_100244652 3300005577 Bacteria 1643
135 Ga0068857_100797522 3300005577 Unclassified 902
136 Ga0068857_100866758 3300005577 Bacteria 865
137 Ga0068854_100020995 3300005578 Bacteria 4426
138 Ga0068854_100058792 3300005578 Bacteria 2777
139 Ga0068854_100151850 3300005578 Bacteria 1787
140 Ga0068854_100541747 3300005578 Bacteria 986
141 Ga0068854_100800855 3300005578 Bacteria 821
142 Ga0068854_101025771 3300005578 Bacteria 732
143 Ga0068856_100041773 3300005614 Bacteria 4508
144 Ga0068856_100171762 3300005614 Bacteria 2180
145 Ga0068856_100399315 3300005614 Unclassified 1394
146 Ga0070702_100000948 3300005615 Bacteria 11383
147 Ga0068852_100006110 3300005616 Bacteria 8682
148 Ga0068852_100098925 3300005616 Bacteria 2628
149 Ga0068852_100196692 3300005616 Bacteria 1906
150 Ga0068852_100586514 3300005616 Bacteria 1118
151 Ga0068852_101049235 3300005616 Unclassified 834
152 Ga0068852_101138078 3300005616 Bacteria 801
153 Ga0068859_100000163 3300005617 Bacteria 64401
154 Ga0068859_100007600 3300005617 Bacteria 11015
155 Ga0068859_100137784 3300005617 Bacteria 2514
156 Ga0068859_100301301 3300005617 Bacteria 1696
157 Ga0068859_100564662 3300005617 Bacteria 1232
158 Ga0068864_100001080 3300005618 Bacteria 22832
159 Ga0068864_100006105 3300005618 Bacteria 9881
160 Ga0068864_100997685 3300005618 Bacteria 830
161 Ga0068866_10142289 3300005718 Bacteria 1378
162 Ga0068861_100013360 3300005719 Bacteria 5747
163 Ga0068851_10003337 3300005834 Bacteria 7137
164 Ga0068851_10009207 3300005834 Bacteria 4584
165 Ga0068851_10067607 3300005834 Bacteria 1843
166 Ga0068851_10229395 3300005834 Bacteria 1046
167 Ga0068863_100000281 3300005841 Bacteria 52492
168 Ga0068863_100000696 3300005841 Bacteria 33755
169 Ga0068863_100042175 3300005841 Bacteria 4335
170 Ga0068863_100083239 3300005841 Unclassified 3032
171 Ga0068863_100200341 3300005841 Bacteria 1920
172 Ga0068863_100986875 3300005841 Bacteria 845
173 Ga0068858_100001379 3300005842 Bacteria 25066
174 Ga0068858_100006245 3300005842 Bacteria 11609
175 Ga0068858_100072999 3300005842 Unclassified 3185
176 Ga0068860_100000004 3300005843 Bacteria 506126
177 Ga0068860_100004472 3300005843 Bacteria 14264
178 Ga0068860_100005091 3300005843 Bacteria 13370
179 Ga0068860_100007805 3300005843 Bacteria 10687
180 Ga0068860_100035187 3300005843 Bacteria 4805
181 Ga0068860_100260531 3300005843 Bacteria 1690
182 Ga0068860_100339768 3300005843 Bacteria 1476
183 Ga0068860_100837624 3300005843 Unclassified 934
184 Ga0068860_101424780 3300005843 Bacteria 714
185 Ga0068862_100082495 3300005844 Bacteria 2790
186 Ga0068862_100467725 3300005844 Bacteria 1191
187 Ga0068862_100851186 3300005844 Unclassified 894
188 Ga0081455_10418787 3300005937 Bacteria 924
189 Ga0081540_1012938 3300005983 Bacteria 5452
190 Ga0075366_10003749 3300006195 Bacteria 8077
191 Ga0075366_10528628 3300006195 Bacteria 730
192 Ga0097621_100001082 3300006237 Bacteria 19034
193 Ga0097621_100012160 3300006237 Bacteria 6371
194 Ga0097621_100024579 3300006237 Bacteria 4706
195 Ga0097621_100072652 3300006237 Bacteria 2846
196 Ga0097621_100089110 3300006237 Bacteria 2579
197 Ga0097621_100162038 3300006237 Bacteria 1923
198 Ga0097621_100224101 3300006237 Unclassified 1639
199 Ga0097621_100688198 3300006237 Bacteria 941
200 Ga0097621_100823426 3300006237 Bacteria 861
201 Ga0068871_100000076 3300006358 Bacteria 55186
202 Ga0068871_100001571 3300006358 Bacteria 15344
203 Ga0068871_100014842 3300006358 Bacteria 5819
204 Ga0068871_100016263 3300006358 Bacteria 5597
205 Ga0068871_100256799 3300006358 Bacteria 1523
206 Ga0068871_100493263 3300006358 Bacteria 1103
207 Ga0068871_101748345 3300006358 Unclassified 590
208 Ga0068865_100002600 3300006881 Bacteria 10725
209 Ga0068865_100043619 3300006881 Bacteria 3066
210 Ga0068865_100046501 3300006881 Unclassified 2978
211 Ga0068865_100869262 3300006881 Bacteria 782
212 Ga0097620_100000163 3300006931 Bacteria 64401
213 Ga0097620_100007600 3300006931 Bacteria 11015
214 Ga0097620_100137784 3300006931 Bacteria 2514
215 Ga0097620_100301290 3300006931 Bacteria 1696
216 Ga0097620_100564692 3300006931 Bacteria 1232
217 Ga0105240_10000061 3300009093 Bacteria 218897
218 Ga0105240_10000087 3300009093 Bacteria 187637
219 Ga0105240_10001401 3300009093 Bacteria 41397
220 Ga0105240_10004570 3300009093 Bacteria 20988
221 Ga0105240_10012560 3300009093 Bacteria 11682
222 Ga0105240_10021348 3300009093 Bacteria 8613
223 Ga0105240_10037251 3300009093 Bacteria 6252
224 Ga0105240_10229541 3300009093 Bacteria 2158
225 Ga0105240_10492485 3300009093 Bacteria 1364
226 Ga0105240_10533042 3300009093 Bacteria 1301
227 Ga0105240_10638222 3300009093 Unclassified 1169
228 Ga0105240_11238485 3300009093 Bacteria 789
229 Ga0111539_11462533 3300009094 Bacteria 792
230 Ga0105245_10137294 3300009098 Bacteria 2299
231 Ga0105247_10030304 3300009101 Bacteria 3278
232 Ga0105247_10055978 3300009101 Unclassified 2435
233 Ga0114129_10383048 3300009147 Bacteria 1857
234 Ga0105241_10000776 3300009174 Bacteria 24269
235 Ga0105241_10001165 3300009174 Bacteria 20006
236 Ga0105241_10002324 3300009174 Bacteria 14278
237 Ga0105241_10021855 3300009174 Bacteria 4735
238 Ga0105241_10032888 3300009174 Bacteria 3890
239 Ga0105241_10159399 3300009174 Unclassified 1853
240 Ga0105241_10309581 3300009174 Unclassified 1358
241 Ga0105242_10031097 3300009176 Bacteria 4262
242 Ga0105242_10102408 3300009176 Bacteria 2428
243 Ga0105248_10081319 3300009177 Bacteria 3641
244 Ga0105248_10124603 3300009177 Bacteria 2907
245 Ga0105237_10000377 3300009545 Bacteria 63580
246 Ga0105237_10003363 3300009545 Bacteria 19043
247 Ga0105237_10003655 3300009545 Bacteria 18145
248 Ga0105237_10006545 3300009545 Bacteria 12887
249 Ga0105237_10008725 3300009545 Bacteria 10946
250 Ga0105237_10023189 3300009545 Bacteria 6362
251 Ga0105237_10032771 3300009545 Bacteria 5261
252 Ga0105237_10100761 3300009545 Bacteria 2880
253 Ga0105237_10103591 3300009545 Unclassified 2838
254 Ga0105237_10147269 3300009545 Bacteria 2350
255 Ga0105237_10179821 3300009545 Bacteria 2115
256 Ga0105237_10506697 3300009545 Bacteria 1214
257 Ga0105237_10605405 3300009545 Unclassified 1103
258 Ga0105237_10644038 3300009545 Unclassified 1066
259 Ga0105237_10734961 3300009545 Bacteria 993
260 Ga0105237_10972953 3300009545 Unclassified 855
261 Ga0105238_10000725 3300009551 Bacteria 34423
262 Ga0105238_10077843 3300009551 Unclassified 3307
263 Ga0105238_10321410 3300009551 Bacteria 1534
264 Ga0105238_10335318 3300009551 Bacteria 1500
265 Ga0105238_10500504 3300009551 Unclassified 1216
266 Ga0105238_11203939 3300009551 Bacteria 782
267 Ga0105249_10001077 3300009553 Bacteria 24238
268 Ga0105249_10006543 3300009553 Bacteria 10137
269 Ga0105249_10216258 3300009553 Bacteria 1883
270 Ga0105249_10227559 3300009553 Bacteria 1838
271 Ga0105249_11620739 3300009553 Unclassified 720
272 Ga0105239_10000029 3300010375 Bacteria 234749
273 Ga0105239_10000122 3300010375 Bacteria 109167
274 Ga0105239_10002610 3300010375 Bacteria 22800
275 Ga0105239_10003762 3300010375 Bacteria 18452
276 Ga0105239_10020310 3300010375 Bacteria 7327
277 Ga0105239_10030473 3300010375 Bacteria 5930
278 Ga0105239_10057406 3300010375 Unclassified 4269
279 Ga0105239_10075981 3300010375 Bacteria 3694
280 Ga0105239_10143397 3300010375 Bacteria 2663
281 Ga0105239_10220534 3300010375 Bacteria 2127
282 Ga0105239_10690100 3300010375 Bacteria 1167
283 Ga0105246_10286815 3300011119 Unclassified 1323
284 Ga0157373_10030712 3300013100 Bacteria 3866
285 Ga0157373_10107677 3300013100 Bacteria 1960
286 Ga0157371_10021734 3300013102 Bacteria 4708
287 Ga0157371_10496130 3300013102 Bacteria 901
288 Ga0157370_10004831 3300013104 Bacteria 15322
289 Ga0157370_10008901 3300013104 Bacteria 10786
290 Ga0157370_10010136 3300013104 Bacteria 9951
291 Ga0157370_10022162 3300013104 Bacteria 6324
292 Ga0157370_10634682 3300013104 Bacteria 977
293 Ga0157369_10041773 3300013105 Bacteria 5005
294 Ga0157369_10098769 3300013105 Bacteria 3112
295 Ga0157369_10187806 3300013105 Unclassified 2172
296 Ga0157369_10202195 3300013105 Bacteria 2085
297 Ga0157374_10000001 3300013296 Bacteria 1077351
298 Ga0157374_10000399 3300013296 Bacteria 39374
299 Ga0157374_10033808 3300013296 Bacteria 4667
300 Ga0157374_10120836 3300013296 Bacteria 2528
301 Ga0157374_10365623 3300013296 Unclassified 1435
302 Ga0157374_10474019 3300013296 Bacteria 1254
303 Ga0157378_10005736 3300013297 Bacteria 10871
304 Ga0157378_10011030 3300013297 Bacteria 7909
305 Ga0157378_10016461 3300013297 Bacteria 6476
306 Ga0157378_10018702 3300013297 Bacteria 6090
307 Ga0157378_10059428 3300013297 Bacteria 3411
308 Ga0157378_10271589 3300013297 Bacteria 1631
309 Ga0157378_10553141 3300013297 Bacteria 1156
310 Ga0157378_10560931 3300013297 Bacteria 1149
311 Ga0157378_11387574 3300013297 Bacteria 745
312 Ga0163162_10000170 3300013306 Bacteria 60233
313 Ga0163162_10000214 3300013306 Bacteria 53543
314 Ga0163162_10000365 3300013306 Bacteria 41027
315 Ga0163162_10000461 3300013306 Bacteria 37669
316 Ga0163162_10000785 3300013306 Bacteria 29535
317 Ga0163162_10003791 3300013306 Bacteria 14497
318 Ga0163162_10017550 3300013306 Bacteria 7004
319 Ga0163162_10045357 3300013306 Bacteria 4404
320 Ga0163162_10128351 3300013306 Bacteria 2643
321 Ga0163162_10174203 3300013306 Bacteria 2276
322 Ga0163162_10979074 3300013306 Bacteria 956
323 Ga0163162_12059746 3300013306 Unclassified 654
324 Ga0157372_10000255 3300013307 Bacteria 58805
325 Ga0157372_10003905 3300013307 Bacteria 16022
326 Ga0157372_10058406 3300013307 Bacteria 4312
327 Ga0157372_10062274 3300013307 Bacteria 4180
328 Ga0157372_10112198 3300013307 Unclassified 3124
329 Ga0157372_10181550 3300013307 Bacteria 2436
330 Ga0157372_10189128 3300013307 Bacteria 2384
331 Ga0157375_10000125 3300013308 Bacteria 75607
332 Ga0157375_10000450 3300013308 Bacteria 37191
333 Ga0157375_10076314 3300013308 Unclassified 3378
334 Ga0157375_10106887 3300013308 Bacteria 2891
335 Ga0157375_10387995 3300013308 Unclassified 1563
336 Ga0157375_10526534 3300013308 Bacteria 1345
337 Ga0157375_11756438 3300013308 Bacteria 735
338 Ga0163163_10000281 3300014325 Bacteria 50719
339 Ga0163163_10000761 3300014325 Bacteria 27429
340 Ga0163163_10278215 3300014325 Bacteria 1725
341 Ga0163163_10714526 3300014325 Unclassified 1066
342 Ga0163163_11100747 3300014325 Bacteria 857
343 Ga0163163_11397439 3300014325 Bacteria 762
344 Ga0157377_10617100 3300014745 Bacteria 776
345 Ga0157379_10000107 3300014968 Bacteria 57370
346 Ga0157379_10027995 3300014968 Bacteria 5016
347 Ga0157379_10133735 3300014968 Bacteria 2234
348 Ga0157379_10947873 3300014968 Bacteria 818
349 Ga0157376_10000336 3300014969 Bacteria 31351
350 Ga0157376_10002516 3300014969 Bacteria 12416
351 Ga0157376_10002763 3300014969 Bacteria 11980
352 Ga0157376_10030967 3300014969 Bacteria 4278
353 Ga0157376_10215890 3300014969 Bacteria 1774
354 Ga0157376_10327012 3300014969 Bacteria 1459
355 Ga0157376_10506707 3300014969 Bacteria 1187
356 Ga0157376_10568200 3300014969 Bacteria 1124
357 Ga0182005_1000040 3300015265 Bacteria 151222
358 Ga0163161_10000612 3300017792 Bacteria 28547
359 Ga0163161_10058150 3300017792 Bacteria 2810
360 Ga0163161_10307145 3300017792 Bacteria 1251
361 Ga0213876_10001420 3300021384 Bacteria 14922
362 Ga0213876_10009849 3300021384 Bacteria 5142
363 Ga0209436_101069 3300025208 Bacteria 10358
364 Ga0209258_100075 3300025242 Bacteria 270751
365 Ga0209646_1000025 3300025246 Bacteria 406493
366 Ga0209646_1002484 3300025246 Bacteria 4057
367 Ga0209026_1000189 3300025250 Bacteria 89924
368 Ga0209148_1000085 3300025254 Bacteria 265193
369 Ga0209673_1000197 3300025273 Bacteria 121313
370 Ga0209130_1000540 3300025284 Bacteria 38066
371 Ga0209564_1007802 3300025295 Bacteria 5433
372 Ga0209758_1004263 3300025297 Bacteria 12084
373 Ga0209758_1020046 3300025297 Bacteria 3185
374 Ga0209758_1063479 3300025297 Bacteria 1203
375 Ga0209050_1000204 3300025298 Bacteria 133087
376 Ga0207426_1000057 3300025302 Bacteria 369548
377 Ga0207426_1000332 3300025302 Bacteria 89192
378 Ga0207426_1000647 3300025302 Bacteria 43103
379 Ga0207426_1039109 3300025302 Bacteria 1489
380 Ga0209051_1016604 3300025303 Bacteria 3322
381 Ga0209257_1000004 3300025304 Bacteria 1678347
382 Ga0209257_1001318 3300025304 Bacteria 30201
383 Ga0207656_10004885 3300025321 Bacteria 4705
384 Ga0207656_10018454 3300025321 Unclassified 2748
385 Ga0207656_10043748 3300025321 Unclassified 1910
386 Ga0207682_10080003 3300025893 Bacteria 1399
387 Ga0207710_10031433 3300025900 Bacteria 2321
388 Ga0207688_10011763 3300025901 Bacteria 4760
389 Ga0207680_10000068 3300025903 Bacteria 45911
390 Ga0207680_10003265 3300025903 Bacteria 7637
391 Ga0207680_10076220 3300025903 Unclassified 2094
392 Ga0207647_10000717 3300025904 Bacteria 25975
393 Ga0207647_10030100 3300025904 Bacteria 3506
394 Ga0207645_10001517 3300025907 Bacteria 18974
395 Ga0207705_10003407 3300025909 Bacteria 12089
396 Ga0207705_10132739 3300025909 Bacteria 1854
397 Ga0207654_10003625 3300025911 Bacteria 7788
398 Ga0207654_10004528 3300025911 Bacteria 7022
399 Ga0207654_10016709 3300025911 Bacteria 3825
400 Ga0207654_10142023 3300025911 Bacteria 1532
401 Ga0207654_10240585 3300025911 Bacteria 1209
402 Ga0207707_10000186 3300025912 Bacteria 65484
403 Ga0207695_10000057 3300025913 Bacteria 376090
404 Ga0207695_10000459 3300025913 Bacteria 88603
405 Ga0207695_10000568 3300025913 Bacteria 75553
406 Ga0207695_10003746 3300025913 Bacteria 21140
407 Ga0207695_10010042 3300025913 Bacteria 11624
408 Ga0207695_10010077 3300025913 Bacteria 11604
409 Ga0207695_10013050 3300025913 Bacteria 9923
410 Ga0207695_10069434 3300025913 Bacteria 3605
411 Ga0207695_10138329 3300025913 Unclassified 2387
412 Ga0207695_10149243 3300025913 Bacteria 2278
413 Ga0207695_10588688 3300025913 Unclassified 994
414 Ga0207695_10607717 3300025913 Bacteria 974
415 Ga0207671_10000438 3300025914 Bacteria 57265
416 Ga0207671_10003201 3300025914 Bacteria 16484
417 Ga0207671_10003886 3300025914 Bacteria 14584
418 Ga0207671_10006029 3300025914 Bacteria 10946
419 Ga0207671_10008419 3300025914 Bacteria 8749
420 Ga0207671_10009693 3300025914 Bacteria 8021
421 Ga0207671_10032395 3300025914 Unclassified 3891
422 Ga0207671_10100497 3300025914 Bacteria 2190
423 Ga0207671_10123685 3300025914 Bacteria 1979
424 Ga0207671_10280458 3300025914 Bacteria 1314
425 Ga0207671_10418538 3300025914 Unclassified 1066
426 Ga0207671_10429607 3300025914 Bacteria 1051
427 Ga0207660_10001497 3300025917 Bacteria 15739
428 Ga0207662_10102497 3300025918 Bacteria 1775
429 Ga0207657_10735458 3300025919 Bacteria 765
430 Ga0207652_10002640 3300025921 Bacteria 15042
431 Ga0207652_10103818 3300025921 Bacteria 2513
432 Ga0207681_10463442 3300025923 Bacteria 1033
433 Ga0207694_10005144 3300025924 Bacteria 10096
434 Ga0207694_10012647 3300025924 Bacteria 6358
435 Ga0207694_10049911 3300025924 Bacteria 3239
436 Ga0207694_10148195 3300025924 Unclassified 1890
437 Ga0207650_10041236 3300025925 Bacteria 3381
438 Ga0207650_10095431 3300025925 Unclassified 2280
439 Ga0207650_10179981 3300025925 Bacteria 1684
440 Ga0207650_10550499 3300025925 Bacteria 967
441 Ga0207650_10595579 3300025925 Bacteria 929
442 Ga0207650_10652551 3300025925 Bacteria 887
443 Ga0207650_10847486 3300025925 Bacteria 775
444 Ga0207650_11181487 3300025925 Bacteria 651
445 Ga0207659_10279853 3300025926 Bacteria 1363
446 Ga0207644_10012876 3300025931 Bacteria 5561
447 Ga0207644_10024302 3300025931 Bacteria 4158
448 Ga0207644_10088974 3300025931 Bacteria 2298
449 Ga0207644_10104123 3300025931 Unclassified 2136
450 Ga0207644_10348455 3300025931 Bacteria 1202
451 Ga0207690_10514874 3300025932 Bacteria 969
452 Ga0207706_10028304 3300025933 Bacteria 5005
453 Ga0207706_10179897 3300025933 Bacteria 1857
454 Ga0207686_10055656 3300025934 Unclassified 2483
455 Ga0207686_10081205 3300025934 Bacteria 2116
456 Ga0207709_10350577 3300025935 Bacteria 1114
457 Ga0207669_11078510 3300025937 Unclassified 677
458 Ga0207704_10001241 3300025938 Bacteria 11372
459 Ga0207704_10015092 3300025938 Bacteria 3926
460 Ga0207704_10345580 3300025938 Bacteria 1156
461 Ga0207691_10000001 3300025940 Bacteria 220829
462 Ga0207691_10059647 3300025940 Bacteria 3469
463 Ga0207691_10915684 3300025940 Unclassified 734
464 Ga0207711_10976615 3300025941 Unclassified 786
465 Ga0207689_10001987 3300025942 Bacteria 19318
466 Ga0207689_10045397 3300025942 Unclassified 3633
467 Ga0207689_10295584 3300025942 Bacteria 1342
468 Ga0207661_10053648 3300025944 Bacteria 3227
469 Ga0207679_10063377 3300025945 Bacteria 2759
470 Ga0207679_10064138 3300025945 Bacteria 2745
471 Ga0207679_10622120 3300025945 Bacteria 975
472 Ga0207667_10000133 3300025949 Bacteria 112994
473 Ga0207667_10016999 3300025949 Bacteria 8205
474 Ga0207667_10021922 3300025949 Bacteria 7071
475 Ga0207667_10050811 3300025949 Bacteria 4373
476 Ga0207667_10081758 3300025949 Unclassified 3346
477 Ga0207667_10141097 3300025949 Bacteria 2481
478 Ga0207667_10229187 3300025949 Bacteria 1903
479 Ga0207667_10622970 3300025949 Unclassified 1086
480 Ga0207667_10696112 3300025949 Bacteria 1019
481 Ga0207651_10000927 3300025960 Bacteria 12937
482 Ga0207651_10040230 3300025960 Unclassified 3090
483 Ga0207651_10191884 3300025960 Bacteria 1630
484 Ga0207651_10638082 3300025960 Unclassified 934
485 Ga0207712_10016655 3300025961 Bacteria 4765
486 Ga0207712_10074171 3300025961 Unclassified 2456
487 Ga0207712_10189518 3300025961 Bacteria 1622
488 Ga0207712_10229528 3300025961 Unclassified 1489
489 Ga0207668_10004515 3300025972 Bacteria 8183
490 Ga0207668_10071386 3300025972 Unclassified 2480
491 Ga0207640_10044612 3300025981 Bacteria 2842
492 Ga0207640_10119279 3300025981 Bacteria 1886
493 Ga0207640_10409148 3300025981 Unclassified 1107
494 Ga0207658_10002225 3300025986 Bacteria 14396
495 Ga0207658_10030704 3300025986 Bacteria 3808
496 Ga0207658_10097378 3300025986 Unclassified 2296
497 Ga0207658_10218341 3300025986 Unclassified 1602
498 Ga0207658_10863776 3300025986 Unclassified 823
499 Ga0207677_10031471 3300026023 Unclassified 3398
500 Ga0207703_10000541 3300026035 Bacteria 38865
501 Ga0207703_10013325 3300026035 Bacteria 6407
502 Ga0207639_10010449 3300026041 Bacteria 6431
503 Ga0207639_10013895 3300026041 Bacteria 5647
504 Ga0207639_10015128 3300026041 Bacteria 5437
505 Ga0207639_10061396 3300026041 Bacteria 2903
506 Ga0207639_10076756 3300026041 Unclassified 2632
507 Ga0207639_10142609 3300026041 Bacteria 1998
508 Ga0207639_10224040 3300026041 Unclassified 1626
509 Ga0207639_10240071 3300026041 Bacteria 1575
510 Ga0207639_10304178 3300026041 Bacteria 1410
511 Ga0207639_10309906 3300026041 Bacteria 1398
512 Ga0207639_11214595 3300026041 Bacteria 708
513 Ga0207678_10156274 3300026067 Bacteria 1947
514 Ga0207702_10037878 3300026078 Bacteria 4038
515 Ga0207702_10099818 3300026078 Bacteria 2560
516 Ga0207702_10140155 3300026078 Bacteria 2187
517 Ga0207702_10440278 3300026078 Bacteria 1263
518 Ga0207641_10000176 3300026088 Bacteria 88863
519 Ga0207641_10020855 3300026088 Bacteria 5386
520 Ga0207641_10028806 3300026088 Bacteria 4591
521 Ga0207641_10369454 3300026088 Unclassified 1371
522 Ga0207641_10381008 3300026088 Bacteria 1351
523 Ga0207648_10002236 3300026089 Bacteria 20960
524 Ga0207648_10267431 3300026089 Unclassified 1527
525 Ga0207648_10402070 3300026089 Bacteria 1241
526 Ga0207648_10857483 3300026089 Unclassified 847
527 Ga0207648_10957274 3300026089 Bacteria 801
528 Ga0207648_11102928 3300026089 Unclassified 744
529 Ga0207648_11392437 3300026089 Bacteria 659
530 Ga0207676_10003381 3300026095 Bacteria 11283
531 Ga0207676_10056279 3300026095 Unclassified 3091
532 Ga0207676_10076300 3300026095 Bacteria 2708
533 Ga0207676_10369206 3300026095 Bacteria 1332
534 Ga0207674_10003956 3300026116 Bacteria 18014
535 Ga0207674_10134951 3300026116 Bacteria 2430
536 Ga0207674_10146596 3300026116 Bacteria 2319
537 Ga0207674_10809301 3300026116 Bacteria 904
538 Ga0207675_100011131 3300026118 Bacteria 8427
539 Ga0207683_10040207 3300026121 Bacteria 4079
540 Ga0207683_10267855 3300026121 Unclassified 1560
541 Ga0207683_10346391 3300026121 Bacteria 1363
542 Ga0207698_10173606 3300026142 Bacteria 1901
543 Ga0207698_10541785 3300026142 Bacteria 1139
544 Ga0207698_11084130 3300026142 Unclassified 813
545 Ga0268266_10000065 3300028379 Bacteria 246498
546 Ga0268266_10004508 3300028379 Bacteria 13311
547 Ga0268265_10138189 3300028380 Bacteria 2036
548 Ga0268264_10000011 3300028381 Bacteria 580884
549 Ga0268264_10002016 3300028381 Bacteria 18236
550 Ga0268264_10005470 3300028381 Bacteria 10768
551 Ga0268264_10011914 3300028381 Bacteria 7162
552 Ga0268264_10086984 3300028381 Bacteria 2686
553 Ga0268264_10191606 3300028381 Bacteria 1864
554 Ga0268264_10468491 3300028381 Bacteria 1223
555 Ga0268264_10651066 3300028381 Bacteria 1043
556 Ga0268264_10773221 3300028381 Unclassified 958
557 Ga0265337_1078310 3300028556 Bacteria 905
558 Ga0307517_10002935 3300028786 Bacteria 26992
559 Ga0307517_10229909 3300028786 Unclassified 1115
560 Ga0307515_10000002 3300028794 Bacteria 1231751
561 Ga0307515_10000107 3300028794 Bacteria 197046
562 Ga0307511_10000930 3300030521 Bacteria 30913
563 Ga0265327_10000148 3300031251 Bacteria 151952
564 Ga0265327_10009240 3300031251 Bacteria 7147
565 Ga0307513_10047118 3300031456 Bacteria 4692
566 Ga0307513_10150285 3300031456 Bacteria 2239
567 Ga0307513_10528508 3300031456 Bacteria 894
568 Ga0307513_10591996 3300031456 Bacteria 819
569 Ga0307509_10040553 3300031507 Bacteria 5064
570 Ga0307509_10101603 3300031507 Bacteria 2910
571 Ga0307509_10356072 3300031507 Unclassified 1185
572 Ga0265313_10051177 3300031595 Bacteria 1978
573 Ga0307516_10000944 3300031730 Bacteria 40084
574 Ga0307409_100101291 3300031995 Bacteria 2390
575 Ga0307414_10403293 3300032004 Bacteria 1188
576 Ga0307510_10004875 3300033180 Bacteria 15869
577 Ga0373943_0074867 3300035170 Unclassified 1723
578 Ga0373955_0536105 3300035172 Bacteria 716
579 Ga0373935_0400889 3300035692 Unclassified 985
580 Ga0373927_0037405 3300035695 Bacteria 3155
581 Ga0373937_0248875 3300036401 Bacteria 1675
582 Ga0373937_0914510 3300036401 Bacteria 826
583 Ga0373937_1481369 3300036401 Bacteria 626
584 Ga0373925_0503246 3300037068 Bacteria 995
585 Ga0436365_0180273 3300039437 Bacteria 11023
586 Ga0436365_0316569 3300039437 Bacteria 800
587 Ga0436365_0920295 3300039437 Bacteria 45426
588 Ga0439439_0000810 3300041406 Bacteria 5687
589 Ga0451795_0607167 3300041456 Bacteria 1298
590 Ga0451853_1580363 3300041512 Bacteria 1982
591 Ga0451853_1589815 3300041512 Bacteria 1407
592 Ga0451853_3965068 3300041512 Bacteria 2031
593 Ga0439431_0000493 3300041997 Bacteria 8352
594 Ga0439431_0087441 3300041997 Bacteria 846
595 Ga0439449_0011315 3300042007 Bacteria 3358
596 Ga0439449_0039835 3300042007 Bacteria 1747
597 Ga0439457_000066 3300042014 Bacteria 22683
598 Ga0439462_0005485 3300042015 Bacteria 3127
599 Ga0439434_0106645 3300042435 Bacteria 905
600 Ga0451577_0508365 3300042876 Unclassified 1094
601 Ga0466969_0000004 3300044656 Bacteria 168068
602 Ga0466969_0264517 3300044656 Unclassified 779
603 Ga0466972_0000017 3300044658 Bacteria 199884
604 Ga0466972_0008593 3300044658 Bacteria 5123
605 Ga0466972_0036057 3300044658 Bacteria 2421
606 Ga0466966_0000295 3300044684 Bacteria 32723
607 Ga0466966_0057735 3300044684 Unclassified 2454
608 Ga0466961_0083778 3300044693 Bacteria 2017
609 Ga0466964_0110189 3300044706 Bacteria 1226
610 Ga0453684_0007222 3300044712 Bacteria 20597
611 Ga0453684_0350822 3300044712 Bacteria 1664
612 Ga0466968_0018094 3300044735 Bacteria 2824
613 Ga0466968_0056743 3300044735 Bacteria 1683
614 Ga0466970_0047636 3300044765 Unclassified 2285
615 Ga0466957_0000760 3300044842 Bacteria 16415
616 Ga0466957_0049972 3300044842 Unclassified 2544
617 Ga0466960_0229387 3300044901 Bacteria 1024
618 Ga0466959_0000004 3300045049 Bacteria 216815
619 Ga0466959_0004206 3300045049 Bacteria 9589
620 Ga0466958_0034417 3300045836 Bacteria 3022
621 Ga0466967_0104447 3300045976 Bacteria 2594
622 Ga0495627_019703 3300046453 Bacteria 2257
623 Ga0495638_0015366 3300046460 Bacteria 5143
624 Ga0495638_0173362 3300046460 Bacteria 1236
625 Ga0495650_0031148 3300046471 Bacteria 2405
626 Ga0495650_0033688 3300046471 Bacteria 2277
627 Ga0495580_0056085 3300046472 Bacteria 2775
628 Ga0495639_0135047 3300046475 Unclassified 1183
629 Ga0495664_0122192 3300046477 Unclassified 1575
630 Ga0495606_0079825 3300046507 Bacteria 2037
631 Ga0495608_0335022 3300046511 Unclassified 933
632 Ga0495630_0126267 3300046517 Bacteria 1941
633 Ga0495632_0196590 3300046519 Bacteria 920
634 Ga0495648_0015274 3300046524 Bacteria 5584
635 Ga0495665_0324442 3300046531 Unclassified 786
636 Ga0495633_0000017 3300046558 Bacteria 249973
637 Ga0495633_0040974 3300046558 Bacteria 2204
638 Ga0495668_0000321 3300046616 Bacteria 65700
639 Ga0495668_0008554 3300046616 Bacteria 6374
640 Ga0495634_0214590 3300046642 Unclassified 1190
641 Ga0495611_0000021 3300046648 Bacteria 123657
642 Ga0495625_0016880 3300046660 Bacteria 5731
643 Ga0495625_0385957 3300046660 Unclassified 878
644 Ga0495625_0604034 3300046660 Unclassified 658
645 Ga0495646_0275272 3300046680 Bacteria 896
646 Ga0495647_0223937 3300046681 Unclassified 831
647 Ga0495613_0076208 3300046689 Bacteria 2441
648 Ga0495670_0019468 3300046691 Bacteria 3345
649 Ga0495600_0572303 3300046809 Bacteria 689
650 Ga0495674_0137385 3300047319 Unclassified 2056
651 Ga0495672_0044759 3300047320 Bacteria 2653
652 Ga0495672_0154754 3300047320 Bacteria 1185
653 Ga0495676_0628625 3300047321 Unclassified 698
654 Ga0495687_000006 3300047443 Bacteria 571936
655 Ga0495686_0000094 3300047472 Bacteria 187720
656 Ga0496100_0019465 3300048903 Bacteria 4051
657 Ga0496101_0064741 3300048904 Bacteria 2664
658 Ga0496102_0146727 3300048905 Bacteria 2215
659 Ga0496102_0248525 3300048905 Unclassified 1677
660 Ga0496104_0168150 3300048907 Unclassified 2103
661 Ga0496105_0510239 3300048908 Unclassified 943
662 Ga0496106_0152137 3300048909 Bacteria 1826
663 Ga0496108_0570406 3300048911 Bacteria 987
664 Ga0496109_0577778 3300048912 Bacteria 1059
665 Ga0496110_0220632 3300048913 Bacteria 1724
666 Ga0496114_0027530 3300048917 Unclassified 4657
667 Ga0496115_0028703 3300048918 Bacteria 4363
668 Ga0496121_0000010 3300048924 Bacteria 793488
669 Ga0496126_0018857 3300048929 Bacteria 6819
670 Ga0501300_026701 3300049523 Bacteria 848
671 Ga0501032_0045288 3300049569 Unclassified 2976
672 Ga0501033_0213273 3300049570 Bacteria 1376
673 Ga0501034_0003578 3300049571 Bacteria 17643
674 Ga0501034_0004335 3300049571 Bacteria 15811
675 Ga0501034_0005604 3300049571 Bacteria 13677
676 Ga0501034_0083863 3300049571 Bacteria 3189
677 Ga0501034_0220674 3300049571 Bacteria 1848
678 Ga0501034_0239107 3300049571 Bacteria 1762
679 Ga0501034_0467604 3300049571 Bacteria 1177
680 Ga0501037_0070932 3300049573 Unclassified 2535
681 Ga0501039_0649991 3300049575 Bacteria 826
682 Ga0501043_0108914 3300049579 Unclassified 2175
683 Ga0501047_0028890 3300049581 Bacteria 5349
684 Ga0501047_0044570 3300049581 Bacteria 4286
685 Ga0501047_0165516 3300049581 Unclassified 2082
686 Ga0501223_000312 3300049663 Bacteria 12052
687 Ga0501238_016463 3300049671 Bacteria 1025
688 Ga0501238_050383 3300049671 Bacteria 624
689 Ga0501219_000278 3300049703 Bacteria 9092
690 Ga0501225_0002394 3300049705 Bacteria 5791
691 Ga0501080_0111512 3300049742 Bacteria 2536
692 Ga0501080_0406706 3300049742 Bacteria 1224
693 Ga0501241_000755 3300049758 Bacteria 6963
694 Ga0501035_0201245 3300049822 Bacteria 1708
695 Ga0501035_0927534 3300049822 Unclassified 688
696 Ga0501044_0033488 3300049823 Bacteria 5400
697 Ga0501044_0052856 3300049823 Bacteria 4182
698 Ga0501044_0213032 3300049823 Bacteria 1885
699 Ga0501044_0530478 3300049823 Bacteria 1076
700 Ga0501044_0645088 3300049823 Bacteria 948
701 Ga0501284_00005 3300050005 Bacteria 164758
702 nmdc:mga0k408_32120_c1 3300050493 Bacteria 2999
703 nmdc:mga0k408_4366_c2 3300050493 Bacteria 3670
704 nmdc:mga05p37_101574_c1 3300050507 Bacteria 3541
705 Ga0495619_0041541 3300053085 Bacteria 3009
706 Ga0500578_0000814 3300053086 Bacteria 36228
707 Ga0500578_0029296 3300053086 Bacteria 3536
708 Ga0500578_0390778 3300053086 Bacteria 804
709 Ga0500644_0000233 3300053088 Bacteria 31422
710 Ga0500646_0033642 3300053090 Bacteria 1419
711 Ga0500646_0037946 3300053090 Bacteria 1347
712 Ga0500583_0000062 3300053092 Bacteria 67892
713 Ga0500583_0003491 3300053092 Bacteria 4950
714 Ga0500583_0018893 3300053092 Bacteria 2813
715 Ga0500583_0022594 3300053092 Bacteria 2637
716 Ga0500651_0079726 3300053093 Bacteria 2029
717 Ga0500651_0113014 3300053093 Bacteria 1656
718 Ga0500556_0042230 3300053104 Bacteria 1612
719 Ga0500556_0097226 3300053104 Bacteria 1131
720 Ga0500569_000386 3300053109 Bacteria 7142
721 Ga0500594_0085698 3300053118 Bacteria 949
722 Ga0500594_0117595 3300053118 Bacteria 832
723 Ga0500628_013038 3300053129 Bacteria 1544
724 Ga0500642_0021523 3300053130 Bacteria 2555
725 Ga0500652_017178 3300053131 Bacteria 2649
726 Ga0500655_007478 3300053133 Bacteria 1965
727 Ga0500658_0006742 3300053134 Bacteria 4248
728 Ga0500658_0152586 3300053134 Bacteria 1042
729 Ga0500658_0278522 3300053134 Bacteria 769
730 Ga0500559_0029668 3300053136 Unclassified 2343
731 Ga0500559_0033973 3300053136 Bacteria 2198
732 Ga0500559_0297002 3300053136 Bacteria 759
733 Ga0500561_0030505 3300053137 Bacteria 1355
734 Ga0500577_0000835 3300053142 Bacteria 7971
735 Ga0500577_0296508 3300053142 Bacteria 706
736 Ga0500588_0004802 3300053146 Bacteria 2952
737 Ga0500588_0070548 3300053146 Unclassified 1144
738 Ga0500589_027510 3300053147 Bacteria 2641
739 Ga0500603_015406 3300053150 Bacteria 1799
740 Ga0500604_0005577 3300053151 Bacteria 3322
741 Ga0500616_0032438 3300053153 Bacteria 2856
742 Ga0500619_047819 3300053154 Bacteria 1376
743 Ga0500622_0000319 3300053156 Bacteria 48315
744 Ga0500622_0004146 3300053156 Bacteria 9278
745 Ga0500622_0033424 3300053156 Bacteria 2697
746 Ga0500622_0227446 3300053156 Bacteria 832
747 Ga0500633_0000218 3300053160 Bacteria 8074
748 Ga0500634_0133068 3300053161 Bacteria 1190
749 Ga0500636_0329410 3300053177 Bacteria 738
750 Ga0500637_0047445 3300053178 Unclassified 2440
751 Ga0500637_0096756 3300053178 Bacteria 1711
752 Ga0500637_0157346 3300053178 Bacteria 1311
753 Ga0500661_039163 3300055283 Bacteria 839
754 Ga0500661_039871 3300055283 Bacteria 831
755 Ga0587090_057691 3300059510 Bacteria 728
756 Ga0466962_0046035 3300061719 Unclassified 2085
757 2738724487 2738541278 Bacteria 9755573
758 2819572039 2818991442 Bacteria 8318214
759 2819677812 2818991460 Bacteria 7595395
760 2821141716 2821136567 Bacteria 8080116
761 2839991863 2839989709 Bacteria 3773432
762 2883073130 2883068021 Bacteria 6192739
763 2884797761 2884791551 Bacteria 8511252
764 2890806986 2890804823 Bacteria 3717572
765 2896087450 2896085136 Bacteria 6129793
766 2896114804 2896109856 Bacteria 7140722
767 2904469869 2904467357 Bacteria 8057758
768 2910246681 2910245624 Bacteria 6935613
769 2929245324 2929239360 Bacteria 7745570
770 2929927566 2929921140 Bacteria 8649150
771 2945979149 2945977869 Bacteria 7777518
772 2946014987 2946013367 Bacteria 7766675
773 8003151414 8003151029 Bacteria 8187759
774 Ga0466970_0222261
775 CNXas_1006850
776 JGI24739J22299_10007316
777 JGI24743J22301_10078264
778 JGI25154J39366_1000004
779 JGI25157J39369_1012508
780 JGI25153J46596_10002511
781 JGI25153J46596_10016838
782 rootH1_10052946
783 rootH1_10097560
784 rootH2_10009025
785 rootH2_10049413
786 rootH2_10082932
787 rootH2_10088799
788 rootL2_10002103
789 rootL2_10118243
790 rootL2_10161687
791 rootL2_10190022
792 rootL2_10316744
793 rootH1_10005517
794 rootH1_10044609
795 rootH1_10097553
796 rootH1_10136237
797 rootH1_10219635
798 JGI25160J50197_1004814
799 JGI25160J50197_1007518
800 Ga0055542_1006351
801 Ga0055528_1000663
802 Ga0055530_10002672
803 Ga0055531_10000171
804 Ga0065165_1000503
805 Ga0065165_1004318
806 Ga0065165_1063152
807 Ga0065704_10174357
808 Ga0065712_10142270
809 Ga0065712_10149970
810 Ga0065715_10291611
811 Ga0070658_10000526
812 Ga0070658_10016658
813 Ga0070658_10596992
814 Ga0070676_10006484
815 Ga0070683_100078858
816 Ga0070683_100218468
817 Ga0070670_100056311
818 Ga0070670_100097783
819 Ga0070670_100102345
820 Ga0070670_100105346
821 Ga0070670_100106421
822 Ga0070670_101315574
823 Ga0068869_100052369
824 Ga0068869_100095978
825 Ga0068869_100498591
826 Ga0068869_100823745
827 Ga0070666_10000165
828 Ga0070666_10005184
829 Ga0070666_10110656
830 Ga0070666_10231958
831 Ga0070666_10288128
832 Ga0070680_100000079
833 Ga0070682_100000037
834 Ga0070682_100059539
835 Ga0070682_100111418
836 Ga0068868_100000064
837 Ga0068868_100013122
838 Ga0068868_100016798
839 Ga0068868_100489735
840 Ga0070691_10001320
841 Ga0070668_100005340
842 Ga0070668_101341578
843 Ga0070675_100077152
844 Ga0070671_100014859
845 Ga0070671_100154150
846 Ga0070671_100213266
847 Ga0070671_100298392
848 Ga0070671_100484050
849 Ga0070671_101169732
850 Ga0070673_100000225
851 Ga0070673_100066236
852 Ga0070673_100640124
853 Ga0070659_100135562
854 Ga0070667_100000557
855 Ga0070667_100012935
856 Ga0070667_100069557
857 Ga0070667_100098632
858 Ga0070667_100146966
859 Ga0070667_100440041
860 Ga0070667_100479913
861 Ga0070663_101007672
862 Ga0070678_100332182
863 Ga0070678_100422086
864 Ga0070662_100014952
865 Ga0070681_10026471
866 Ga0070681_10039494
867 Ga0068867_100002721
868 Ga0068867_100155730
869 Ga0068867_100844266
870 Ga0068867_100993992
871 Ga0068867_101140596
872 Ga0070685_10094145
873 Ga0070707_100482598
874 Ga0070698_101251224
875 Ga0070699_100405290
876 Ga0070679_100015634
877 Ga0070684_100000916
878 Ga0068853_100002721
879 Ga0068853_100013829
880 Ga0068853_100044966
881 Ga0068853_100047572
882 Ga0068853_100077605
883 Ga0068853_100120463
884 Ga0068853_100148886
885 Ga0068853_100220163
886 Ga0068853_100279812
887 Ga0070672_100000052
888 Ga0070672_100042644
889 Ga0070672_100173215
890 Ga0070686_100316532
891 Ga0070693_100827059
892 Ga0070665_100000001
893 Ga0070665_100000903
894 Ga0068855_100000210
895 Ga0068855_100019394
896 Ga0068855_100084561
897 Ga0068855_100135938
898 Ga0068855_100191869
899 Ga0068855_100464613
900 Ga0068855_100777592
901 Ga0070664_100017672
902 Ga0070664_100093595
903 Ga0070664_100107927
904 Ga0070664_100390039
905 Ga0070664_100695736
906 Ga0068857_100140977
907 Ga0068857_100244652
908 Ga0068857_100797522
909 Ga0068857_100866758
910 Ga0068854_100020995
911 Ga0068854_100058792
912 Ga0068854_100151850
913 Ga0068854_100541747
914 Ga0068854_100800855
915 Ga0068854_101025771
916 Ga0068856_100041773
917 Ga0068856_100171762
918 Ga0068856_100399315
919 Ga0070702_100000948
920 Ga0068852_100006110
921 Ga0068852_100098925
922 Ga0068852_100196692
923 Ga0068852_100586514
924 Ga0068852_101049235
925 Ga0068852_101138078
926 Ga0068859_100000163
927 Ga0068859_100007600
928 Ga0068859_100137784
929 Ga0068859_100301301
930 Ga0068859_100564662
931 Ga0068864_100001080
932 Ga0068864_100006105
933 Ga0068864_100997685
934 Ga0068866_10142289
935 Ga0068861_100013360
936 Ga0068851_10003337
937 Ga0068851_10009207
938 Ga0068851_10067607
939 Ga0068851_10229395
940 Ga0068863_100000281
941 Ga0068863_100000696
942 Ga0068863_100042175
943 Ga0068863_100083239
944 Ga0068863_100200341
945 Ga0068863_100986875
946 Ga0068858_100001379
947 Ga0068858_100006245
948 Ga0068858_100072999
949 Ga0068860_100000004
950 Ga0068860_100004472
951 Ga0068860_100005091
952 Ga0068860_100007805
953 Ga0068860_100035187
954 Ga0068860_100260531
955 Ga0068860_100339768
956 Ga0068860_100837624
957 Ga0068860_101424780
958 Ga0068862_100082495
959 Ga0068862_100467725
960 Ga0068862_100851186
961 Ga0081455_10418787
962 Ga0081540_1012938
963 Ga0075366_10003749
964 Ga0075366_10528628
965 Ga0097621_100001082
966 Ga0097621_100012160
967 Ga0097621_100024579
968 Ga0097621_100072652
969 Ga0097621_100089110
970 Ga0097621_100162038
971 Ga0097621_100224101
972 Ga0097621_100688198
973 Ga0097621_100823426
974 Ga0068871_100000076
975 Ga0068871_100001571
976 Ga0068871_100014842
977 Ga0068871_100016263
978 Ga0068871_100256799
979 Ga0068871_100493263
980 Ga0068871_101748345
981 Ga0068865_100002600
982 Ga0068865_100043619
983 Ga0068865_100046501
984 Ga0068865_100869262
985 Ga0097620_100000163
986 Ga0097620_100007600
987 Ga0097620_100137784
988 Ga0097620_100301290
989 Ga0097620_100564692
990 Ga0105240_10000061
991 Ga0105240_10000087
992 Ga0105240_10001401
993 Ga0105240_10004570
994 Ga0105240_10012560
995 Ga0105240_10021348
996 Ga0105240_10037251
997 Ga0105240_10229541
998 Ga0105240_10492485
999 Ga0105240_10533042
1000 Ga0105240_10638222
1001 Ga0105240_11238485
1002 Ga0111539_11462533
1003 Ga0105245_10137294
1004 Ga0105247_10030304
1005 Ga0105247_10055978
1006 Ga0114129_10383048
1007 Ga0105241_10000776
1008 Ga0105241_10001165
1009 Ga0105241_10002324
1010 Ga0105241_10021855
1011 Ga0105241_10032888
1012 Ga0105241_10159399
1013 Ga0105241_10309581
1014 Ga0105242_10031097
1015 Ga0105242_10102408
1016 Ga0105248_10081319
1017 Ga0105248_10124603
1018 Ga0105237_10000377
1019 Ga0105237_10003363
1020 Ga0105237_10003655
1021 Ga0105237_10006545
1022 Ga0105237_10008725
1023 Ga0105237_10023189
1024 Ga0105237_10032771
1025 Ga0105237_10100761
1026 Ga0105237_10103591
1027 Ga0105237_10147269
1028 Ga0105237_10179821
1029 Ga0105237_10506697
1030 Ga0105237_10605405
1031 Ga0105237_10644038
1032 Ga0105237_10734961
1033 Ga0105237_10972953
1034 Ga0105238_10000725
1035 Ga0105238_10077843
1036 Ga0105238_10321410
1037 Ga0105238_10335318
1038 Ga0105238_10500504
1039 Ga0105238_11203939
1040 Ga0105249_10001077
1041 Ga0105249_10006543
1042 Ga0105249_10216258
1043 Ga0105249_10227559
1044 Ga0105249_11620739
1045 Ga0105239_10000029
1046 Ga0105239_10000122
1047 Ga0105239_10002610
1048 Ga0105239_10003762
1049 Ga0105239_10020310
1050 Ga0105239_10030473
1051 Ga0105239_10057406
1052 Ga0105239_10075981
1053 Ga0105239_10143397
1054 Ga0105239_10220534
1055 Ga0105239_10690100
1056 Ga0105246_10286815
1057 Ga0157373_10030712
1058 Ga0157373_10107677
1059 Ga0157371_10021734
1060 Ga0157371_10496130
1061 Ga0157370_10004831
1062 Ga0157370_10008901
1063 Ga0157370_10010136
1064 Ga0157370_10022162
1065 Ga0157370_10634682
1066 Ga0157369_10041773
1067 Ga0157369_10098769
1068 Ga0157369_10187806
1069 Ga0157369_10202195
1070 Ga0157374_10000001
1071 Ga0157374_10000399
1072 Ga0157374_10033808
1073 Ga0157374_10120836
1074 Ga0157374_10365623
1075 Ga0157374_10474019
1076 Ga0157378_10005736
1077 Ga0157378_10011030
1078 Ga0157378_10016461
1079 Ga0157378_10018702
1080 Ga0157378_10059428
1081 Ga0157378_10271589
1082 Ga0157378_10553141
1083 Ga0157378_10560931
1084 Ga0157378_11387574
1085 Ga0163162_10000170
1086 Ga0163162_10000214
1087 Ga0163162_10000365
1088 Ga0163162_10000461
1089 Ga0163162_10000785
1090 Ga0163162_10003791
1091 Ga0163162_10017550
1092 Ga0163162_10045357
1093 Ga0163162_10128351
1094 Ga0163162_10174203
1095 Ga0163162_10979074
1096 Ga0163162_12059746
1097 Ga0157372_10000255
1098 Ga0157372_10003905
1099 Ga0157372_10058406
1100 Ga0157372_10062274
1101 Ga0157372_10112198
1102 Ga0157372_10181550
1103 Ga0157372_10189128
1104 Ga0157375_10000125
1105 Ga0157375_10000450
1106 Ga0157375_10076314
1107 Ga0157375_10106887
1108 Ga0157375_10387995
1109 Ga0157375_10526534
1110 Ga0157375_11756438
1111 Ga0163163_10000281
1112 Ga0163163_10000761
1113 Ga0163163_10278215
1114 Ga0163163_10714526
1115 Ga0163163_11100747
1116 Ga0163163_11397439
1117 Ga0157377_10617100
1118 Ga0157379_10000107
1119 Ga0157379_10027995
1120 Ga0157379_10133735
1121 Ga0157379_10947873
1122 Ga0157376_10000336
1123 Ga0157376_10002516
1124 Ga0157376_10002763
1125 Ga0157376_10030967
1126 Ga0157376_10215890
1127 Ga0157376_10327012
1128 Ga0157376_10506707
1129 Ga0157376_10568200
1130 Ga0182005_1000040
1131 Ga0163161_10000612
1132 Ga0163161_10058150
1133 Ga0163161_10307145
1134 Ga0213876_10001420
1135 Ga0213876_10009849
1136 Ga0209436_101069
1137 Ga0209258_100075
1138 Ga0209646_1000025
1139 Ga0209646_1002484
1140 Ga0209026_1000189
1141 Ga0209148_1000085
1142 Ga0209673_1000197
1143 Ga0209130_1000540
1144 Ga0209564_1007802
1145 Ga0209758_1004263
1146 Ga0209758_1020046
1147 Ga0209758_1063479
1148 Ga0209050_1000204
1149 Ga0207426_1000057
1150 Ga0207426_1000332
1151 Ga0207426_1000647
1152 Ga0207426_1039109
1153 Ga0209051_1016604
1154 Ga0209257_1000004
1155 Ga0209257_1001318
1156 Ga0207656_10004885
1157 Ga0207656_10018454
1158 Ga0207656_10043748
1159 Ga0207682_10080003
1160 Ga0207710_10031433
1161 Ga0207688_10011763
1162 Ga0207680_10000068
1163 Ga0207680_10003265
1164 Ga0207680_10076220
1165 Ga0207647_10000717
1166 Ga0207647_10030100
1167 Ga0207645_10001517
1168 Ga0207705_10003407
1169 Ga0207705_10132739
1170 Ga0207654_10003625
1171 Ga0207654_10004528
1172 Ga0207654_10016709
1173 Ga0207654_10142023
1174 Ga0207654_10240585
1175 Ga0207707_10000186
1176 Ga0207695_10000057
1177 Ga0207695_10000459
1178 Ga0207695_10000568
1179 Ga0207695_10003746
1180 Ga0207695_10010042
1181 Ga0207695_10010077
1182 Ga0207695_10013050
1183 Ga0207695_10069434
1184 Ga0207695_10138329
1185 Ga0207695_10149243
1186 Ga0207695_10588688
1187 Ga0207695_10607717
1188 Ga0207671_10000438
1189 Ga0207671_10003201
1190 Ga0207671_10003886
1191 Ga0207671_10006029
1192 Ga0207671_10008419
1193 Ga0207671_10009693
1194 Ga0207671_10032395
1195 Ga0207671_10100497
1196 Ga0207671_10123685
1197 Ga0207671_10280458
1198 Ga0207671_10418538
1199 Ga0207671_10429607
1200 Ga0207660_10001497
1201 Ga0207662_10102497
1202 Ga0207657_10735458
1203 Ga0207652_10002640
1204 Ga0207652_10103818
1205 Ga0207681_10463442
1206 Ga0207694_10005144
1207 Ga0207694_10012647
1208 Ga0207694_10049911
1209 Ga0207694_10148195
1210 Ga0207650_10041236
1211 Ga0207650_10095431
1212 Ga0207650_10179981
1213 Ga0207650_10550499
1214 Ga0207650_10595579
1215 Ga0207650_10652551
1216 Ga0207650_10847486
1217 Ga0207650_11181487
1218 Ga0207659_10279853
1219 Ga0207644_10012876
1220 Ga0207644_10024302
1221 Ga0207644_10088974
1222 Ga0207644_10104123
1223 Ga0207644_10348455
1224 Ga0207690_10514874
1225 Ga0207706_10028304
1226 Ga0207706_10179897
1227 Ga0207686_10055656
1228 Ga0207686_10081205
1229 Ga0207709_10350577
1230 Ga0207669_11078510
1231 Ga0207704_10001241
1232 Ga0207704_10015092
1233 Ga0207704_10345580
1234 Ga0207691_10000001
1235 Ga0207691_10059647
1236 Ga0207691_10915684
1237 Ga0207711_10976615
1238 Ga0207689_10001987
1239 Ga0207689_10045397
1240 Ga0207689_10295584
1241 Ga0207661_10053648
1242 Ga0207679_10063377
1243 Ga0207679_10064138
1244 Ga0207679_10622120
1245 Ga0207667_10000133
1246 Ga0207667_10016999
1247 Ga0207667_10021922
1248 Ga0207667_10050811
1249 Ga0207667_10081758
1250 Ga0207667_10141097
1251 Ga0207667_10229187
1252 Ga0207667_10622970
1253 Ga0207667_10696112
1254 Ga0207651_10000927
1255 Ga0207651_10040230
1256 Ga0207651_10191884
1257 Ga0207651_10638082
1258 Ga0207712_10016655
1259 Ga0207712_10074171
1260 Ga0207712_10189518
1261 Ga0207712_10229528
1262 Ga0207668_10004515
1263 Ga0207668_10071386
1264 Ga0207640_10044612
1265 Ga0207640_10119279
1266 Ga0207640_10409148
1267 Ga0207658_10002225
1268 Ga0207658_10030704
1269 Ga0207658_10097378
1270 Ga0207658_10218341
1271 Ga0207658_10863776
1272 Ga0207677_10031471
1273 Ga0207703_10000541
1274 Ga0207703_10013325
1275 Ga0207639_10010449
1276 Ga0207639_10013895
1277 Ga0207639_10015128
1278 Ga0207639_10061396
1279 Ga0207639_10076756
1280 Ga0207639_10142609
1281 Ga0207639_10224040
1282 Ga0207639_10240071
1283 Ga0207639_10304178
1284 Ga0207639_10309906
1285 Ga0207639_11214595
1286 Ga0207678_10156274
1287 Ga0207702_10037878
1288 Ga0207702_10099818
1289 Ga0207702_10140155
1290 Ga0207702_10440278
1291 Ga0207641_10000176
1292 Ga0207641_10020855
1293 Ga0207641_10028806
1294 Ga0207641_10369454
1295 Ga0207641_10381008
1296 Ga0207648_10002236
1297 Ga0207648_10267431
1298 Ga0207648_10402070
1299 Ga0207648_10857483
1300 Ga0207648_10957274
1301 Ga0207648_11102928
1302 Ga0207648_11392437
1303 Ga0207676_10003381
1304 Ga0207676_10056279
1305 Ga0207676_10076300
1306 Ga0207676_10369206
1307 Ga0207674_10003956
1308 Ga0207674_10134951
1309 Ga0207674_10146596
1310 Ga0207674_10809301
1311 Ga0207675_100011131
1312 Ga0207683_10040207
1313 Ga0207683_10267855
1314 Ga0207683_10346391
1315 Ga0207698_10173606
1316 Ga0207698_10541785
1317 Ga0207698_11084130
1318 Ga0268266_10000065
1319 Ga0268266_10004508
1320 Ga0268265_10138189
1321 Ga0268264_10000011
1322 Ga0268264_10002016
1323 Ga0268264_10005470
1324 Ga0268264_10011914
1325 Ga0268264_10086984
1326 Ga0268264_10191606
1327 Ga0268264_10468491
1328 Ga0268264_10651066
1329 Ga0268264_10773221
1330 Ga0265337_1078310
1331 Ga0307517_10002935
1332 Ga0307517_10229909
1333 Ga0307515_10000002
1334 Ga0307515_10000107
1335 Ga0307511_10000930
1336 Ga0265327_10000148
1337 Ga0265327_10009240
1338 Ga0307513_10047118
1339 Ga0307513_10150285
1340 Ga0307513_10528508
1341 Ga0307513_10591996
1342 Ga0307509_10040553
1343 Ga0307509_10101603
1344 Ga0307509_10356072
1345 Ga0265313_10051177
1346 Ga0307516_10000944
1347 Ga0307409_100101291
1348 Ga0307414_10403293
1349 Ga0307510_10004875
1350 Ga0373943_0074867
1351 Ga0373955_0536105
1352 Ga0373935_0400889
1353 Ga0373927_0037405
1354 Ga0373937_0248875
1355 Ga0373937_0914510
1356 Ga0373937_1481369
1357 Ga0373925_0503246
1358 Ga0436365_0180273
1359 Ga0436365_0316569
1360 Ga0436365_0920295
1361 Ga0439439_0000810
1362 Ga0451795_0607167
1363 Ga0451853_1580363
1364 Ga0451853_1589815
1365 Ga0451853_3965068
1366 Ga0439431_0000493
1367 Ga0439431_0087441
1368 Ga0439449_0011315
1369 Ga0439449_0039835
1370 Ga0439457_000066
1371 Ga0439462_0005485
1372 Ga0439434_0106645
1373 Ga0451577_0508365
1374 Ga0466969_0000004
1375 Ga0466969_0264517
1376 Ga0466972_0000017
1377 Ga0466972_0008593
1378 Ga0466972_0036057
1379 Ga0466966_0000295
1380 Ga0466966_0057735
1381 Ga0466961_0083778
1382 Ga0466964_0110189
1383 Ga0453684_0007222
1384 Ga0453684_0350822
1385 Ga0466968_0018094
1386 Ga0466968_0056743
1387 Ga0466970_0047636
1388 Ga0466957_0000760
1389 Ga0466957_0049972
1390 Ga0466960_0229387
1391 Ga0466959_0000004
1392 Ga0466959_0004206
1393 Ga0466958_0034417
1394 Ga0466967_0104447
1395 Ga0495627_019703
1396 Ga0495638_0015366
1397 Ga0495638_0173362
1398 Ga0495650_0031148
1399 Ga0495650_0033688
1400 Ga0495580_0056085
1401 Ga0495639_0135047
1402 Ga0495664_0122192
1403 Ga0495606_0079825
1404 Ga0495608_0335022
1405 Ga0495630_0126267
1406 Ga0495632_0196590
1407 Ga0495648_0015274
1408 Ga0495665_0324442
1409 Ga0495633_0000017
1410 Ga0495633_0040974
1411 Ga0495668_0000321
1412 Ga0495668_0008554
1413 Ga0495634_0214590
1414 Ga0495611_0000021
1415 Ga0495625_0016880
1416 Ga0495625_0385957
1417 Ga0495625_0604034
1418 Ga0495646_0275272
1419 Ga0495647_0223937
1420 Ga0495613_0076208
1421 Ga0495670_0019468
1422 Ga0495600_0572303
1423 Ga0495674_0137385
1424 Ga0495672_0044759
1425 Ga0495672_0154754
1426 Ga0495676_0628625
1427 Ga0495687_000006
1428 Ga0495686_0000094
1429 Ga0496100_0019465
1430 Ga0496101_0064741
1431 Ga0496102_0146727
1432 Ga0496102_0248525
1433 Ga0496104_0168150
1434 Ga0496105_0510239
1435 Ga0496106_0152137
1436 Ga0496108_0570406
1437 Ga0496109_0577778
1438 Ga0496110_0220632
1439 Ga0496114_0027530
1440 Ga0496115_0028703
1441 Ga0496121_0000010
1442 Ga0496126_0018857
1443 Ga0501300_026701
1444 Ga0501032_0045288
1445 Ga0501033_0213273
1446 Ga0501034_0003578
1447 Ga0501034_0004335
1448 Ga0501034_0005604
1449 Ga0501034_0083863
1450 Ga0501034_0220674
1451 Ga0501034_0239107
1452 Ga0501034_0467604
1453 Ga0501037_0070932
1454 Ga0501039_0649991
1455 Ga0501043_0108914
1456 Ga0501047_0028890
1457 Ga0501047_0044570
1458 Ga0501047_0165516
1459 Ga0501223_000312
1460 Ga0501238_016463
1461 Ga0501238_050383
1462 Ga0501219_000278
1463 Ga0501225_0002394
1464 Ga0501080_0111512
1465 Ga0501080_0406706
1466 Ga0501241_000755
1467 Ga0501035_0201245
1468 Ga0501035_0927534
1469 Ga0501044_0033488
1470 Ga0501044_0052856
1471 Ga0501044_0213032
1472 Ga0501044_0530478
1473 Ga0501044_0645088
1474 Ga0501284_00005
1475 nmdc:mga0k408_32120_c1
1476 nmdc:mga0k408_4366_c2
1477 nmdc:mga05p37_101574_c1
1478 Ga0495619_0041541
1479 Ga0500578_0000814
1480 Ga0500578_0029296
1481 Ga0500578_0390778
1482 Ga0500644_0000233
1483 Ga0500646_0033642
1484 Ga0500646_0037946
1485 Ga0500583_0000062
1486 Ga0500583_0003491
1487 Ga0500583_0018893
1488 Ga0500583_0022594
1489 Ga0500651_0079726
1490 Ga0500651_0113014
1491 Ga0500556_0042230
1492 Ga0500556_0097226
1493 Ga0500569_000386
1494 Ga0500594_0085698
1495 Ga0500594_0117595
1496 Ga0500628_013038
1497 Ga0500642_0021523
1498 Ga0500652_017178
1499 Ga0500655_007478
1500 Ga0500658_0006742
1501 Ga0500658_0152586
1502 Ga0500658_0278522
1503 Ga0500559_0029668
1504 Ga0500559_0033973
1505 Ga0500559_0297002
1506 Ga0500561_0030505
1507 Ga0500577_0000835
1508 Ga0500577_0296508
1509 Ga0500588_0004802
1510 Ga0500588_0070548
1511 Ga0500589_027510
1512 Ga0500603_015406
1513 Ga0500604_0005577
1514 Ga0500616_0032438
1515 Ga0500619_047819
1516 Ga0500622_0000319
1517 Ga0500622_0004146
1518 Ga0500622_0033424
1519 Ga0500622_0227446
1520 Ga0500633_0000218
1521 Ga0500634_0133068
1522 Ga0500636_0329410
1523 Ga0500637_0047445
1524 Ga0500637_0096756
1525 Ga0500637_0157346
1526 Ga0500661_039163
1527 Ga0500661_039871
1528 Ga0587090_057691
1529 Ga0466962_0046035
1530 2738724487
1531 2819572039
1532 2819677812
1533 2821141716
1534 2839991863
1535 2883073130
1536 2884797761
1537 2890806986
1538 2896087450
1539 2896114804
1540 2904469869
1541 2910246681
1542 2929245324
1543 2929927566
1544 2945979149
1545 2946014987
1546 8003151414

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

28

180

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6igs-assembly2.cif.gz_D crystal structure of hprt from f. tularensis with zinc 0.9592 10 176
3o7m-assembly1.cif.gz_D 1.98 angstrom resolution crystal structure of a hypoxanthine-guanine phosphoribosyltransferase (hpt-2) from bacillus anthracis str. 'ames ancestor' 0.9459 12 176
4qri-assembly1.cif.gz_A 2.35 angstrom resolution crystal structure of hypoxanthine-guanine-xanthine phosphoribosyltransferase from leptospira interrogans serovar copenhageni str. fiocruz l1-130 0.9452 10 177
6d9r-assembly1.cif.gz_B the substrate-bound crystal structure of hprt (hypoxanthine phosphoribosyltransferase) 0.9403 11 176
1j7j-assembly2.cif.gz_B crystal structure of the hprt from salmonella typhimurium 0.9397 10 177
ID Description Score Start End Superfamily
4qriB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9325 10 178 3.40.50.2020
1hgxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9228 11 177 3.40.50.2020
af_Q9NF11_2_214_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9213 12 176 3.40.50.2020
4qriB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9092 10 178 3.40.50.2020
4rhtD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9006 11 177 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A5C7Q9A5-F1-model_v4 deleted 0.9872 3 177
AF-A0A4U6D3V6-F1-model_v4 Hypoxanthine phosphoribosyltransferase (EC 2.4.2.8) 0.9868 3 177 GO:0000166
GO:0000287
GO:0004422
GO:0005829
GO:0006166
GO:0006178
GO:0032263
GO:0032264
GO:0046100
GO:0052657
AF-A0A1I1PEH0-F1-model_v4 Hypoxanthine phosphoribosyltransferase (EC 2.4.2.8) 0.9852 1 176 GO:0000166
GO:0000287
GO:0004422
GO:0005829
GO:0006166
GO:0006178
GO:0032263
GO:0032264
GO:0046100
GO:0052657
AF-A0A3C1LIB5-F1-model_v4 Hypoxanthine phosphoribosyltransferase 0.9834 88 177 GO:0000166
GO:0000287
GO:0004422
GO:0005829
GO:0006178
GO:0032263
GO:0032264
GO:0046100
AF-A0A4V2AWN9-F1-model_v4 Hypoxanthine phosphoribosyltransferase 0.9829 1 161 GO:0000166
GO:0000287
GO:0004422
GO:0005829
GO:0006178
GO:0032263
GO:0032264
GO:0046100

Map