F480180
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 773 | 317 | 1546 | 178 |
Family's Representative Sequence
| Representative Sequence | 3300044765|Ga0466970_0222261|Ga0466970_0222261_375_959 |
| Length | 194 |
| Sequence | VRRGSGEGGVTRKVRDMSIIRVHDKDFEPYLPAEQITKKIKEIAVRMDADYEGKKPLFVAILNGSFMFASDLFKSLTIEAEICFIKLASYKGTKSSGQVITAIGLDTDMHGRHVVILEDIVDTGKTLSEFLPQLEHQQPASLKIAALLHKPEATVYPISVDYLGFSVPNKFLLGYGLDYDGLGRNIPSIYKLVE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 2 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 105 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 108 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 109 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 172 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 173 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 174 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 175 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 176 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 177 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 178 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 179 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 180 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 181 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 182 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 183 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 184 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 187 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 190 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 191 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 193 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 194 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 195 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 196 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 197 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 198 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 199 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 200 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 201 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 202 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 203 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 204 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 205 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 206 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 207 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 208 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 209 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 210 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 211 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 241 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 242 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 243 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 244 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 247 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 248 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 249 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 250 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 251 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 252 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 260 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 261 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 262 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 263 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 265 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 268 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 269 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 272 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 273 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 274 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 275 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 276 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 277 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 278 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 279 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 280 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 281 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 282 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 283 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 284 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 285 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 286 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 287 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 288 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 289 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 290 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 291 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 292 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 293 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 294 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 295 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 296 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 297 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 298 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 299 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 301 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 302 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 303 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 304 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 305 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 306 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 307 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 308 | 2890804823 | Fluviicola sp. SGL-29 | Isolate | Rhizosphere |
| 309 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 310 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 311 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 312 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 313 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 314 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 315 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 316 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 317 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.67 |
| Metatranscriptomes | 0.13 |
| Isolates | 2.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.48 |
| Nodule | 0 |
| Rhizoplane | 1.68 |
| Rhizosphere | 80.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466970_0222261 | 3300044765 | Bacteria | 1054 |
| 2 | CNXas_1006850 | 3300000545 | Bacteria | 804 |
| 3 | JGI24739J22299_10007316 | 3300001989 | Unclassified | 4145 |
| 4 | JGI24743J22301_10078264 | 3300001991 | Bacteria | 696 |
| 5 | JGI25154J39366_1000004 | 3300002738 | Bacteria | 346460 |
| 6 | JGI25157J39369_1012508 | 3300002741 | Bacteria | 1078 |
| 7 | JGI25153J46596_10002511 | 3300003215 | Bacteria | 10532 |
| 8 | JGI25153J46596_10016838 | 3300003215 | Bacteria | 2908 |
| 9 | rootH1_10052946 | 3300003316 | Bacteria | 4683 |
| 10 | rootH1_10097560 | 3300003316 | Bacteria | 3727 |
| 11 | rootH2_10009025 | 3300003320 | Bacteria | 27408 |
| 12 | rootH2_10049413 | 3300003320 | Bacteria | 18448 |
| 13 | rootH2_10082932 | 3300003320 | Bacteria | 3347 |
| 14 | rootH2_10088799 | 3300003320 | Bacteria | 3837 |
| 15 | rootL2_10002103 | 3300003322 | Bacteria | 5592 |
| 16 | rootL2_10118243 | 3300003322 | Bacteria | 3173 |
| 17 | rootL2_10161687 | 3300003322 | Bacteria | 4293 |
| 18 | rootL2_10190022 | 3300003322 | Bacteria | 2580 |
| 19 | rootL2_10316744 | 3300003322 | Unclassified | 2216 |
| 20 | rootH1_10005517 | 3300003323 | Bacteria | 4511 |
| 21 | rootH1_10044609 | 3300003323 | Bacteria | 6762 |
| 22 | rootH1_10097553 | 3300003323 | Bacteria | 3525 |
| 23 | rootH1_10136237 | 3300003323 | Bacteria | 2039 |
| 24 | rootH1_10219635 | 3300003323 | Bacteria | 2383 |
| 25 | JGI25160J50197_1004814 | 3300003354 | Bacteria | 5756 |
| 26 | JGI25160J50197_1007518 | 3300003354 | Bacteria | 4254 |
| 27 | Ga0055542_1006351 | 3300003762 | Bacteria | 2537 |
| 28 | Ga0055528_1000663 | 3300003790 | Bacteria | 25012 |
| 29 | Ga0055530_10002672 | 3300003791 | Bacteria | 11124 |
| 30 | Ga0055531_10000171 | 3300003794 | Bacteria | 73046 |
| 31 | Ga0065165_1000503 | 3300005262 | Bacteria | 60427 |
| 32 | Ga0065165_1004318 | 3300005262 | Bacteria | 8935 |
| 33 | Ga0065165_1063152 | 3300005262 | Bacteria | 1007 |
| 34 | Ga0065704_10174357 | 3300005289 | Bacteria | 1273 |
| 35 | Ga0065712_10142270 | 3300005290 | Unclassified | 1439 |
| 36 | Ga0065712_10149970 | 3300005290 | Bacteria | 1377 |
| 37 | Ga0065715_10291611 | 3300005293 | Bacteria | 1062 |
| 38 | Ga0070658_10000526 | 3300005327 | Bacteria | 33186 |
| 39 | Ga0070658_10016658 | 3300005327 | Bacteria | 5883 |
| 40 | Ga0070658_10596992 | 3300005327 | Bacteria | 957 |
| 41 | Ga0070676_10006484 | 3300005328 | Bacteria | 6252 |
| 42 | Ga0070683_100078858 | 3300005329 | Bacteria | 3082 |
| 43 | Ga0070683_100218468 | 3300005329 | Unclassified | 1811 |
| 44 | Ga0070670_100056311 | 3300005331 | Unclassified | 3374 |
| 45 | Ga0070670_100097783 | 3300005331 | Bacteria | 2525 |
| 46 | Ga0070670_100102345 | 3300005331 | Bacteria | 2467 |
| 47 | Ga0070670_100105346 | 3300005331 | Bacteria | 2430 |
| 48 | Ga0070670_100106421 | 3300005331 | Bacteria | 2417 |
| 49 | Ga0070670_101315574 | 3300005331 | Bacteria | 662 |
| 50 | Ga0068869_100052369 | 3300005334 | Bacteria | 2964 |
| 51 | Ga0068869_100095978 | 3300005334 | Unclassified | 2237 |
| 52 | Ga0068869_100498591 | 3300005334 | Bacteria | 1016 |
| 53 | Ga0068869_100823745 | 3300005334 | Bacteria | 799 |
| 54 | Ga0070666_10000165 | 3300005335 | Bacteria | 45323 |
| 55 | Ga0070666_10005184 | 3300005335 | Bacteria | 7981 |
| 56 | Ga0070666_10110656 | 3300005335 | Unclassified | 1899 |
| 57 | Ga0070666_10231958 | 3300005335 | Bacteria | 1304 |
| 58 | Ga0070666_10288128 | 3300005335 | Bacteria | 1168 |
| 59 | Ga0070680_100000079 | 3300005336 | Bacteria | 52745 |
| 60 | Ga0070682_100000037 | 3300005337 | Bacteria | 147526 |
| 61 | Ga0070682_100059539 | 3300005337 | Bacteria | 2413 |
| 62 | Ga0070682_100111418 | 3300005337 | Bacteria | 1824 |
| 63 | Ga0068868_100000064 | 3300005338 | Bacteria | 61762 |
| 64 | Ga0068868_100013122 | 3300005338 | Bacteria | 6068 |
| 65 | Ga0068868_100016798 | 3300005338 | Bacteria | 5443 |
| 66 | Ga0068868_100489735 | 3300005338 | Bacteria | 1075 |
| 67 | Ga0070691_10001320 | 3300005341 | Bacteria | 10540 |
| 68 | Ga0070668_100005340 | 3300005347 | Bacteria | 9541 |
| 69 | Ga0070668_101341578 | 3300005347 | Bacteria | 651 |
| 70 | Ga0070675_100077152 | 3300005354 | Bacteria | 2773 |
| 71 | Ga0070671_100014859 | 3300005355 | Bacteria | 6289 |
| 72 | Ga0070671_100154150 | 3300005355 | Unclassified | 1941 |
| 73 | Ga0070671_100213266 | 3300005355 | Unclassified | 1638 |
| 74 | Ga0070671_100298392 | 3300005355 | Bacteria | 1372 |
| 75 | Ga0070671_100484050 | 3300005355 | Bacteria | 1063 |
| 76 | Ga0070671_101169732 | 3300005355 | Unclassified | 676 |
| 77 | Ga0070673_100000225 | 3300005364 | Bacteria | 28328 |
| 78 | Ga0070673_100066236 | 3300005364 | Unclassified | 2885 |
| 79 | Ga0070673_100640124 | 3300005364 | Unclassified | 972 |
| 80 | Ga0070659_100135562 | 3300005366 | Bacteria | 2002 |
| 81 | Ga0070667_100000557 | 3300005367 | Bacteria | 36978 |
| 82 | Ga0070667_100012935 | 3300005367 | Bacteria | 6899 |
| 83 | Ga0070667_100069557 | 3300005367 | Bacteria | 2996 |
| 84 | Ga0070667_100098632 | 3300005367 | Unclassified | 2521 |
| 85 | Ga0070667_100146966 | 3300005367 | Bacteria | 2068 |
| 86 | Ga0070667_100440041 | 3300005367 | Bacteria | 1190 |
| 87 | Ga0070667_100479913 | 3300005367 | Bacteria | 1138 |
| 88 | Ga0070663_101007672 | 3300005455 | Bacteria | 724 |
| 89 | Ga0070678_100332182 | 3300005456 | Unclassified | 1301 |
| 90 | Ga0070678_100422086 | 3300005456 | Bacteria | 1163 |
| 91 | Ga0070662_100014952 | 3300005457 | Bacteria | 5190 |
| 92 | Ga0070681_10026471 | 3300005458 | Bacteria | 5828 |
| 93 | Ga0070681_10039494 | 3300005458 | Bacteria | 4731 |
| 94 | Ga0068867_100002721 | 3300005459 | Bacteria | 12472 |
| 95 | Ga0068867_100155730 | 3300005459 | Bacteria | 1798 |
| 96 | Ga0068867_100844266 | 3300005459 | Unclassified | 820 |
| 97 | Ga0068867_100993992 | 3300005459 | Unclassified | 760 |
| 98 | Ga0068867_101140596 | 3300005459 | Bacteria | 713 |
| 99 | Ga0070685_10094145 | 3300005466 | Unclassified | 1819 |
| 100 | Ga0070707_100482598 | 3300005468 | Bacteria | 1201 |
| 101 | Ga0070698_101251224 | 3300005471 | Bacteria | 692 |
| 102 | Ga0070699_100405290 | 3300005518 | Bacteria | 1233 |
| 103 | Ga0070679_100015634 | 3300005530 | Bacteria | 7294 |
| 104 | Ga0070684_100000916 | 3300005535 | Bacteria | 20926 |
| 105 | Ga0068853_100002721 | 3300005539 | Bacteria | 13351 |
| 106 | Ga0068853_100013829 | 3300005539 | Bacteria | 6597 |
| 107 | Ga0068853_100044966 | 3300005539 | Bacteria | 3781 |
| 108 | Ga0068853_100047572 | 3300005539 | Bacteria | 3681 |
| 109 | Ga0068853_100077605 | 3300005539 | Bacteria | 2902 |
| 110 | Ga0068853_100120463 | 3300005539 | Bacteria | 2340 |
| 111 | Ga0068853_100148886 | 3300005539 | Unclassified | 2106 |
| 112 | Ga0068853_100220163 | 3300005539 | Bacteria | 1733 |
| 113 | Ga0068853_100279812 | 3300005539 | Unclassified | 1538 |
| 114 | Ga0070672_100000052 | 3300005543 | Bacteria | 51529 |
| 115 | Ga0070672_100042644 | 3300005543 | Bacteria | 3494 |
| 116 | Ga0070672_100173215 | 3300005543 | Bacteria | 1795 |
| 117 | Ga0070686_100316532 | 3300005544 | Bacteria | 1162 |
| 118 | Ga0070693_100827059 | 3300005547 | Unclassified | 688 |
| 119 | Ga0070665_100000001 | 3300005548 | Bacteria | 1083363 |
| 120 | Ga0070665_100000903 | 3300005548 | Bacteria | 38097 |
| 121 | Ga0068855_100000210 | 3300005563 | Bacteria | 74786 |
| 122 | Ga0068855_100019394 | 3300005563 | Bacteria | 8171 |
| 123 | Ga0068855_100084561 | 3300005563 | Bacteria | 3673 |
| 124 | Ga0068855_100135938 | 3300005563 | Bacteria | 2805 |
| 125 | Ga0068855_100191869 | 3300005563 | Unclassified | 2304 |
| 126 | Ga0068855_100464613 | 3300005563 | Bacteria | 1379 |
| 127 | Ga0068855_100777592 | 3300005563 | Bacteria | 1019 |
| 128 | Ga0070664_100017672 | 3300005564 | Bacteria | 5856 |
| 129 | Ga0070664_100093595 | 3300005564 | Unclassified | 2604 |
| 130 | Ga0070664_100107927 | 3300005564 | Bacteria | 2427 |
| 131 | Ga0070664_100390039 | 3300005564 | Bacteria | 1272 |
| 132 | Ga0070664_100695736 | 3300005564 | Bacteria | 947 |
| 133 | Ga0068857_100140977 | 3300005577 | Bacteria | 2179 |
| 134 | Ga0068857_100244652 | 3300005577 | Bacteria | 1643 |
| 135 | Ga0068857_100797522 | 3300005577 | Unclassified | 902 |
| 136 | Ga0068857_100866758 | 3300005577 | Bacteria | 865 |
| 137 | Ga0068854_100020995 | 3300005578 | Bacteria | 4426 |
| 138 | Ga0068854_100058792 | 3300005578 | Bacteria | 2777 |
| 139 | Ga0068854_100151850 | 3300005578 | Bacteria | 1787 |
| 140 | Ga0068854_100541747 | 3300005578 | Bacteria | 986 |
| 141 | Ga0068854_100800855 | 3300005578 | Bacteria | 821 |
| 142 | Ga0068854_101025771 | 3300005578 | Bacteria | 732 |
| 143 | Ga0068856_100041773 | 3300005614 | Bacteria | 4508 |
| 144 | Ga0068856_100171762 | 3300005614 | Bacteria | 2180 |
| 145 | Ga0068856_100399315 | 3300005614 | Unclassified | 1394 |
| 146 | Ga0070702_100000948 | 3300005615 | Bacteria | 11383 |
| 147 | Ga0068852_100006110 | 3300005616 | Bacteria | 8682 |
| 148 | Ga0068852_100098925 | 3300005616 | Bacteria | 2628 |
| 149 | Ga0068852_100196692 | 3300005616 | Bacteria | 1906 |
| 150 | Ga0068852_100586514 | 3300005616 | Bacteria | 1118 |
| 151 | Ga0068852_101049235 | 3300005616 | Unclassified | 834 |
| 152 | Ga0068852_101138078 | 3300005616 | Bacteria | 801 |
| 153 | Ga0068859_100000163 | 3300005617 | Bacteria | 64401 |
| 154 | Ga0068859_100007600 | 3300005617 | Bacteria | 11015 |
| 155 | Ga0068859_100137784 | 3300005617 | Bacteria | 2514 |
| 156 | Ga0068859_100301301 | 3300005617 | Bacteria | 1696 |
| 157 | Ga0068859_100564662 | 3300005617 | Bacteria | 1232 |
| 158 | Ga0068864_100001080 | 3300005618 | Bacteria | 22832 |
| 159 | Ga0068864_100006105 | 3300005618 | Bacteria | 9881 |
| 160 | Ga0068864_100997685 | 3300005618 | Bacteria | 830 |
| 161 | Ga0068866_10142289 | 3300005718 | Bacteria | 1378 |
| 162 | Ga0068861_100013360 | 3300005719 | Bacteria | 5747 |
| 163 | Ga0068851_10003337 | 3300005834 | Bacteria | 7137 |
| 164 | Ga0068851_10009207 | 3300005834 | Bacteria | 4584 |
| 165 | Ga0068851_10067607 | 3300005834 | Bacteria | 1843 |
| 166 | Ga0068851_10229395 | 3300005834 | Bacteria | 1046 |
| 167 | Ga0068863_100000281 | 3300005841 | Bacteria | 52492 |
| 168 | Ga0068863_100000696 | 3300005841 | Bacteria | 33755 |
| 169 | Ga0068863_100042175 | 3300005841 | Bacteria | 4335 |
| 170 | Ga0068863_100083239 | 3300005841 | Unclassified | 3032 |
| 171 | Ga0068863_100200341 | 3300005841 | Bacteria | 1920 |
| 172 | Ga0068863_100986875 | 3300005841 | Bacteria | 845 |
| 173 | Ga0068858_100001379 | 3300005842 | Bacteria | 25066 |
| 174 | Ga0068858_100006245 | 3300005842 | Bacteria | 11609 |
| 175 | Ga0068858_100072999 | 3300005842 | Unclassified | 3185 |
| 176 | Ga0068860_100000004 | 3300005843 | Bacteria | 506126 |
| 177 | Ga0068860_100004472 | 3300005843 | Bacteria | 14264 |
| 178 | Ga0068860_100005091 | 3300005843 | Bacteria | 13370 |
| 179 | Ga0068860_100007805 | 3300005843 | Bacteria | 10687 |
| 180 | Ga0068860_100035187 | 3300005843 | Bacteria | 4805 |
| 181 | Ga0068860_100260531 | 3300005843 | Bacteria | 1690 |
| 182 | Ga0068860_100339768 | 3300005843 | Bacteria | 1476 |
| 183 | Ga0068860_100837624 | 3300005843 | Unclassified | 934 |
| 184 | Ga0068860_101424780 | 3300005843 | Bacteria | 714 |
| 185 | Ga0068862_100082495 | 3300005844 | Bacteria | 2790 |
| 186 | Ga0068862_100467725 | 3300005844 | Bacteria | 1191 |
| 187 | Ga0068862_100851186 | 3300005844 | Unclassified | 894 |
| 188 | Ga0081455_10418787 | 3300005937 | Bacteria | 924 |
| 189 | Ga0081540_1012938 | 3300005983 | Bacteria | 5452 |
| 190 | Ga0075366_10003749 | 3300006195 | Bacteria | 8077 |
| 191 | Ga0075366_10528628 | 3300006195 | Bacteria | 730 |
| 192 | Ga0097621_100001082 | 3300006237 | Bacteria | 19034 |
| 193 | Ga0097621_100012160 | 3300006237 | Bacteria | 6371 |
| 194 | Ga0097621_100024579 | 3300006237 | Bacteria | 4706 |
| 195 | Ga0097621_100072652 | 3300006237 | Bacteria | 2846 |
| 196 | Ga0097621_100089110 | 3300006237 | Bacteria | 2579 |
| 197 | Ga0097621_100162038 | 3300006237 | Bacteria | 1923 |
| 198 | Ga0097621_100224101 | 3300006237 | Unclassified | 1639 |
| 199 | Ga0097621_100688198 | 3300006237 | Bacteria | 941 |
| 200 | Ga0097621_100823426 | 3300006237 | Bacteria | 861 |
| 201 | Ga0068871_100000076 | 3300006358 | Bacteria | 55186 |
| 202 | Ga0068871_100001571 | 3300006358 | Bacteria | 15344 |
| 203 | Ga0068871_100014842 | 3300006358 | Bacteria | 5819 |
| 204 | Ga0068871_100016263 | 3300006358 | Bacteria | 5597 |
| 205 | Ga0068871_100256799 | 3300006358 | Bacteria | 1523 |
| 206 | Ga0068871_100493263 | 3300006358 | Bacteria | 1103 |
| 207 | Ga0068871_101748345 | 3300006358 | Unclassified | 590 |
| 208 | Ga0068865_100002600 | 3300006881 | Bacteria | 10725 |
| 209 | Ga0068865_100043619 | 3300006881 | Bacteria | 3066 |
| 210 | Ga0068865_100046501 | 3300006881 | Unclassified | 2978 |
| 211 | Ga0068865_100869262 | 3300006881 | Bacteria | 782 |
| 212 | Ga0097620_100000163 | 3300006931 | Bacteria | 64401 |
| 213 | Ga0097620_100007600 | 3300006931 | Bacteria | 11015 |
| 214 | Ga0097620_100137784 | 3300006931 | Bacteria | 2514 |
| 215 | Ga0097620_100301290 | 3300006931 | Bacteria | 1696 |
| 216 | Ga0097620_100564692 | 3300006931 | Bacteria | 1232 |
| 217 | Ga0105240_10000061 | 3300009093 | Bacteria | 218897 |
| 218 | Ga0105240_10000087 | 3300009093 | Bacteria | 187637 |
| 219 | Ga0105240_10001401 | 3300009093 | Bacteria | 41397 |
| 220 | Ga0105240_10004570 | 3300009093 | Bacteria | 20988 |
| 221 | Ga0105240_10012560 | 3300009093 | Bacteria | 11682 |
| 222 | Ga0105240_10021348 | 3300009093 | Bacteria | 8613 |
| 223 | Ga0105240_10037251 | 3300009093 | Bacteria | 6252 |
| 224 | Ga0105240_10229541 | 3300009093 | Bacteria | 2158 |
| 225 | Ga0105240_10492485 | 3300009093 | Bacteria | 1364 |
| 226 | Ga0105240_10533042 | 3300009093 | Bacteria | 1301 |
| 227 | Ga0105240_10638222 | 3300009093 | Unclassified | 1169 |
| 228 | Ga0105240_11238485 | 3300009093 | Bacteria | 789 |
| 229 | Ga0111539_11462533 | 3300009094 | Bacteria | 792 |
| 230 | Ga0105245_10137294 | 3300009098 | Bacteria | 2299 |
| 231 | Ga0105247_10030304 | 3300009101 | Bacteria | 3278 |
| 232 | Ga0105247_10055978 | 3300009101 | Unclassified | 2435 |
| 233 | Ga0114129_10383048 | 3300009147 | Bacteria | 1857 |
| 234 | Ga0105241_10000776 | 3300009174 | Bacteria | 24269 |
| 235 | Ga0105241_10001165 | 3300009174 | Bacteria | 20006 |
| 236 | Ga0105241_10002324 | 3300009174 | Bacteria | 14278 |
| 237 | Ga0105241_10021855 | 3300009174 | Bacteria | 4735 |
| 238 | Ga0105241_10032888 | 3300009174 | Bacteria | 3890 |
| 239 | Ga0105241_10159399 | 3300009174 | Unclassified | 1853 |
| 240 | Ga0105241_10309581 | 3300009174 | Unclassified | 1358 |
| 241 | Ga0105242_10031097 | 3300009176 | Bacteria | 4262 |
| 242 | Ga0105242_10102408 | 3300009176 | Bacteria | 2428 |
| 243 | Ga0105248_10081319 | 3300009177 | Bacteria | 3641 |
| 244 | Ga0105248_10124603 | 3300009177 | Bacteria | 2907 |
| 245 | Ga0105237_10000377 | 3300009545 | Bacteria | 63580 |
| 246 | Ga0105237_10003363 | 3300009545 | Bacteria | 19043 |
| 247 | Ga0105237_10003655 | 3300009545 | Bacteria | 18145 |
| 248 | Ga0105237_10006545 | 3300009545 | Bacteria | 12887 |
| 249 | Ga0105237_10008725 | 3300009545 | Bacteria | 10946 |
| 250 | Ga0105237_10023189 | 3300009545 | Bacteria | 6362 |
| 251 | Ga0105237_10032771 | 3300009545 | Bacteria | 5261 |
| 252 | Ga0105237_10100761 | 3300009545 | Bacteria | 2880 |
| 253 | Ga0105237_10103591 | 3300009545 | Unclassified | 2838 |
| 254 | Ga0105237_10147269 | 3300009545 | Bacteria | 2350 |
| 255 | Ga0105237_10179821 | 3300009545 | Bacteria | 2115 |
| 256 | Ga0105237_10506697 | 3300009545 | Bacteria | 1214 |
| 257 | Ga0105237_10605405 | 3300009545 | Unclassified | 1103 |
| 258 | Ga0105237_10644038 | 3300009545 | Unclassified | 1066 |
| 259 | Ga0105237_10734961 | 3300009545 | Bacteria | 993 |
| 260 | Ga0105237_10972953 | 3300009545 | Unclassified | 855 |
| 261 | Ga0105238_10000725 | 3300009551 | Bacteria | 34423 |
| 262 | Ga0105238_10077843 | 3300009551 | Unclassified | 3307 |
| 263 | Ga0105238_10321410 | 3300009551 | Bacteria | 1534 |
| 264 | Ga0105238_10335318 | 3300009551 | Bacteria | 1500 |
| 265 | Ga0105238_10500504 | 3300009551 | Unclassified | 1216 |
| 266 | Ga0105238_11203939 | 3300009551 | Bacteria | 782 |
| 267 | Ga0105249_10001077 | 3300009553 | Bacteria | 24238 |
| 268 | Ga0105249_10006543 | 3300009553 | Bacteria | 10137 |
| 269 | Ga0105249_10216258 | 3300009553 | Bacteria | 1883 |
| 270 | Ga0105249_10227559 | 3300009553 | Bacteria | 1838 |
| 271 | Ga0105249_11620739 | 3300009553 | Unclassified | 720 |
| 272 | Ga0105239_10000029 | 3300010375 | Bacteria | 234749 |
| 273 | Ga0105239_10000122 | 3300010375 | Bacteria | 109167 |
| 274 | Ga0105239_10002610 | 3300010375 | Bacteria | 22800 |
| 275 | Ga0105239_10003762 | 3300010375 | Bacteria | 18452 |
| 276 | Ga0105239_10020310 | 3300010375 | Bacteria | 7327 |
| 277 | Ga0105239_10030473 | 3300010375 | Bacteria | 5930 |
| 278 | Ga0105239_10057406 | 3300010375 | Unclassified | 4269 |
| 279 | Ga0105239_10075981 | 3300010375 | Bacteria | 3694 |
| 280 | Ga0105239_10143397 | 3300010375 | Bacteria | 2663 |
| 281 | Ga0105239_10220534 | 3300010375 | Bacteria | 2127 |
| 282 | Ga0105239_10690100 | 3300010375 | Bacteria | 1167 |
| 283 | Ga0105246_10286815 | 3300011119 | Unclassified | 1323 |
| 284 | Ga0157373_10030712 | 3300013100 | Bacteria | 3866 |
| 285 | Ga0157373_10107677 | 3300013100 | Bacteria | 1960 |
| 286 | Ga0157371_10021734 | 3300013102 | Bacteria | 4708 |
| 287 | Ga0157371_10496130 | 3300013102 | Bacteria | 901 |
| 288 | Ga0157370_10004831 | 3300013104 | Bacteria | 15322 |
| 289 | Ga0157370_10008901 | 3300013104 | Bacteria | 10786 |
| 290 | Ga0157370_10010136 | 3300013104 | Bacteria | 9951 |
| 291 | Ga0157370_10022162 | 3300013104 | Bacteria | 6324 |
| 292 | Ga0157370_10634682 | 3300013104 | Bacteria | 977 |
| 293 | Ga0157369_10041773 | 3300013105 | Bacteria | 5005 |
| 294 | Ga0157369_10098769 | 3300013105 | Bacteria | 3112 |
| 295 | Ga0157369_10187806 | 3300013105 | Unclassified | 2172 |
| 296 | Ga0157369_10202195 | 3300013105 | Bacteria | 2085 |
| 297 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 298 | Ga0157374_10000399 | 3300013296 | Bacteria | 39374 |
| 299 | Ga0157374_10033808 | 3300013296 | Bacteria | 4667 |
| 300 | Ga0157374_10120836 | 3300013296 | Bacteria | 2528 |
| 301 | Ga0157374_10365623 | 3300013296 | Unclassified | 1435 |
| 302 | Ga0157374_10474019 | 3300013296 | Bacteria | 1254 |
| 303 | Ga0157378_10005736 | 3300013297 | Bacteria | 10871 |
| 304 | Ga0157378_10011030 | 3300013297 | Bacteria | 7909 |
| 305 | Ga0157378_10016461 | 3300013297 | Bacteria | 6476 |
| 306 | Ga0157378_10018702 | 3300013297 | Bacteria | 6090 |
| 307 | Ga0157378_10059428 | 3300013297 | Bacteria | 3411 |
| 308 | Ga0157378_10271589 | 3300013297 | Bacteria | 1631 |
| 309 | Ga0157378_10553141 | 3300013297 | Bacteria | 1156 |
| 310 | Ga0157378_10560931 | 3300013297 | Bacteria | 1149 |
| 311 | Ga0157378_11387574 | 3300013297 | Bacteria | 745 |
| 312 | Ga0163162_10000170 | 3300013306 | Bacteria | 60233 |
| 313 | Ga0163162_10000214 | 3300013306 | Bacteria | 53543 |
| 314 | Ga0163162_10000365 | 3300013306 | Bacteria | 41027 |
| 315 | Ga0163162_10000461 | 3300013306 | Bacteria | 37669 |
| 316 | Ga0163162_10000785 | 3300013306 | Bacteria | 29535 |
| 317 | Ga0163162_10003791 | 3300013306 | Bacteria | 14497 |
| 318 | Ga0163162_10017550 | 3300013306 | Bacteria | 7004 |
| 319 | Ga0163162_10045357 | 3300013306 | Bacteria | 4404 |
| 320 | Ga0163162_10128351 | 3300013306 | Bacteria | 2643 |
| 321 | Ga0163162_10174203 | 3300013306 | Bacteria | 2276 |
| 322 | Ga0163162_10979074 | 3300013306 | Bacteria | 956 |
| 323 | Ga0163162_12059746 | 3300013306 | Unclassified | 654 |
| 324 | Ga0157372_10000255 | 3300013307 | Bacteria | 58805 |
| 325 | Ga0157372_10003905 | 3300013307 | Bacteria | 16022 |
| 326 | Ga0157372_10058406 | 3300013307 | Bacteria | 4312 |
| 327 | Ga0157372_10062274 | 3300013307 | Bacteria | 4180 |
| 328 | Ga0157372_10112198 | 3300013307 | Unclassified | 3124 |
| 329 | Ga0157372_10181550 | 3300013307 | Bacteria | 2436 |
| 330 | Ga0157372_10189128 | 3300013307 | Bacteria | 2384 |
| 331 | Ga0157375_10000125 | 3300013308 | Bacteria | 75607 |
| 332 | Ga0157375_10000450 | 3300013308 | Bacteria | 37191 |
| 333 | Ga0157375_10076314 | 3300013308 | Unclassified | 3378 |
| 334 | Ga0157375_10106887 | 3300013308 | Bacteria | 2891 |
| 335 | Ga0157375_10387995 | 3300013308 | Unclassified | 1563 |
| 336 | Ga0157375_10526534 | 3300013308 | Bacteria | 1345 |
| 337 | Ga0157375_11756438 | 3300013308 | Bacteria | 735 |
| 338 | Ga0163163_10000281 | 3300014325 | Bacteria | 50719 |
| 339 | Ga0163163_10000761 | 3300014325 | Bacteria | 27429 |
| 340 | Ga0163163_10278215 | 3300014325 | Bacteria | 1725 |
| 341 | Ga0163163_10714526 | 3300014325 | Unclassified | 1066 |
| 342 | Ga0163163_11100747 | 3300014325 | Bacteria | 857 |
| 343 | Ga0163163_11397439 | 3300014325 | Bacteria | 762 |
| 344 | Ga0157377_10617100 | 3300014745 | Bacteria | 776 |
| 345 | Ga0157379_10000107 | 3300014968 | Bacteria | 57370 |
| 346 | Ga0157379_10027995 | 3300014968 | Bacteria | 5016 |
| 347 | Ga0157379_10133735 | 3300014968 | Bacteria | 2234 |
| 348 | Ga0157379_10947873 | 3300014968 | Bacteria | 818 |
| 349 | Ga0157376_10000336 | 3300014969 | Bacteria | 31351 |
| 350 | Ga0157376_10002516 | 3300014969 | Bacteria | 12416 |
| 351 | Ga0157376_10002763 | 3300014969 | Bacteria | 11980 |
| 352 | Ga0157376_10030967 | 3300014969 | Bacteria | 4278 |
| 353 | Ga0157376_10215890 | 3300014969 | Bacteria | 1774 |
| 354 | Ga0157376_10327012 | 3300014969 | Bacteria | 1459 |
| 355 | Ga0157376_10506707 | 3300014969 | Bacteria | 1187 |
| 356 | Ga0157376_10568200 | 3300014969 | Bacteria | 1124 |
| 357 | Ga0182005_1000040 | 3300015265 | Bacteria | 151222 |
| 358 | Ga0163161_10000612 | 3300017792 | Bacteria | 28547 |
| 359 | Ga0163161_10058150 | 3300017792 | Bacteria | 2810 |
| 360 | Ga0163161_10307145 | 3300017792 | Bacteria | 1251 |
| 361 | Ga0213876_10001420 | 3300021384 | Bacteria | 14922 |
| 362 | Ga0213876_10009849 | 3300021384 | Bacteria | 5142 |
| 363 | Ga0209436_101069 | 3300025208 | Bacteria | 10358 |
| 364 | Ga0209258_100075 | 3300025242 | Bacteria | 270751 |
| 365 | Ga0209646_1000025 | 3300025246 | Bacteria | 406493 |
| 366 | Ga0209646_1002484 | 3300025246 | Bacteria | 4057 |
| 367 | Ga0209026_1000189 | 3300025250 | Bacteria | 89924 |
| 368 | Ga0209148_1000085 | 3300025254 | Bacteria | 265193 |
| 369 | Ga0209673_1000197 | 3300025273 | Bacteria | 121313 |
| 370 | Ga0209130_1000540 | 3300025284 | Bacteria | 38066 |
| 371 | Ga0209564_1007802 | 3300025295 | Bacteria | 5433 |
| 372 | Ga0209758_1004263 | 3300025297 | Bacteria | 12084 |
| 373 | Ga0209758_1020046 | 3300025297 | Bacteria | 3185 |
| 374 | Ga0209758_1063479 | 3300025297 | Bacteria | 1203 |
| 375 | Ga0209050_1000204 | 3300025298 | Bacteria | 133087 |
| 376 | Ga0207426_1000057 | 3300025302 | Bacteria | 369548 |
| 377 | Ga0207426_1000332 | 3300025302 | Bacteria | 89192 |
| 378 | Ga0207426_1000647 | 3300025302 | Bacteria | 43103 |
| 379 | Ga0207426_1039109 | 3300025302 | Bacteria | 1489 |
| 380 | Ga0209051_1016604 | 3300025303 | Bacteria | 3322 |
| 381 | Ga0209257_1000004 | 3300025304 | Bacteria | 1678347 |
| 382 | Ga0209257_1001318 | 3300025304 | Bacteria | 30201 |
| 383 | Ga0207656_10004885 | 3300025321 | Bacteria | 4705 |
| 384 | Ga0207656_10018454 | 3300025321 | Unclassified | 2748 |
| 385 | Ga0207656_10043748 | 3300025321 | Unclassified | 1910 |
| 386 | Ga0207682_10080003 | 3300025893 | Bacteria | 1399 |
| 387 | Ga0207710_10031433 | 3300025900 | Bacteria | 2321 |
| 388 | Ga0207688_10011763 | 3300025901 | Bacteria | 4760 |
| 389 | Ga0207680_10000068 | 3300025903 | Bacteria | 45911 |
| 390 | Ga0207680_10003265 | 3300025903 | Bacteria | 7637 |
| 391 | Ga0207680_10076220 | 3300025903 | Unclassified | 2094 |
| 392 | Ga0207647_10000717 | 3300025904 | Bacteria | 25975 |
| 393 | Ga0207647_10030100 | 3300025904 | Bacteria | 3506 |
| 394 | Ga0207645_10001517 | 3300025907 | Bacteria | 18974 |
| 395 | Ga0207705_10003407 | 3300025909 | Bacteria | 12089 |
| 396 | Ga0207705_10132739 | 3300025909 | Bacteria | 1854 |
| 397 | Ga0207654_10003625 | 3300025911 | Bacteria | 7788 |
| 398 | Ga0207654_10004528 | 3300025911 | Bacteria | 7022 |
| 399 | Ga0207654_10016709 | 3300025911 | Bacteria | 3825 |
| 400 | Ga0207654_10142023 | 3300025911 | Bacteria | 1532 |
| 401 | Ga0207654_10240585 | 3300025911 | Bacteria | 1209 |
| 402 | Ga0207707_10000186 | 3300025912 | Bacteria | 65484 |
| 403 | Ga0207695_10000057 | 3300025913 | Bacteria | 376090 |
| 404 | Ga0207695_10000459 | 3300025913 | Bacteria | 88603 |
| 405 | Ga0207695_10000568 | 3300025913 | Bacteria | 75553 |
| 406 | Ga0207695_10003746 | 3300025913 | Bacteria | 21140 |
| 407 | Ga0207695_10010042 | 3300025913 | Bacteria | 11624 |
| 408 | Ga0207695_10010077 | 3300025913 | Bacteria | 11604 |
| 409 | Ga0207695_10013050 | 3300025913 | Bacteria | 9923 |
| 410 | Ga0207695_10069434 | 3300025913 | Bacteria | 3605 |
| 411 | Ga0207695_10138329 | 3300025913 | Unclassified | 2387 |
| 412 | Ga0207695_10149243 | 3300025913 | Bacteria | 2278 |
| 413 | Ga0207695_10588688 | 3300025913 | Unclassified | 994 |
| 414 | Ga0207695_10607717 | 3300025913 | Bacteria | 974 |
| 415 | Ga0207671_10000438 | 3300025914 | Bacteria | 57265 |
| 416 | Ga0207671_10003201 | 3300025914 | Bacteria | 16484 |
| 417 | Ga0207671_10003886 | 3300025914 | Bacteria | 14584 |
| 418 | Ga0207671_10006029 | 3300025914 | Bacteria | 10946 |
| 419 | Ga0207671_10008419 | 3300025914 | Bacteria | 8749 |
| 420 | Ga0207671_10009693 | 3300025914 | Bacteria | 8021 |
| 421 | Ga0207671_10032395 | 3300025914 | Unclassified | 3891 |
| 422 | Ga0207671_10100497 | 3300025914 | Bacteria | 2190 |
| 423 | Ga0207671_10123685 | 3300025914 | Bacteria | 1979 |
| 424 | Ga0207671_10280458 | 3300025914 | Bacteria | 1314 |
| 425 | Ga0207671_10418538 | 3300025914 | Unclassified | 1066 |
| 426 | Ga0207671_10429607 | 3300025914 | Bacteria | 1051 |
| 427 | Ga0207660_10001497 | 3300025917 | Bacteria | 15739 |
| 428 | Ga0207662_10102497 | 3300025918 | Bacteria | 1775 |
| 429 | Ga0207657_10735458 | 3300025919 | Bacteria | 765 |
| 430 | Ga0207652_10002640 | 3300025921 | Bacteria | 15042 |
| 431 | Ga0207652_10103818 | 3300025921 | Bacteria | 2513 |
| 432 | Ga0207681_10463442 | 3300025923 | Bacteria | 1033 |
| 433 | Ga0207694_10005144 | 3300025924 | Bacteria | 10096 |
| 434 | Ga0207694_10012647 | 3300025924 | Bacteria | 6358 |
| 435 | Ga0207694_10049911 | 3300025924 | Bacteria | 3239 |
| 436 | Ga0207694_10148195 | 3300025924 | Unclassified | 1890 |
| 437 | Ga0207650_10041236 | 3300025925 | Bacteria | 3381 |
| 438 | Ga0207650_10095431 | 3300025925 | Unclassified | 2280 |
| 439 | Ga0207650_10179981 | 3300025925 | Bacteria | 1684 |
| 440 | Ga0207650_10550499 | 3300025925 | Bacteria | 967 |
| 441 | Ga0207650_10595579 | 3300025925 | Bacteria | 929 |
| 442 | Ga0207650_10652551 | 3300025925 | Bacteria | 887 |
| 443 | Ga0207650_10847486 | 3300025925 | Bacteria | 775 |
| 444 | Ga0207650_11181487 | 3300025925 | Bacteria | 651 |
| 445 | Ga0207659_10279853 | 3300025926 | Bacteria | 1363 |
| 446 | Ga0207644_10012876 | 3300025931 | Bacteria | 5561 |
| 447 | Ga0207644_10024302 | 3300025931 | Bacteria | 4158 |
| 448 | Ga0207644_10088974 | 3300025931 | Bacteria | 2298 |
| 449 | Ga0207644_10104123 | 3300025931 | Unclassified | 2136 |
| 450 | Ga0207644_10348455 | 3300025931 | Bacteria | 1202 |
| 451 | Ga0207690_10514874 | 3300025932 | Bacteria | 969 |
| 452 | Ga0207706_10028304 | 3300025933 | Bacteria | 5005 |
| 453 | Ga0207706_10179897 | 3300025933 | Bacteria | 1857 |
| 454 | Ga0207686_10055656 | 3300025934 | Unclassified | 2483 |
| 455 | Ga0207686_10081205 | 3300025934 | Bacteria | 2116 |
| 456 | Ga0207709_10350577 | 3300025935 | Bacteria | 1114 |
| 457 | Ga0207669_11078510 | 3300025937 | Unclassified | 677 |
| 458 | Ga0207704_10001241 | 3300025938 | Bacteria | 11372 |
| 459 | Ga0207704_10015092 | 3300025938 | Bacteria | 3926 |
| 460 | Ga0207704_10345580 | 3300025938 | Bacteria | 1156 |
| 461 | Ga0207691_10000001 | 3300025940 | Bacteria | 220829 |
| 462 | Ga0207691_10059647 | 3300025940 | Bacteria | 3469 |
| 463 | Ga0207691_10915684 | 3300025940 | Unclassified | 734 |
| 464 | Ga0207711_10976615 | 3300025941 | Unclassified | 786 |
| 465 | Ga0207689_10001987 | 3300025942 | Bacteria | 19318 |
| 466 | Ga0207689_10045397 | 3300025942 | Unclassified | 3633 |
| 467 | Ga0207689_10295584 | 3300025942 | Bacteria | 1342 |
| 468 | Ga0207661_10053648 | 3300025944 | Bacteria | 3227 |
| 469 | Ga0207679_10063377 | 3300025945 | Bacteria | 2759 |
| 470 | Ga0207679_10064138 | 3300025945 | Bacteria | 2745 |
| 471 | Ga0207679_10622120 | 3300025945 | Bacteria | 975 |
| 472 | Ga0207667_10000133 | 3300025949 | Bacteria | 112994 |
| 473 | Ga0207667_10016999 | 3300025949 | Bacteria | 8205 |
| 474 | Ga0207667_10021922 | 3300025949 | Bacteria | 7071 |
| 475 | Ga0207667_10050811 | 3300025949 | Bacteria | 4373 |
| 476 | Ga0207667_10081758 | 3300025949 | Unclassified | 3346 |
| 477 | Ga0207667_10141097 | 3300025949 | Bacteria | 2481 |
| 478 | Ga0207667_10229187 | 3300025949 | Bacteria | 1903 |
| 479 | Ga0207667_10622970 | 3300025949 | Unclassified | 1086 |
| 480 | Ga0207667_10696112 | 3300025949 | Bacteria | 1019 |
| 481 | Ga0207651_10000927 | 3300025960 | Bacteria | 12937 |
| 482 | Ga0207651_10040230 | 3300025960 | Unclassified | 3090 |
| 483 | Ga0207651_10191884 | 3300025960 | Bacteria | 1630 |
| 484 | Ga0207651_10638082 | 3300025960 | Unclassified | 934 |
| 485 | Ga0207712_10016655 | 3300025961 | Bacteria | 4765 |
| 486 | Ga0207712_10074171 | 3300025961 | Unclassified | 2456 |
| 487 | Ga0207712_10189518 | 3300025961 | Bacteria | 1622 |
| 488 | Ga0207712_10229528 | 3300025961 | Unclassified | 1489 |
| 489 | Ga0207668_10004515 | 3300025972 | Bacteria | 8183 |
| 490 | Ga0207668_10071386 | 3300025972 | Unclassified | 2480 |
| 491 | Ga0207640_10044612 | 3300025981 | Bacteria | 2842 |
| 492 | Ga0207640_10119279 | 3300025981 | Bacteria | 1886 |
| 493 | Ga0207640_10409148 | 3300025981 | Unclassified | 1107 |
| 494 | Ga0207658_10002225 | 3300025986 | Bacteria | 14396 |
| 495 | Ga0207658_10030704 | 3300025986 | Bacteria | 3808 |
| 496 | Ga0207658_10097378 | 3300025986 | Unclassified | 2296 |
| 497 | Ga0207658_10218341 | 3300025986 | Unclassified | 1602 |
| 498 | Ga0207658_10863776 | 3300025986 | Unclassified | 823 |
| 499 | Ga0207677_10031471 | 3300026023 | Unclassified | 3398 |
| 500 | Ga0207703_10000541 | 3300026035 | Bacteria | 38865 |
| 501 | Ga0207703_10013325 | 3300026035 | Bacteria | 6407 |
| 502 | Ga0207639_10010449 | 3300026041 | Bacteria | 6431 |
| 503 | Ga0207639_10013895 | 3300026041 | Bacteria | 5647 |
| 504 | Ga0207639_10015128 | 3300026041 | Bacteria | 5437 |
| 505 | Ga0207639_10061396 | 3300026041 | Bacteria | 2903 |
| 506 | Ga0207639_10076756 | 3300026041 | Unclassified | 2632 |
| 507 | Ga0207639_10142609 | 3300026041 | Bacteria | 1998 |
| 508 | Ga0207639_10224040 | 3300026041 | Unclassified | 1626 |
| 509 | Ga0207639_10240071 | 3300026041 | Bacteria | 1575 |
| 510 | Ga0207639_10304178 | 3300026041 | Bacteria | 1410 |
| 511 | Ga0207639_10309906 | 3300026041 | Bacteria | 1398 |
| 512 | Ga0207639_11214595 | 3300026041 | Bacteria | 708 |
| 513 | Ga0207678_10156274 | 3300026067 | Bacteria | 1947 |
| 514 | Ga0207702_10037878 | 3300026078 | Bacteria | 4038 |
| 515 | Ga0207702_10099818 | 3300026078 | Bacteria | 2560 |
| 516 | Ga0207702_10140155 | 3300026078 | Bacteria | 2187 |
| 517 | Ga0207702_10440278 | 3300026078 | Bacteria | 1263 |
| 518 | Ga0207641_10000176 | 3300026088 | Bacteria | 88863 |
| 519 | Ga0207641_10020855 | 3300026088 | Bacteria | 5386 |
| 520 | Ga0207641_10028806 | 3300026088 | Bacteria | 4591 |
| 521 | Ga0207641_10369454 | 3300026088 | Unclassified | 1371 |
| 522 | Ga0207641_10381008 | 3300026088 | Bacteria | 1351 |
| 523 | Ga0207648_10002236 | 3300026089 | Bacteria | 20960 |
| 524 | Ga0207648_10267431 | 3300026089 | Unclassified | 1527 |
| 525 | Ga0207648_10402070 | 3300026089 | Bacteria | 1241 |
| 526 | Ga0207648_10857483 | 3300026089 | Unclassified | 847 |
| 527 | Ga0207648_10957274 | 3300026089 | Bacteria | 801 |
| 528 | Ga0207648_11102928 | 3300026089 | Unclassified | 744 |
| 529 | Ga0207648_11392437 | 3300026089 | Bacteria | 659 |
| 530 | Ga0207676_10003381 | 3300026095 | Bacteria | 11283 |
| 531 | Ga0207676_10056279 | 3300026095 | Unclassified | 3091 |
| 532 | Ga0207676_10076300 | 3300026095 | Bacteria | 2708 |
| 533 | Ga0207676_10369206 | 3300026095 | Bacteria | 1332 |
| 534 | Ga0207674_10003956 | 3300026116 | Bacteria | 18014 |
| 535 | Ga0207674_10134951 | 3300026116 | Bacteria | 2430 |
| 536 | Ga0207674_10146596 | 3300026116 | Bacteria | 2319 |
| 537 | Ga0207674_10809301 | 3300026116 | Bacteria | 904 |
| 538 | Ga0207675_100011131 | 3300026118 | Bacteria | 8427 |
| 539 | Ga0207683_10040207 | 3300026121 | Bacteria | 4079 |
| 540 | Ga0207683_10267855 | 3300026121 | Unclassified | 1560 |
| 541 | Ga0207683_10346391 | 3300026121 | Bacteria | 1363 |
| 542 | Ga0207698_10173606 | 3300026142 | Bacteria | 1901 |
| 543 | Ga0207698_10541785 | 3300026142 | Bacteria | 1139 |
| 544 | Ga0207698_11084130 | 3300026142 | Unclassified | 813 |
| 545 | Ga0268266_10000065 | 3300028379 | Bacteria | 246498 |
| 546 | Ga0268266_10004508 | 3300028379 | Bacteria | 13311 |
| 547 | Ga0268265_10138189 | 3300028380 | Bacteria | 2036 |
| 548 | Ga0268264_10000011 | 3300028381 | Bacteria | 580884 |
| 549 | Ga0268264_10002016 | 3300028381 | Bacteria | 18236 |
| 550 | Ga0268264_10005470 | 3300028381 | Bacteria | 10768 |
| 551 | Ga0268264_10011914 | 3300028381 | Bacteria | 7162 |
| 552 | Ga0268264_10086984 | 3300028381 | Bacteria | 2686 |
| 553 | Ga0268264_10191606 | 3300028381 | Bacteria | 1864 |
| 554 | Ga0268264_10468491 | 3300028381 | Bacteria | 1223 |
| 555 | Ga0268264_10651066 | 3300028381 | Bacteria | 1043 |
| 556 | Ga0268264_10773221 | 3300028381 | Unclassified | 958 |
| 557 | Ga0265337_1078310 | 3300028556 | Bacteria | 905 |
| 558 | Ga0307517_10002935 | 3300028786 | Bacteria | 26992 |
| 559 | Ga0307517_10229909 | 3300028786 | Unclassified | 1115 |
| 560 | Ga0307515_10000002 | 3300028794 | Bacteria | 1231751 |
| 561 | Ga0307515_10000107 | 3300028794 | Bacteria | 197046 |
| 562 | Ga0307511_10000930 | 3300030521 | Bacteria | 30913 |
| 563 | Ga0265327_10000148 | 3300031251 | Bacteria | 151952 |
| 564 | Ga0265327_10009240 | 3300031251 | Bacteria | 7147 |
| 565 | Ga0307513_10047118 | 3300031456 | Bacteria | 4692 |
| 566 | Ga0307513_10150285 | 3300031456 | Bacteria | 2239 |
| 567 | Ga0307513_10528508 | 3300031456 | Bacteria | 894 |
| 568 | Ga0307513_10591996 | 3300031456 | Bacteria | 819 |
| 569 | Ga0307509_10040553 | 3300031507 | Bacteria | 5064 |
| 570 | Ga0307509_10101603 | 3300031507 | Bacteria | 2910 |
| 571 | Ga0307509_10356072 | 3300031507 | Unclassified | 1185 |
| 572 | Ga0265313_10051177 | 3300031595 | Bacteria | 1978 |
| 573 | Ga0307516_10000944 | 3300031730 | Bacteria | 40084 |
| 574 | Ga0307409_100101291 | 3300031995 | Bacteria | 2390 |
| 575 | Ga0307414_10403293 | 3300032004 | Bacteria | 1188 |
| 576 | Ga0307510_10004875 | 3300033180 | Bacteria | 15869 |
| 577 | Ga0373943_0074867 | 3300035170 | Unclassified | 1723 |
| 578 | Ga0373955_0536105 | 3300035172 | Bacteria | 716 |
| 579 | Ga0373935_0400889 | 3300035692 | Unclassified | 985 |
| 580 | Ga0373927_0037405 | 3300035695 | Bacteria | 3155 |
| 581 | Ga0373937_0248875 | 3300036401 | Bacteria | 1675 |
| 582 | Ga0373937_0914510 | 3300036401 | Bacteria | 826 |
| 583 | Ga0373937_1481369 | 3300036401 | Bacteria | 626 |
| 584 | Ga0373925_0503246 | 3300037068 | Bacteria | 995 |
| 585 | Ga0436365_0180273 | 3300039437 | Bacteria | 11023 |
| 586 | Ga0436365_0316569 | 3300039437 | Bacteria | 800 |
| 587 | Ga0436365_0920295 | 3300039437 | Bacteria | 45426 |
| 588 | Ga0439439_0000810 | 3300041406 | Bacteria | 5687 |
| 589 | Ga0451795_0607167 | 3300041456 | Bacteria | 1298 |
| 590 | Ga0451853_1580363 | 3300041512 | Bacteria | 1982 |
| 591 | Ga0451853_1589815 | 3300041512 | Bacteria | 1407 |
| 592 | Ga0451853_3965068 | 3300041512 | Bacteria | 2031 |
| 593 | Ga0439431_0000493 | 3300041997 | Bacteria | 8352 |
| 594 | Ga0439431_0087441 | 3300041997 | Bacteria | 846 |
| 595 | Ga0439449_0011315 | 3300042007 | Bacteria | 3358 |
| 596 | Ga0439449_0039835 | 3300042007 | Bacteria | 1747 |
| 597 | Ga0439457_000066 | 3300042014 | Bacteria | 22683 |
| 598 | Ga0439462_0005485 | 3300042015 | Bacteria | 3127 |
| 599 | Ga0439434_0106645 | 3300042435 | Bacteria | 905 |
| 600 | Ga0451577_0508365 | 3300042876 | Unclassified | 1094 |
| 601 | Ga0466969_0000004 | 3300044656 | Bacteria | 168068 |
| 602 | Ga0466969_0264517 | 3300044656 | Unclassified | 779 |
| 603 | Ga0466972_0000017 | 3300044658 | Bacteria | 199884 |
| 604 | Ga0466972_0008593 | 3300044658 | Bacteria | 5123 |
| 605 | Ga0466972_0036057 | 3300044658 | Bacteria | 2421 |
| 606 | Ga0466966_0000295 | 3300044684 | Bacteria | 32723 |
| 607 | Ga0466966_0057735 | 3300044684 | Unclassified | 2454 |
| 608 | Ga0466961_0083778 | 3300044693 | Bacteria | 2017 |
| 609 | Ga0466964_0110189 | 3300044706 | Bacteria | 1226 |
| 610 | Ga0453684_0007222 | 3300044712 | Bacteria | 20597 |
| 611 | Ga0453684_0350822 | 3300044712 | Bacteria | 1664 |
| 612 | Ga0466968_0018094 | 3300044735 | Bacteria | 2824 |
| 613 | Ga0466968_0056743 | 3300044735 | Bacteria | 1683 |
| 614 | Ga0466970_0047636 | 3300044765 | Unclassified | 2285 |
| 615 | Ga0466957_0000760 | 3300044842 | Bacteria | 16415 |
| 616 | Ga0466957_0049972 | 3300044842 | Unclassified | 2544 |
| 617 | Ga0466960_0229387 | 3300044901 | Bacteria | 1024 |
| 618 | Ga0466959_0000004 | 3300045049 | Bacteria | 216815 |
| 619 | Ga0466959_0004206 | 3300045049 | Bacteria | 9589 |
| 620 | Ga0466958_0034417 | 3300045836 | Bacteria | 3022 |
| 621 | Ga0466967_0104447 | 3300045976 | Bacteria | 2594 |
| 622 | Ga0495627_019703 | 3300046453 | Bacteria | 2257 |
| 623 | Ga0495638_0015366 | 3300046460 | Bacteria | 5143 |
| 624 | Ga0495638_0173362 | 3300046460 | Bacteria | 1236 |
| 625 | Ga0495650_0031148 | 3300046471 | Bacteria | 2405 |
| 626 | Ga0495650_0033688 | 3300046471 | Bacteria | 2277 |
| 627 | Ga0495580_0056085 | 3300046472 | Bacteria | 2775 |
| 628 | Ga0495639_0135047 | 3300046475 | Unclassified | 1183 |
| 629 | Ga0495664_0122192 | 3300046477 | Unclassified | 1575 |
| 630 | Ga0495606_0079825 | 3300046507 | Bacteria | 2037 |
| 631 | Ga0495608_0335022 | 3300046511 | Unclassified | 933 |
| 632 | Ga0495630_0126267 | 3300046517 | Bacteria | 1941 |
| 633 | Ga0495632_0196590 | 3300046519 | Bacteria | 920 |
| 634 | Ga0495648_0015274 | 3300046524 | Bacteria | 5584 |
| 635 | Ga0495665_0324442 | 3300046531 | Unclassified | 786 |
| 636 | Ga0495633_0000017 | 3300046558 | Bacteria | 249973 |
| 637 | Ga0495633_0040974 | 3300046558 | Bacteria | 2204 |
| 638 | Ga0495668_0000321 | 3300046616 | Bacteria | 65700 |
| 639 | Ga0495668_0008554 | 3300046616 | Bacteria | 6374 |
| 640 | Ga0495634_0214590 | 3300046642 | Unclassified | 1190 |
| 641 | Ga0495611_0000021 | 3300046648 | Bacteria | 123657 |
| 642 | Ga0495625_0016880 | 3300046660 | Bacteria | 5731 |
| 643 | Ga0495625_0385957 | 3300046660 | Unclassified | 878 |
| 644 | Ga0495625_0604034 | 3300046660 | Unclassified | 658 |
| 645 | Ga0495646_0275272 | 3300046680 | Bacteria | 896 |
| 646 | Ga0495647_0223937 | 3300046681 | Unclassified | 831 |
| 647 | Ga0495613_0076208 | 3300046689 | Bacteria | 2441 |
| 648 | Ga0495670_0019468 | 3300046691 | Bacteria | 3345 |
| 649 | Ga0495600_0572303 | 3300046809 | Bacteria | 689 |
| 650 | Ga0495674_0137385 | 3300047319 | Unclassified | 2056 |
| 651 | Ga0495672_0044759 | 3300047320 | Bacteria | 2653 |
| 652 | Ga0495672_0154754 | 3300047320 | Bacteria | 1185 |
| 653 | Ga0495676_0628625 | 3300047321 | Unclassified | 698 |
| 654 | Ga0495687_000006 | 3300047443 | Bacteria | 571936 |
| 655 | Ga0495686_0000094 | 3300047472 | Bacteria | 187720 |
| 656 | Ga0496100_0019465 | 3300048903 | Bacteria | 4051 |
| 657 | Ga0496101_0064741 | 3300048904 | Bacteria | 2664 |
| 658 | Ga0496102_0146727 | 3300048905 | Bacteria | 2215 |
| 659 | Ga0496102_0248525 | 3300048905 | Unclassified | 1677 |
| 660 | Ga0496104_0168150 | 3300048907 | Unclassified | 2103 |
| 661 | Ga0496105_0510239 | 3300048908 | Unclassified | 943 |
| 662 | Ga0496106_0152137 | 3300048909 | Bacteria | 1826 |
| 663 | Ga0496108_0570406 | 3300048911 | Bacteria | 987 |
| 664 | Ga0496109_0577778 | 3300048912 | Bacteria | 1059 |
| 665 | Ga0496110_0220632 | 3300048913 | Bacteria | 1724 |
| 666 | Ga0496114_0027530 | 3300048917 | Unclassified | 4657 |
| 667 | Ga0496115_0028703 | 3300048918 | Bacteria | 4363 |
| 668 | Ga0496121_0000010 | 3300048924 | Bacteria | 793488 |
| 669 | Ga0496126_0018857 | 3300048929 | Bacteria | 6819 |
| 670 | Ga0501300_026701 | 3300049523 | Bacteria | 848 |
| 671 | Ga0501032_0045288 | 3300049569 | Unclassified | 2976 |
| 672 | Ga0501033_0213273 | 3300049570 | Bacteria | 1376 |
| 673 | Ga0501034_0003578 | 3300049571 | Bacteria | 17643 |
| 674 | Ga0501034_0004335 | 3300049571 | Bacteria | 15811 |
| 675 | Ga0501034_0005604 | 3300049571 | Bacteria | 13677 |
| 676 | Ga0501034_0083863 | 3300049571 | Bacteria | 3189 |
| 677 | Ga0501034_0220674 | 3300049571 | Bacteria | 1848 |
| 678 | Ga0501034_0239107 | 3300049571 | Bacteria | 1762 |
| 679 | Ga0501034_0467604 | 3300049571 | Bacteria | 1177 |
| 680 | Ga0501037_0070932 | 3300049573 | Unclassified | 2535 |
| 681 | Ga0501039_0649991 | 3300049575 | Bacteria | 826 |
| 682 | Ga0501043_0108914 | 3300049579 | Unclassified | 2175 |
| 683 | Ga0501047_0028890 | 3300049581 | Bacteria | 5349 |
| 684 | Ga0501047_0044570 | 3300049581 | Bacteria | 4286 |
| 685 | Ga0501047_0165516 | 3300049581 | Unclassified | 2082 |
| 686 | Ga0501223_000312 | 3300049663 | Bacteria | 12052 |
| 687 | Ga0501238_016463 | 3300049671 | Bacteria | 1025 |
| 688 | Ga0501238_050383 | 3300049671 | Bacteria | 624 |
| 689 | Ga0501219_000278 | 3300049703 | Bacteria | 9092 |
| 690 | Ga0501225_0002394 | 3300049705 | Bacteria | 5791 |
| 691 | Ga0501080_0111512 | 3300049742 | Bacteria | 2536 |
| 692 | Ga0501080_0406706 | 3300049742 | Bacteria | 1224 |
| 693 | Ga0501241_000755 | 3300049758 | Bacteria | 6963 |
| 694 | Ga0501035_0201245 | 3300049822 | Bacteria | 1708 |
| 695 | Ga0501035_0927534 | 3300049822 | Unclassified | 688 |
| 696 | Ga0501044_0033488 | 3300049823 | Bacteria | 5400 |
| 697 | Ga0501044_0052856 | 3300049823 | Bacteria | 4182 |
| 698 | Ga0501044_0213032 | 3300049823 | Bacteria | 1885 |
| 699 | Ga0501044_0530478 | 3300049823 | Bacteria | 1076 |
| 700 | Ga0501044_0645088 | 3300049823 | Bacteria | 948 |
| 701 | Ga0501284_00005 | 3300050005 | Bacteria | 164758 |
| 702 | nmdc:mga0k408_32120_c1 | 3300050493 | Bacteria | 2999 |
| 703 | nmdc:mga0k408_4366_c2 | 3300050493 | Bacteria | 3670 |
| 704 | nmdc:mga05p37_101574_c1 | 3300050507 | Bacteria | 3541 |
| 705 | Ga0495619_0041541 | 3300053085 | Bacteria | 3009 |
| 706 | Ga0500578_0000814 | 3300053086 | Bacteria | 36228 |
| 707 | Ga0500578_0029296 | 3300053086 | Bacteria | 3536 |
| 708 | Ga0500578_0390778 | 3300053086 | Bacteria | 804 |
| 709 | Ga0500644_0000233 | 3300053088 | Bacteria | 31422 |
| 710 | Ga0500646_0033642 | 3300053090 | Bacteria | 1419 |
| 711 | Ga0500646_0037946 | 3300053090 | Bacteria | 1347 |
| 712 | Ga0500583_0000062 | 3300053092 | Bacteria | 67892 |
| 713 | Ga0500583_0003491 | 3300053092 | Bacteria | 4950 |
| 714 | Ga0500583_0018893 | 3300053092 | Bacteria | 2813 |
| 715 | Ga0500583_0022594 | 3300053092 | Bacteria | 2637 |
| 716 | Ga0500651_0079726 | 3300053093 | Bacteria | 2029 |
| 717 | Ga0500651_0113014 | 3300053093 | Bacteria | 1656 |
| 718 | Ga0500556_0042230 | 3300053104 | Bacteria | 1612 |
| 719 | Ga0500556_0097226 | 3300053104 | Bacteria | 1131 |
| 720 | Ga0500569_000386 | 3300053109 | Bacteria | 7142 |
| 721 | Ga0500594_0085698 | 3300053118 | Bacteria | 949 |
| 722 | Ga0500594_0117595 | 3300053118 | Bacteria | 832 |
| 723 | Ga0500628_013038 | 3300053129 | Bacteria | 1544 |
| 724 | Ga0500642_0021523 | 3300053130 | Bacteria | 2555 |
| 725 | Ga0500652_017178 | 3300053131 | Bacteria | 2649 |
| 726 | Ga0500655_007478 | 3300053133 | Bacteria | 1965 |
| 727 | Ga0500658_0006742 | 3300053134 | Bacteria | 4248 |
| 728 | Ga0500658_0152586 | 3300053134 | Bacteria | 1042 |
| 729 | Ga0500658_0278522 | 3300053134 | Bacteria | 769 |
| 730 | Ga0500559_0029668 | 3300053136 | Unclassified | 2343 |
| 731 | Ga0500559_0033973 | 3300053136 | Bacteria | 2198 |
| 732 | Ga0500559_0297002 | 3300053136 | Bacteria | 759 |
| 733 | Ga0500561_0030505 | 3300053137 | Bacteria | 1355 |
| 734 | Ga0500577_0000835 | 3300053142 | Bacteria | 7971 |
| 735 | Ga0500577_0296508 | 3300053142 | Bacteria | 706 |
| 736 | Ga0500588_0004802 | 3300053146 | Bacteria | 2952 |
| 737 | Ga0500588_0070548 | 3300053146 | Unclassified | 1144 |
| 738 | Ga0500589_027510 | 3300053147 | Bacteria | 2641 |
| 739 | Ga0500603_015406 | 3300053150 | Bacteria | 1799 |
| 740 | Ga0500604_0005577 | 3300053151 | Bacteria | 3322 |
| 741 | Ga0500616_0032438 | 3300053153 | Bacteria | 2856 |
| 742 | Ga0500619_047819 | 3300053154 | Bacteria | 1376 |
| 743 | Ga0500622_0000319 | 3300053156 | Bacteria | 48315 |
| 744 | Ga0500622_0004146 | 3300053156 | Bacteria | 9278 |
| 745 | Ga0500622_0033424 | 3300053156 | Bacteria | 2697 |
| 746 | Ga0500622_0227446 | 3300053156 | Bacteria | 832 |
| 747 | Ga0500633_0000218 | 3300053160 | Bacteria | 8074 |
| 748 | Ga0500634_0133068 | 3300053161 | Bacteria | 1190 |
| 749 | Ga0500636_0329410 | 3300053177 | Bacteria | 738 |
| 750 | Ga0500637_0047445 | 3300053178 | Unclassified | 2440 |
| 751 | Ga0500637_0096756 | 3300053178 | Bacteria | 1711 |
| 752 | Ga0500637_0157346 | 3300053178 | Bacteria | 1311 |
| 753 | Ga0500661_039163 | 3300055283 | Bacteria | 839 |
| 754 | Ga0500661_039871 | 3300055283 | Bacteria | 831 |
| 755 | Ga0587090_057691 | 3300059510 | Bacteria | 728 |
| 756 | Ga0466962_0046035 | 3300061719 | Unclassified | 2085 |
| 757 | 2738724487 | 2738541278 | Bacteria | 9755573 |
| 758 | 2819572039 | 2818991442 | Bacteria | 8318214 |
| 759 | 2819677812 | 2818991460 | Bacteria | 7595395 |
| 760 | 2821141716 | 2821136567 | Bacteria | 8080116 |
| 761 | 2839991863 | 2839989709 | Bacteria | 3773432 |
| 762 | 2883073130 | 2883068021 | Bacteria | 6192739 |
| 763 | 2884797761 | 2884791551 | Bacteria | 8511252 |
| 764 | 2890806986 | 2890804823 | Bacteria | 3717572 |
| 765 | 2896087450 | 2896085136 | Bacteria | 6129793 |
| 766 | 2896114804 | 2896109856 | Bacteria | 7140722 |
| 767 | 2904469869 | 2904467357 | Bacteria | 8057758 |
| 768 | 2910246681 | 2910245624 | Bacteria | 6935613 |
| 769 | 2929245324 | 2929239360 | Bacteria | 7745570 |
| 770 | 2929927566 | 2929921140 | Bacteria | 8649150 |
| 771 | 2945979149 | 2945977869 | Bacteria | 7777518 |
| 772 | 2946014987 | 2946013367 | Bacteria | 7766675 |
| 773 | 8003151414 | 8003151029 | Bacteria | 8187759 |
| 774 | Ga0466970_0222261 | |||
| 775 | CNXas_1006850 | |||
| 776 | JGI24739J22299_10007316 | |||
| 777 | JGI24743J22301_10078264 | |||
| 778 | JGI25154J39366_1000004 | |||
| 779 | JGI25157J39369_1012508 | |||
| 780 | JGI25153J46596_10002511 | |||
| 781 | JGI25153J46596_10016838 | |||
| 782 | rootH1_10052946 | |||
| 783 | rootH1_10097560 | |||
| 784 | rootH2_10009025 | |||
| 785 | rootH2_10049413 | |||
| 786 | rootH2_10082932 | |||
| 787 | rootH2_10088799 | |||
| 788 | rootL2_10002103 | |||
| 789 | rootL2_10118243 | |||
| 790 | rootL2_10161687 | |||
| 791 | rootL2_10190022 | |||
| 792 | rootL2_10316744 | |||
| 793 | rootH1_10005517 | |||
| 794 | rootH1_10044609 | |||
| 795 | rootH1_10097553 | |||
| 796 | rootH1_10136237 | |||
| 797 | rootH1_10219635 | |||
| 798 | JGI25160J50197_1004814 | |||
| 799 | JGI25160J50197_1007518 | |||
| 800 | Ga0055542_1006351 | |||
| 801 | Ga0055528_1000663 | |||
| 802 | Ga0055530_10002672 | |||
| 803 | Ga0055531_10000171 | |||
| 804 | Ga0065165_1000503 | |||
| 805 | Ga0065165_1004318 | |||
| 806 | Ga0065165_1063152 | |||
| 807 | Ga0065704_10174357 | |||
| 808 | Ga0065712_10142270 | |||
| 809 | Ga0065712_10149970 | |||
| 810 | Ga0065715_10291611 | |||
| 811 | Ga0070658_10000526 | |||
| 812 | Ga0070658_10016658 | |||
| 813 | Ga0070658_10596992 | |||
| 814 | Ga0070676_10006484 | |||
| 815 | Ga0070683_100078858 | |||
| 816 | Ga0070683_100218468 | |||
| 817 | Ga0070670_100056311 | |||
| 818 | Ga0070670_100097783 | |||
| 819 | Ga0070670_100102345 | |||
| 820 | Ga0070670_100105346 | |||
| 821 | Ga0070670_100106421 | |||
| 822 | Ga0070670_101315574 | |||
| 823 | Ga0068869_100052369 | |||
| 824 | Ga0068869_100095978 | |||
| 825 | Ga0068869_100498591 | |||
| 826 | Ga0068869_100823745 | |||
| 827 | Ga0070666_10000165 | |||
| 828 | Ga0070666_10005184 | |||
| 829 | Ga0070666_10110656 | |||
| 830 | Ga0070666_10231958 | |||
| 831 | Ga0070666_10288128 | |||
| 832 | Ga0070680_100000079 | |||
| 833 | Ga0070682_100000037 | |||
| 834 | Ga0070682_100059539 | |||
| 835 | Ga0070682_100111418 | |||
| 836 | Ga0068868_100000064 | |||
| 837 | Ga0068868_100013122 | |||
| 838 | Ga0068868_100016798 | |||
| 839 | Ga0068868_100489735 | |||
| 840 | Ga0070691_10001320 | |||
| 841 | Ga0070668_100005340 | |||
| 842 | Ga0070668_101341578 | |||
| 843 | Ga0070675_100077152 | |||
| 844 | Ga0070671_100014859 | |||
| 845 | Ga0070671_100154150 | |||
| 846 | Ga0070671_100213266 | |||
| 847 | Ga0070671_100298392 | |||
| 848 | Ga0070671_100484050 | |||
| 849 | Ga0070671_101169732 | |||
| 850 | Ga0070673_100000225 | |||
| 851 | Ga0070673_100066236 | |||
| 852 | Ga0070673_100640124 | |||
| 853 | Ga0070659_100135562 | |||
| 854 | Ga0070667_100000557 | |||
| 855 | Ga0070667_100012935 | |||
| 856 | Ga0070667_100069557 | |||
| 857 | Ga0070667_100098632 | |||
| 858 | Ga0070667_100146966 | |||
| 859 | Ga0070667_100440041 | |||
| 860 | Ga0070667_100479913 | |||
| 861 | Ga0070663_101007672 | |||
| 862 | Ga0070678_100332182 | |||
| 863 | Ga0070678_100422086 | |||
| 864 | Ga0070662_100014952 | |||
| 865 | Ga0070681_10026471 | |||
| 866 | Ga0070681_10039494 | |||
| 867 | Ga0068867_100002721 | |||
| 868 | Ga0068867_100155730 | |||
| 869 | Ga0068867_100844266 | |||
| 870 | Ga0068867_100993992 | |||
| 871 | Ga0068867_101140596 | |||
| 872 | Ga0070685_10094145 | |||
| 873 | Ga0070707_100482598 | |||
| 874 | Ga0070698_101251224 | |||
| 875 | Ga0070699_100405290 | |||
| 876 | Ga0070679_100015634 | |||
| 877 | Ga0070684_100000916 | |||
| 878 | Ga0068853_100002721 | |||
| 879 | Ga0068853_100013829 | |||
| 880 | Ga0068853_100044966 | |||
| 881 | Ga0068853_100047572 | |||
| 882 | Ga0068853_100077605 | |||
| 883 | Ga0068853_100120463 | |||
| 884 | Ga0068853_100148886 | |||
| 885 | Ga0068853_100220163 | |||
| 886 | Ga0068853_100279812 | |||
| 887 | Ga0070672_100000052 | |||
| 888 | Ga0070672_100042644 | |||
| 889 | Ga0070672_100173215 | |||
| 890 | Ga0070686_100316532 | |||
| 891 | Ga0070693_100827059 | |||
| 892 | Ga0070665_100000001 | |||
| 893 | Ga0070665_100000903 | |||
| 894 | Ga0068855_100000210 | |||
| 895 | Ga0068855_100019394 | |||
| 896 | Ga0068855_100084561 | |||
| 897 | Ga0068855_100135938 | |||
| 898 | Ga0068855_100191869 | |||
| 899 | Ga0068855_100464613 | |||
| 900 | Ga0068855_100777592 | |||
| 901 | Ga0070664_100017672 | |||
| 902 | Ga0070664_100093595 | |||
| 903 | Ga0070664_100107927 | |||
| 904 | Ga0070664_100390039 | |||
| 905 | Ga0070664_100695736 | |||
| 906 | Ga0068857_100140977 | |||
| 907 | Ga0068857_100244652 | |||
| 908 | Ga0068857_100797522 | |||
| 909 | Ga0068857_100866758 | |||
| 910 | Ga0068854_100020995 | |||
| 911 | Ga0068854_100058792 | |||
| 912 | Ga0068854_100151850 | |||
| 913 | Ga0068854_100541747 | |||
| 914 | Ga0068854_100800855 | |||
| 915 | Ga0068854_101025771 | |||
| 916 | Ga0068856_100041773 | |||
| 917 | Ga0068856_100171762 | |||
| 918 | Ga0068856_100399315 | |||
| 919 | Ga0070702_100000948 | |||
| 920 | Ga0068852_100006110 | |||
| 921 | Ga0068852_100098925 | |||
| 922 | Ga0068852_100196692 | |||
| 923 | Ga0068852_100586514 | |||
| 924 | Ga0068852_101049235 | |||
| 925 | Ga0068852_101138078 | |||
| 926 | Ga0068859_100000163 | |||
| 927 | Ga0068859_100007600 | |||
| 928 | Ga0068859_100137784 | |||
| 929 | Ga0068859_100301301 | |||
| 930 | Ga0068859_100564662 | |||
| 931 | Ga0068864_100001080 | |||
| 932 | Ga0068864_100006105 | |||
| 933 | Ga0068864_100997685 | |||
| 934 | Ga0068866_10142289 | |||
| 935 | Ga0068861_100013360 | |||
| 936 | Ga0068851_10003337 | |||
| 937 | Ga0068851_10009207 | |||
| 938 | Ga0068851_10067607 | |||
| 939 | Ga0068851_10229395 | |||
| 940 | Ga0068863_100000281 | |||
| 941 | Ga0068863_100000696 | |||
| 942 | Ga0068863_100042175 | |||
| 943 | Ga0068863_100083239 | |||
| 944 | Ga0068863_100200341 | |||
| 945 | Ga0068863_100986875 | |||
| 946 | Ga0068858_100001379 | |||
| 947 | Ga0068858_100006245 | |||
| 948 | Ga0068858_100072999 | |||
| 949 | Ga0068860_100000004 | |||
| 950 | Ga0068860_100004472 | |||
| 951 | Ga0068860_100005091 | |||
| 952 | Ga0068860_100007805 | |||
| 953 | Ga0068860_100035187 | |||
| 954 | Ga0068860_100260531 | |||
| 955 | Ga0068860_100339768 | |||
| 956 | Ga0068860_100837624 | |||
| 957 | Ga0068860_101424780 | |||
| 958 | Ga0068862_100082495 | |||
| 959 | Ga0068862_100467725 | |||
| 960 | Ga0068862_100851186 | |||
| 961 | Ga0081455_10418787 | |||
| 962 | Ga0081540_1012938 | |||
| 963 | Ga0075366_10003749 | |||
| 964 | Ga0075366_10528628 | |||
| 965 | Ga0097621_100001082 | |||
| 966 | Ga0097621_100012160 | |||
| 967 | Ga0097621_100024579 | |||
| 968 | Ga0097621_100072652 | |||
| 969 | Ga0097621_100089110 | |||
| 970 | Ga0097621_100162038 | |||
| 971 | Ga0097621_100224101 | |||
| 972 | Ga0097621_100688198 | |||
| 973 | Ga0097621_100823426 | |||
| 974 | Ga0068871_100000076 | |||
| 975 | Ga0068871_100001571 | |||
| 976 | Ga0068871_100014842 | |||
| 977 | Ga0068871_100016263 | |||
| 978 | Ga0068871_100256799 | |||
| 979 | Ga0068871_100493263 | |||
| 980 | Ga0068871_101748345 | |||
| 981 | Ga0068865_100002600 | |||
| 982 | Ga0068865_100043619 | |||
| 983 | Ga0068865_100046501 | |||
| 984 | Ga0068865_100869262 | |||
| 985 | Ga0097620_100000163 | |||
| 986 | Ga0097620_100007600 | |||
| 987 | Ga0097620_100137784 | |||
| 988 | Ga0097620_100301290 | |||
| 989 | Ga0097620_100564692 | |||
| 990 | Ga0105240_10000061 | |||
| 991 | Ga0105240_10000087 | |||
| 992 | Ga0105240_10001401 | |||
| 993 | Ga0105240_10004570 | |||
| 994 | Ga0105240_10012560 | |||
| 995 | Ga0105240_10021348 | |||
| 996 | Ga0105240_10037251 | |||
| 997 | Ga0105240_10229541 | |||
| 998 | Ga0105240_10492485 | |||
| 999 | Ga0105240_10533042 | |||
| 1000 | Ga0105240_10638222 | |||
| 1001 | Ga0105240_11238485 | |||
| 1002 | Ga0111539_11462533 | |||
| 1003 | Ga0105245_10137294 | |||
| 1004 | Ga0105247_10030304 | |||
| 1005 | Ga0105247_10055978 | |||
| 1006 | Ga0114129_10383048 | |||
| 1007 | Ga0105241_10000776 | |||
| 1008 | Ga0105241_10001165 | |||
| 1009 | Ga0105241_10002324 | |||
| 1010 | Ga0105241_10021855 | |||
| 1011 | Ga0105241_10032888 | |||
| 1012 | Ga0105241_10159399 | |||
| 1013 | Ga0105241_10309581 | |||
| 1014 | Ga0105242_10031097 | |||
| 1015 | Ga0105242_10102408 | |||
| 1016 | Ga0105248_10081319 | |||
| 1017 | Ga0105248_10124603 | |||
| 1018 | Ga0105237_10000377 | |||
| 1019 | Ga0105237_10003363 | |||
| 1020 | Ga0105237_10003655 | |||
| 1021 | Ga0105237_10006545 | |||
| 1022 | Ga0105237_10008725 | |||
| 1023 | Ga0105237_10023189 | |||
| 1024 | Ga0105237_10032771 | |||
| 1025 | Ga0105237_10100761 | |||
| 1026 | Ga0105237_10103591 | |||
| 1027 | Ga0105237_10147269 | |||
| 1028 | Ga0105237_10179821 | |||
| 1029 | Ga0105237_10506697 | |||
| 1030 | Ga0105237_10605405 | |||
| 1031 | Ga0105237_10644038 | |||
| 1032 | Ga0105237_10734961 | |||
| 1033 | Ga0105237_10972953 | |||
| 1034 | Ga0105238_10000725 | |||
| 1035 | Ga0105238_10077843 | |||
| 1036 | Ga0105238_10321410 | |||
| 1037 | Ga0105238_10335318 | |||
| 1038 | Ga0105238_10500504 | |||
| 1039 | Ga0105238_11203939 | |||
| 1040 | Ga0105249_10001077 | |||
| 1041 | Ga0105249_10006543 | |||
| 1042 | Ga0105249_10216258 | |||
| 1043 | Ga0105249_10227559 | |||
| 1044 | Ga0105249_11620739 | |||
| 1045 | Ga0105239_10000029 | |||
| 1046 | Ga0105239_10000122 | |||
| 1047 | Ga0105239_10002610 | |||
| 1048 | Ga0105239_10003762 | |||
| 1049 | Ga0105239_10020310 | |||
| 1050 | Ga0105239_10030473 | |||
| 1051 | Ga0105239_10057406 | |||
| 1052 | Ga0105239_10075981 | |||
| 1053 | Ga0105239_10143397 | |||
| 1054 | Ga0105239_10220534 | |||
| 1055 | Ga0105239_10690100 | |||
| 1056 | Ga0105246_10286815 | |||
| 1057 | Ga0157373_10030712 | |||
| 1058 | Ga0157373_10107677 | |||
| 1059 | Ga0157371_10021734 | |||
| 1060 | Ga0157371_10496130 | |||
| 1061 | Ga0157370_10004831 | |||
| 1062 | Ga0157370_10008901 | |||
| 1063 | Ga0157370_10010136 | |||
| 1064 | Ga0157370_10022162 | |||
| 1065 | Ga0157370_10634682 | |||
| 1066 | Ga0157369_10041773 | |||
| 1067 | Ga0157369_10098769 | |||
| 1068 | Ga0157369_10187806 | |||
| 1069 | Ga0157369_10202195 | |||
| 1070 | Ga0157374_10000001 | |||
| 1071 | Ga0157374_10000399 | |||
| 1072 | Ga0157374_10033808 | |||
| 1073 | Ga0157374_10120836 | |||
| 1074 | Ga0157374_10365623 | |||
| 1075 | Ga0157374_10474019 | |||
| 1076 | Ga0157378_10005736 | |||
| 1077 | Ga0157378_10011030 | |||
| 1078 | Ga0157378_10016461 | |||
| 1079 | Ga0157378_10018702 | |||
| 1080 | Ga0157378_10059428 | |||
| 1081 | Ga0157378_10271589 | |||
| 1082 | Ga0157378_10553141 | |||
| 1083 | Ga0157378_10560931 | |||
| 1084 | Ga0157378_11387574 | |||
| 1085 | Ga0163162_10000170 | |||
| 1086 | Ga0163162_10000214 | |||
| 1087 | Ga0163162_10000365 | |||
| 1088 | Ga0163162_10000461 | |||
| 1089 | Ga0163162_10000785 | |||
| 1090 | Ga0163162_10003791 | |||
| 1091 | Ga0163162_10017550 | |||
| 1092 | Ga0163162_10045357 | |||
| 1093 | Ga0163162_10128351 | |||
| 1094 | Ga0163162_10174203 | |||
| 1095 | Ga0163162_10979074 | |||
| 1096 | Ga0163162_12059746 | |||
| 1097 | Ga0157372_10000255 | |||
| 1098 | Ga0157372_10003905 | |||
| 1099 | Ga0157372_10058406 | |||
| 1100 | Ga0157372_10062274 | |||
| 1101 | Ga0157372_10112198 | |||
| 1102 | Ga0157372_10181550 | |||
| 1103 | Ga0157372_10189128 | |||
| 1104 | Ga0157375_10000125 | |||
| 1105 | Ga0157375_10000450 | |||
| 1106 | Ga0157375_10076314 | |||
| 1107 | Ga0157375_10106887 | |||
| 1108 | Ga0157375_10387995 | |||
| 1109 | Ga0157375_10526534 | |||
| 1110 | Ga0157375_11756438 | |||
| 1111 | Ga0163163_10000281 | |||
| 1112 | Ga0163163_10000761 | |||
| 1113 | Ga0163163_10278215 | |||
| 1114 | Ga0163163_10714526 | |||
| 1115 | Ga0163163_11100747 | |||
| 1116 | Ga0163163_11397439 | |||
| 1117 | Ga0157377_10617100 | |||
| 1118 | Ga0157379_10000107 | |||
| 1119 | Ga0157379_10027995 | |||
| 1120 | Ga0157379_10133735 | |||
| 1121 | Ga0157379_10947873 | |||
| 1122 | Ga0157376_10000336 | |||
| 1123 | Ga0157376_10002516 | |||
| 1124 | Ga0157376_10002763 | |||
| 1125 | Ga0157376_10030967 | |||
| 1126 | Ga0157376_10215890 | |||
| 1127 | Ga0157376_10327012 | |||
| 1128 | Ga0157376_10506707 | |||
| 1129 | Ga0157376_10568200 | |||
| 1130 | Ga0182005_1000040 | |||
| 1131 | Ga0163161_10000612 | |||
| 1132 | Ga0163161_10058150 | |||
| 1133 | Ga0163161_10307145 | |||
| 1134 | Ga0213876_10001420 | |||
| 1135 | Ga0213876_10009849 | |||
| 1136 | Ga0209436_101069 | |||
| 1137 | Ga0209258_100075 | |||
| 1138 | Ga0209646_1000025 | |||
| 1139 | Ga0209646_1002484 | |||
| 1140 | Ga0209026_1000189 | |||
| 1141 | Ga0209148_1000085 | |||
| 1142 | Ga0209673_1000197 | |||
| 1143 | Ga0209130_1000540 | |||
| 1144 | Ga0209564_1007802 | |||
| 1145 | Ga0209758_1004263 | |||
| 1146 | Ga0209758_1020046 | |||
| 1147 | Ga0209758_1063479 | |||
| 1148 | Ga0209050_1000204 | |||
| 1149 | Ga0207426_1000057 | |||
| 1150 | Ga0207426_1000332 | |||
| 1151 | Ga0207426_1000647 | |||
| 1152 | Ga0207426_1039109 | |||
| 1153 | Ga0209051_1016604 | |||
| 1154 | Ga0209257_1000004 | |||
| 1155 | Ga0209257_1001318 | |||
| 1156 | Ga0207656_10004885 | |||
| 1157 | Ga0207656_10018454 | |||
| 1158 | Ga0207656_10043748 | |||
| 1159 | Ga0207682_10080003 | |||
| 1160 | Ga0207710_10031433 | |||
| 1161 | Ga0207688_10011763 | |||
| 1162 | Ga0207680_10000068 | |||
| 1163 | Ga0207680_10003265 | |||
| 1164 | Ga0207680_10076220 | |||
| 1165 | Ga0207647_10000717 | |||
| 1166 | Ga0207647_10030100 | |||
| 1167 | Ga0207645_10001517 | |||
| 1168 | Ga0207705_10003407 | |||
| 1169 | Ga0207705_10132739 | |||
| 1170 | Ga0207654_10003625 | |||
| 1171 | Ga0207654_10004528 | |||
| 1172 | Ga0207654_10016709 | |||
| 1173 | Ga0207654_10142023 | |||
| 1174 | Ga0207654_10240585 | |||
| 1175 | Ga0207707_10000186 | |||
| 1176 | Ga0207695_10000057 | |||
| 1177 | Ga0207695_10000459 | |||
| 1178 | Ga0207695_10000568 | |||
| 1179 | Ga0207695_10003746 | |||
| 1180 | Ga0207695_10010042 | |||
| 1181 | Ga0207695_10010077 | |||
| 1182 | Ga0207695_10013050 | |||
| 1183 | Ga0207695_10069434 | |||
| 1184 | Ga0207695_10138329 | |||
| 1185 | Ga0207695_10149243 | |||
| 1186 | Ga0207695_10588688 | |||
| 1187 | Ga0207695_10607717 | |||
| 1188 | Ga0207671_10000438 | |||
| 1189 | Ga0207671_10003201 | |||
| 1190 | Ga0207671_10003886 | |||
| 1191 | Ga0207671_10006029 | |||
| 1192 | Ga0207671_10008419 | |||
| 1193 | Ga0207671_10009693 | |||
| 1194 | Ga0207671_10032395 | |||
| 1195 | Ga0207671_10100497 | |||
| 1196 | Ga0207671_10123685 | |||
| 1197 | Ga0207671_10280458 | |||
| 1198 | Ga0207671_10418538 | |||
| 1199 | Ga0207671_10429607 | |||
| 1200 | Ga0207660_10001497 | |||
| 1201 | Ga0207662_10102497 | |||
| 1202 | Ga0207657_10735458 | |||
| 1203 | Ga0207652_10002640 | |||
| 1204 | Ga0207652_10103818 | |||
| 1205 | Ga0207681_10463442 | |||
| 1206 | Ga0207694_10005144 | |||
| 1207 | Ga0207694_10012647 | |||
| 1208 | Ga0207694_10049911 | |||
| 1209 | Ga0207694_10148195 | |||
| 1210 | Ga0207650_10041236 | |||
| 1211 | Ga0207650_10095431 | |||
| 1212 | Ga0207650_10179981 | |||
| 1213 | Ga0207650_10550499 | |||
| 1214 | Ga0207650_10595579 | |||
| 1215 | Ga0207650_10652551 | |||
| 1216 | Ga0207650_10847486 | |||
| 1217 | Ga0207650_11181487 | |||
| 1218 | Ga0207659_10279853 | |||
| 1219 | Ga0207644_10012876 | |||
| 1220 | Ga0207644_10024302 | |||
| 1221 | Ga0207644_10088974 | |||
| 1222 | Ga0207644_10104123 | |||
| 1223 | Ga0207644_10348455 | |||
| 1224 | Ga0207690_10514874 | |||
| 1225 | Ga0207706_10028304 | |||
| 1226 | Ga0207706_10179897 | |||
| 1227 | Ga0207686_10055656 | |||
| 1228 | Ga0207686_10081205 | |||
| 1229 | Ga0207709_10350577 | |||
| 1230 | Ga0207669_11078510 | |||
| 1231 | Ga0207704_10001241 | |||
| 1232 | Ga0207704_10015092 | |||
| 1233 | Ga0207704_10345580 | |||
| 1234 | Ga0207691_10000001 | |||
| 1235 | Ga0207691_10059647 | |||
| 1236 | Ga0207691_10915684 | |||
| 1237 | Ga0207711_10976615 | |||
| 1238 | Ga0207689_10001987 | |||
| 1239 | Ga0207689_10045397 | |||
| 1240 | Ga0207689_10295584 | |||
| 1241 | Ga0207661_10053648 | |||
| 1242 | Ga0207679_10063377 | |||
| 1243 | Ga0207679_10064138 | |||
| 1244 | Ga0207679_10622120 | |||
| 1245 | Ga0207667_10000133 | |||
| 1246 | Ga0207667_10016999 | |||
| 1247 | Ga0207667_10021922 | |||
| 1248 | Ga0207667_10050811 | |||
| 1249 | Ga0207667_10081758 | |||
| 1250 | Ga0207667_10141097 | |||
| 1251 | Ga0207667_10229187 | |||
| 1252 | Ga0207667_10622970 | |||
| 1253 | Ga0207667_10696112 | |||
| 1254 | Ga0207651_10000927 | |||
| 1255 | Ga0207651_10040230 | |||
| 1256 | Ga0207651_10191884 | |||
| 1257 | Ga0207651_10638082 | |||
| 1258 | Ga0207712_10016655 | |||
| 1259 | Ga0207712_10074171 | |||
| 1260 | Ga0207712_10189518 | |||
| 1261 | Ga0207712_10229528 | |||
| 1262 | Ga0207668_10004515 | |||
| 1263 | Ga0207668_10071386 | |||
| 1264 | Ga0207640_10044612 | |||
| 1265 | Ga0207640_10119279 | |||
| 1266 | Ga0207640_10409148 | |||
| 1267 | Ga0207658_10002225 | |||
| 1268 | Ga0207658_10030704 | |||
| 1269 | Ga0207658_10097378 | |||
| 1270 | Ga0207658_10218341 | |||
| 1271 | Ga0207658_10863776 | |||
| 1272 | Ga0207677_10031471 | |||
| 1273 | Ga0207703_10000541 | |||
| 1274 | Ga0207703_10013325 | |||
| 1275 | Ga0207639_10010449 | |||
| 1276 | Ga0207639_10013895 | |||
| 1277 | Ga0207639_10015128 | |||
| 1278 | Ga0207639_10061396 | |||
| 1279 | Ga0207639_10076756 | |||
| 1280 | Ga0207639_10142609 | |||
| 1281 | Ga0207639_10224040 | |||
| 1282 | Ga0207639_10240071 | |||
| 1283 | Ga0207639_10304178 | |||
| 1284 | Ga0207639_10309906 | |||
| 1285 | Ga0207639_11214595 | |||
| 1286 | Ga0207678_10156274 | |||
| 1287 | Ga0207702_10037878 | |||
| 1288 | Ga0207702_10099818 | |||
| 1289 | Ga0207702_10140155 | |||
| 1290 | Ga0207702_10440278 | |||
| 1291 | Ga0207641_10000176 | |||
| 1292 | Ga0207641_10020855 | |||
| 1293 | Ga0207641_10028806 | |||
| 1294 | Ga0207641_10369454 | |||
| 1295 | Ga0207641_10381008 | |||
| 1296 | Ga0207648_10002236 | |||
| 1297 | Ga0207648_10267431 | |||
| 1298 | Ga0207648_10402070 | |||
| 1299 | Ga0207648_10857483 | |||
| 1300 | Ga0207648_10957274 | |||
| 1301 | Ga0207648_11102928 | |||
| 1302 | Ga0207648_11392437 | |||
| 1303 | Ga0207676_10003381 | |||
| 1304 | Ga0207676_10056279 | |||
| 1305 | Ga0207676_10076300 | |||
| 1306 | Ga0207676_10369206 | |||
| 1307 | Ga0207674_10003956 | |||
| 1308 | Ga0207674_10134951 | |||
| 1309 | Ga0207674_10146596 | |||
| 1310 | Ga0207674_10809301 | |||
| 1311 | Ga0207675_100011131 | |||
| 1312 | Ga0207683_10040207 | |||
| 1313 | Ga0207683_10267855 | |||
| 1314 | Ga0207683_10346391 | |||
| 1315 | Ga0207698_10173606 | |||
| 1316 | Ga0207698_10541785 | |||
| 1317 | Ga0207698_11084130 | |||
| 1318 | Ga0268266_10000065 | |||
| 1319 | Ga0268266_10004508 | |||
| 1320 | Ga0268265_10138189 | |||
| 1321 | Ga0268264_10000011 | |||
| 1322 | Ga0268264_10002016 | |||
| 1323 | Ga0268264_10005470 | |||
| 1324 | Ga0268264_10011914 | |||
| 1325 | Ga0268264_10086984 | |||
| 1326 | Ga0268264_10191606 | |||
| 1327 | Ga0268264_10468491 | |||
| 1328 | Ga0268264_10651066 | |||
| 1329 | Ga0268264_10773221 | |||
| 1330 | Ga0265337_1078310 | |||
| 1331 | Ga0307517_10002935 | |||
| 1332 | Ga0307517_10229909 | |||
| 1333 | Ga0307515_10000002 | |||
| 1334 | Ga0307515_10000107 | |||
| 1335 | Ga0307511_10000930 | |||
| 1336 | Ga0265327_10000148 | |||
| 1337 | Ga0265327_10009240 | |||
| 1338 | Ga0307513_10047118 | |||
| 1339 | Ga0307513_10150285 | |||
| 1340 | Ga0307513_10528508 | |||
| 1341 | Ga0307513_10591996 | |||
| 1342 | Ga0307509_10040553 | |||
| 1343 | Ga0307509_10101603 | |||
| 1344 | Ga0307509_10356072 | |||
| 1345 | Ga0265313_10051177 | |||
| 1346 | Ga0307516_10000944 | |||
| 1347 | Ga0307409_100101291 | |||
| 1348 | Ga0307414_10403293 | |||
| 1349 | Ga0307510_10004875 | |||
| 1350 | Ga0373943_0074867 | |||
| 1351 | Ga0373955_0536105 | |||
| 1352 | Ga0373935_0400889 | |||
| 1353 | Ga0373927_0037405 | |||
| 1354 | Ga0373937_0248875 | |||
| 1355 | Ga0373937_0914510 | |||
| 1356 | Ga0373937_1481369 | |||
| 1357 | Ga0373925_0503246 | |||
| 1358 | Ga0436365_0180273 | |||
| 1359 | Ga0436365_0316569 | |||
| 1360 | Ga0436365_0920295 | |||
| 1361 | Ga0439439_0000810 | |||
| 1362 | Ga0451795_0607167 | |||
| 1363 | Ga0451853_1580363 | |||
| 1364 | Ga0451853_1589815 | |||
| 1365 | Ga0451853_3965068 | |||
| 1366 | Ga0439431_0000493 | |||
| 1367 | Ga0439431_0087441 | |||
| 1368 | Ga0439449_0011315 | |||
| 1369 | Ga0439449_0039835 | |||
| 1370 | Ga0439457_000066 | |||
| 1371 | Ga0439462_0005485 | |||
| 1372 | Ga0439434_0106645 | |||
| 1373 | Ga0451577_0508365 | |||
| 1374 | Ga0466969_0000004 | |||
| 1375 | Ga0466969_0264517 | |||
| 1376 | Ga0466972_0000017 | |||
| 1377 | Ga0466972_0008593 | |||
| 1378 | Ga0466972_0036057 | |||
| 1379 | Ga0466966_0000295 | |||
| 1380 | Ga0466966_0057735 | |||
| 1381 | Ga0466961_0083778 | |||
| 1382 | Ga0466964_0110189 | |||
| 1383 | Ga0453684_0007222 | |||
| 1384 | Ga0453684_0350822 | |||
| 1385 | Ga0466968_0018094 | |||
| 1386 | Ga0466968_0056743 | |||
| 1387 | Ga0466970_0047636 | |||
| 1388 | Ga0466957_0000760 | |||
| 1389 | Ga0466957_0049972 | |||
| 1390 | Ga0466960_0229387 | |||
| 1391 | Ga0466959_0000004 | |||
| 1392 | Ga0466959_0004206 | |||
| 1393 | Ga0466958_0034417 | |||
| 1394 | Ga0466967_0104447 | |||
| 1395 | Ga0495627_019703 | |||
| 1396 | Ga0495638_0015366 | |||
| 1397 | Ga0495638_0173362 | |||
| 1398 | Ga0495650_0031148 | |||
| 1399 | Ga0495650_0033688 | |||
| 1400 | Ga0495580_0056085 | |||
| 1401 | Ga0495639_0135047 | |||
| 1402 | Ga0495664_0122192 | |||
| 1403 | Ga0495606_0079825 | |||
| 1404 | Ga0495608_0335022 | |||
| 1405 | Ga0495630_0126267 | |||
| 1406 | Ga0495632_0196590 | |||
| 1407 | Ga0495648_0015274 | |||
| 1408 | Ga0495665_0324442 | |||
| 1409 | Ga0495633_0000017 | |||
| 1410 | Ga0495633_0040974 | |||
| 1411 | Ga0495668_0000321 | |||
| 1412 | Ga0495668_0008554 | |||
| 1413 | Ga0495634_0214590 | |||
| 1414 | Ga0495611_0000021 | |||
| 1415 | Ga0495625_0016880 | |||
| 1416 | Ga0495625_0385957 | |||
| 1417 | Ga0495625_0604034 | |||
| 1418 | Ga0495646_0275272 | |||
| 1419 | Ga0495647_0223937 | |||
| 1420 | Ga0495613_0076208 | |||
| 1421 | Ga0495670_0019468 | |||
| 1422 | Ga0495600_0572303 | |||
| 1423 | Ga0495674_0137385 | |||
| 1424 | Ga0495672_0044759 | |||
| 1425 | Ga0495672_0154754 | |||
| 1426 | Ga0495676_0628625 | |||
| 1427 | Ga0495687_000006 | |||
| 1428 | Ga0495686_0000094 | |||
| 1429 | Ga0496100_0019465 | |||
| 1430 | Ga0496101_0064741 | |||
| 1431 | Ga0496102_0146727 | |||
| 1432 | Ga0496102_0248525 | |||
| 1433 | Ga0496104_0168150 | |||
| 1434 | Ga0496105_0510239 | |||
| 1435 | Ga0496106_0152137 | |||
| 1436 | Ga0496108_0570406 | |||
| 1437 | Ga0496109_0577778 | |||
| 1438 | Ga0496110_0220632 | |||
| 1439 | Ga0496114_0027530 | |||
| 1440 | Ga0496115_0028703 | |||
| 1441 | Ga0496121_0000010 | |||
| 1442 | Ga0496126_0018857 | |||
| 1443 | Ga0501300_026701 | |||
| 1444 | Ga0501032_0045288 | |||
| 1445 | Ga0501033_0213273 | |||
| 1446 | Ga0501034_0003578 | |||
| 1447 | Ga0501034_0004335 | |||
| 1448 | Ga0501034_0005604 | |||
| 1449 | Ga0501034_0083863 | |||
| 1450 | Ga0501034_0220674 | |||
| 1451 | Ga0501034_0239107 | |||
| 1452 | Ga0501034_0467604 | |||
| 1453 | Ga0501037_0070932 | |||
| 1454 | Ga0501039_0649991 | |||
| 1455 | Ga0501043_0108914 | |||
| 1456 | Ga0501047_0028890 | |||
| 1457 | Ga0501047_0044570 | |||
| 1458 | Ga0501047_0165516 | |||
| 1459 | Ga0501223_000312 | |||
| 1460 | Ga0501238_016463 | |||
| 1461 | Ga0501238_050383 | |||
| 1462 | Ga0501219_000278 | |||
| 1463 | Ga0501225_0002394 | |||
| 1464 | Ga0501080_0111512 | |||
| 1465 | Ga0501080_0406706 | |||
| 1466 | Ga0501241_000755 | |||
| 1467 | Ga0501035_0201245 | |||
| 1468 | Ga0501035_0927534 | |||
| 1469 | Ga0501044_0033488 | |||
| 1470 | Ga0501044_0052856 | |||
| 1471 | Ga0501044_0213032 | |||
| 1472 | Ga0501044_0530478 | |||
| 1473 | Ga0501044_0645088 | |||
| 1474 | Ga0501284_00005 | |||
| 1475 | nmdc:mga0k408_32120_c1 | |||
| 1476 | nmdc:mga0k408_4366_c2 | |||
| 1477 | nmdc:mga05p37_101574_c1 | |||
| 1478 | Ga0495619_0041541 | |||
| 1479 | Ga0500578_0000814 | |||
| 1480 | Ga0500578_0029296 | |||
| 1481 | Ga0500578_0390778 | |||
| 1482 | Ga0500644_0000233 | |||
| 1483 | Ga0500646_0033642 | |||
| 1484 | Ga0500646_0037946 | |||
| 1485 | Ga0500583_0000062 | |||
| 1486 | Ga0500583_0003491 | |||
| 1487 | Ga0500583_0018893 | |||
| 1488 | Ga0500583_0022594 | |||
| 1489 | Ga0500651_0079726 | |||
| 1490 | Ga0500651_0113014 | |||
| 1491 | Ga0500556_0042230 | |||
| 1492 | Ga0500556_0097226 | |||
| 1493 | Ga0500569_000386 | |||
| 1494 | Ga0500594_0085698 | |||
| 1495 | Ga0500594_0117595 | |||
| 1496 | Ga0500628_013038 | |||
| 1497 | Ga0500642_0021523 | |||
| 1498 | Ga0500652_017178 | |||
| 1499 | Ga0500655_007478 | |||
| 1500 | Ga0500658_0006742 | |||
| 1501 | Ga0500658_0152586 | |||
| 1502 | Ga0500658_0278522 | |||
| 1503 | Ga0500559_0029668 | |||
| 1504 | Ga0500559_0033973 | |||
| 1505 | Ga0500559_0297002 | |||
| 1506 | Ga0500561_0030505 | |||
| 1507 | Ga0500577_0000835 | |||
| 1508 | Ga0500577_0296508 | |||
| 1509 | Ga0500588_0004802 | |||
| 1510 | Ga0500588_0070548 | |||
| 1511 | Ga0500589_027510 | |||
| 1512 | Ga0500603_015406 | |||
| 1513 | Ga0500604_0005577 | |||
| 1514 | Ga0500616_0032438 | |||
| 1515 | Ga0500619_047819 | |||
| 1516 | Ga0500622_0000319 | |||
| 1517 | Ga0500622_0004146 | |||
| 1518 | Ga0500622_0033424 | |||
| 1519 | Ga0500622_0227446 | |||
| 1520 | Ga0500633_0000218 | |||
| 1521 | Ga0500634_0133068 | |||
| 1522 | Ga0500636_0329410 | |||
| 1523 | Ga0500637_0047445 | |||
| 1524 | Ga0500637_0096756 | |||
| 1525 | Ga0500637_0157346 | |||
| 1526 | Ga0500661_039163 | |||
| 1527 | Ga0500661_039871 | |||
| 1528 | Ga0587090_057691 | |||
| 1529 | Ga0466962_0046035 | |||
| 1530 | 2738724487 | |||
| 1531 | 2819572039 | |||
| 1532 | 2819677812 | |||
| 1533 | 2821141716 | |||
| 1534 | 2839991863 | |||
| 1535 | 2883073130 | |||
| 1536 | 2884797761 | |||
| 1537 | 2890806986 | |||
| 1538 | 2896087450 | |||
| 1539 | 2896114804 | |||
| 1540 | 2904469869 | |||
| 1541 | 2910246681 | |||
| 1542 | 2929245324 | |||
| 1543 | 2929927566 | |||
| 1544 | 2945979149 | |||
| 1545 | 2946014987 | |||
| 1546 | 8003151414 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6igs-assembly2.cif.gz_D | crystal structure of hprt from f. tularensis with zinc | 0.9592 | 10 | 176 |
| 3o7m-assembly1.cif.gz_D | 1.98 angstrom resolution crystal structure of a hypoxanthine-guanine phosphoribosyltransferase (hpt-2) from bacillus anthracis str. 'ames ancestor' | 0.9459 | 12 | 176 |
| 4qri-assembly1.cif.gz_A | 2.35 angstrom resolution crystal structure of hypoxanthine-guanine-xanthine phosphoribosyltransferase from leptospira interrogans serovar copenhageni str. fiocruz l1-130 | 0.9452 | 10 | 177 |
| 6d9r-assembly1.cif.gz_B | the substrate-bound crystal structure of hprt (hypoxanthine phosphoribosyltransferase) | 0.9403 | 11 | 176 |
| 1j7j-assembly2.cif.gz_B | crystal structure of the hprt from salmonella typhimurium | 0.9397 | 10 | 177 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4qriB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9325 | 10 | 178 | 3.40.50.2020 |
| 1hgxB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9228 | 11 | 177 | 3.40.50.2020 |
| af_Q9NF11_2_214_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9213 | 12 | 176 | 3.40.50.2020 |
| 4qriB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9092 | 10 | 178 | 3.40.50.2020 |
| 4rhtD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9006 | 11 | 177 | 3.40.50.2020 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5C7Q9A5-F1-model_v4 | deleted | 0.9872 | 3 | 177 |
|
| AF-A0A4U6D3V6-F1-model_v4 | Hypoxanthine phosphoribosyltransferase (EC 2.4.2.8) | 0.9868 | 3 | 177 |
GO:0000166
GO:0000287 GO:0004422 GO:0005829 GO:0006166 GO:0006178 GO:0032263 GO:0032264 GO:0046100 GO:0052657 |
| AF-A0A1I1PEH0-F1-model_v4 | Hypoxanthine phosphoribosyltransferase (EC 2.4.2.8) | 0.9852 | 1 | 176 |
GO:0000166
GO:0000287 GO:0004422 GO:0005829 GO:0006166 GO:0006178 GO:0032263 GO:0032264 GO:0046100 GO:0052657 |
| AF-A0A3C1LIB5-F1-model_v4 | Hypoxanthine phosphoribosyltransferase | 0.9834 | 88 | 177 |
GO:0000166
GO:0000287 GO:0004422 GO:0005829 GO:0006178 GO:0032263 GO:0032264 GO:0046100 |
| AF-A0A4V2AWN9-F1-model_v4 | Hypoxanthine phosphoribosyltransferase | 0.9829 | 1 | 161 |
GO:0000166
GO:0000287 GO:0004422 GO:0005829 GO:0006178 GO:0032263 GO:0032264 GO:0046100 |