F480181
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 773 | 429 | 728 | 325 |
Family's Representative Sequence
| Representative Sequence | 3300046457|Ga0495590_0021611|Ga0495590_0021611_352_1497 |
| Length | 381 |
| Sequence | MRKPLFDLQKVVYTVSDRIDKISLYKLLPKTSRKRCHGGSIAIAKHGEPEVNRHLSRLAAAWLLPVALSWAAPASAQPDTHSTYPAKPVRIIVPFAAGGVADALPRLIGQKLGEKWGKSIVVDNKPGAAGNIGMEAVARAAPDGYTLGLAPAGNLTVNPILFPKLGYETRDFVPVTMLAASPNVLVVNPAVHARSLKDLVSYAKAHPGELNFSSPGNGSGAHLAGELLNLEAGIKMVHVPYNGMAPALNDVLAGQVQMMFGGISTVLQHIRTGKLVPLAVASPRRLPQLPNVPTVAESGYPGFDVTSWYGLVAPKGTPDAIVQKWQADVATVLRQPDVKEKLDALGLEPVGNSAQAFGGTIAAETLKWRAIVHRANIPPMQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 3 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 4 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 5 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 6 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 7 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 8 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 9 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 10 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 11 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 12 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 13 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 14 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 15 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 16 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 17 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 18 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 19 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 20 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 21 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 22 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 23 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 24 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 25 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 26 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 27 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 28 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 29 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 30 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 31 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 32 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 33 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 34 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 35 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 36 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 37 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 38 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 39 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 40 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 41 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 42 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 43 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 44 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 45 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 46 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 47 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 48 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 49 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 50 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 51 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 52 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 53 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 54 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 55 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 56 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 57 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 59 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 60 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 61 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 62 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 63 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 66 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 68 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 71 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 72 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 81 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 87 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 88 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 91 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 93 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 95 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 100 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 102 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 103 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 104 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 105 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 106 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 107 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 108 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 109 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 110 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 111 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 112 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 113 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 114 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 115 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 116 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 117 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 119 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 120 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 121 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 122 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 123 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 124 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 125 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 127 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 128 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 129 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 130 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 131 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 132 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 133 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 134 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 135 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 147 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 150 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 162 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 165 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 166 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 168 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 181 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 234 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 237 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 241 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 242 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 243 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 244 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 245 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 246 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 247 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 248 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 249 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 250 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 251 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 252 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 253 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 254 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 255 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 256 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 257 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 258 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 259 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 260 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 261 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 262 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 263 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 264 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 266 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 267 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 268 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 269 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 270 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 271 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 272 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 273 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 274 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 275 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 276 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 277 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 278 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 279 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 280 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 281 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 282 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 283 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 284 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 285 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 286 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 287 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 288 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 289 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 290 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 291 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 292 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 293 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 294 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 295 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 296 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 297 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 298 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 299 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 300 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 301 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 302 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 303 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 347 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 348 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 349 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 352 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 353 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 354 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 355 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 356 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 357 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 358 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 359 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 360 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 361 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 362 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 363 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 387 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 388 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 389 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 390 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 391 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 392 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 400 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 402 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 403 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 404 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 405 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 406 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 407 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 408 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 409 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 410 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 411 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 412 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 413 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 414 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 415 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 416 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 417 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 418 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 419 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 420 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 421 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 422 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 423 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 424 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 425 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 426 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 428 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 429 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.05 |
| Metatranscriptomes | 0.13 |
| Isolates | 5.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 23.03 |
| Nodule | 1.68 |
| Rhizoplane | 3.23 |
| Rhizosphere | 64.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1006739 | 3300002773 | Bacteria | 3063 |
| 2 | JGI25150J39212_1004124 | 3300002774 | Bacteria | 3278 |
| 3 | JGI25159J45721_1003238 | 3300002987 | Bacteria | 5838 |
| 4 | JGI25151J46595_10000075 | 3300003187 | Bacteria | 135181 |
| 5 | JGI25151J46595_10000360 | 3300003187 | Bacteria | 48149 |
| 6 | JGI25151J46595_10000362 | 3300003187 | Bacteria | 47753 |
| 7 | JGI25151J46595_10001007 | 3300003187 | Bacteria | 21295 |
| 8 | JGI25151J46595_10003059 | 3300003187 | Bacteria | 9460 |
| 9 | JGI25151J46595_10003214 | 3300003187 | Bacteria | 9145 |
| 10 | JGI25151J46595_10003352 | 3300003187 | Bacteria | 8879 |
| 11 | JGI25151J46595_10011276 | 3300003187 | Bacteria | 4116 |
| 12 | JGI25151J46595_10022894 | 3300003187 | Bacteria | 2584 |
| 13 | JGI25151J46595_10023197 | 3300003187 | Bacteria | 2562 |
| 14 | JGI25153J46596_10002741 | 3300003215 | Bacteria | 10031 |
| 15 | JGI25153J46596_10003269 | 3300003215 | Bacteria | 9110 |
| 16 | JGI25160J50197_1005351 | 3300003354 | Bacteria | 5359 |
| 17 | JGI25161J50226_1001166 | 3300003374 | Bacteria | 8720 |
| 18 | JGI25161J50226_1003857 | 3300003374 | Bacteria | 3290 |
| 19 | Ga0006562J51391_1118556 | 3300003578 | Bacteria | 3380 |
| 20 | JGI25404J52841_10003784 | 3300003659 | Bacteria | 3019 |
| 21 | Ga0055535_1001794 | 3300003761 | Bacteria | 9420 |
| 22 | Ga0055542_1000004 | 3300003762 | Bacteria | 553532 |
| 23 | Ga0055526_1000288 | 3300003771 | Bacteria | 42040 |
| 24 | Ga0055526_1001419 | 3300003771 | Bacteria | 17047 |
| 25 | Ga0055526_1005204 | 3300003771 | Bacteria | 7555 |
| 26 | Ga0055526_1010824 | 3300003771 | Bacteria | 4194 |
| 27 | Ga0055537_1004186 | 3300003773 | Bacteria | 4194 |
| 28 | Ga0055524_1000236 | 3300003775 | Bacteria | 58057 |
| 29 | Ga0055524_1008320 | 3300003775 | Bacteria | 4318 |
| 30 | Ga0055524_1015676 | 3300003775 | Bacteria | 2752 |
| 31 | Ga0055536_1000201 | 3300003781 | Bacteria | 48808 |
| 32 | Ga0055536_1009558 | 3300003781 | Bacteria | 3988 |
| 33 | Ga0055536_1010487 | 3300003781 | Bacteria | 3667 |
| 34 | Ga0055536_1011408 | 3300003781 | Bacteria | 3413 |
| 35 | Ga0055534_1000191 | 3300003784 | Bacteria | 45111 |
| 36 | Ga0055534_1000233 | 3300003784 | Bacteria | 40184 |
| 37 | Ga0055534_1010916 | 3300003784 | Bacteria | 1874 |
| 38 | Ga0055530_10002962 | 3300003791 | Bacteria | 10231 |
| 39 | Ga0055540_1002232 | 3300003792 | Bacteria | 10483 |
| 40 | Ga0055540_1009260 | 3300003792 | Bacteria | 3422 |
| 41 | Ga0055540_1010547 | 3300003792 | Bacteria | 3066 |
| 42 | Ga0055531_10006424 | 3300003794 | Bacteria | 6677 |
| 43 | Ga0055531_10015624 | 3300003794 | Bacteria | 3331 |
| 44 | JGI25405J52794_10018190 | 3300003911 | Bacteria | 1401 |
| 45 | Ga0055543_1001238 | 3300004625 | Bacteria | 10652 |
| 46 | Ga0065165_1003020 | 3300005262 | Bacteria | 12691 |
| 47 | Ga0065714_10078094 | 3300005288 | Bacteria | 2630 |
| 48 | Ga0065704_10074045 | 3300005289 | Bacteria | 6577 |
| 49 | Ga0065707_10084818 | 3300005295 | Bacteria | 6743 |
| 50 | Ga0065707_10092445 | 3300005295 | Bacteria | 3770 |
| 51 | Ga0070658_10009897 | 3300005327 | Bacteria | 7662 |
| 52 | Ga0070658_10019749 | 3300005327 | Bacteria | 5396 |
| 53 | Ga0070683_100021732 | 3300005329 | Bacteria | 5729 |
| 54 | Ga0070683_100149766 | 3300005329 | Bacteria | 2212 |
| 55 | Ga0070683_100496653 | 3300005329 | Unclassified | 1166 |
| 56 | Ga0070690_100000575 | 3300005330 | Bacteria | 18554 |
| 57 | Ga0070670_100010321 | 3300005331 | Bacteria | 7971 |
| 58 | Ga0070670_100020391 | 3300005331 | Bacteria | 5698 |
| 59 | Ga0070670_100138989 | 3300005331 | Unclassified | 2100 |
| 60 | Ga0068869_100077556 | 3300005334 | Bacteria | 2472 |
| 61 | Ga0068869_100137325 | 3300005334 | Bacteria | 1885 |
| 62 | Ga0070666_10069130 | 3300005335 | Bacteria | 2401 |
| 63 | Ga0070682_100082607 | 3300005337 | Bacteria | 2083 |
| 64 | Ga0068868_100006062 | 3300005338 | Bacteria | 8536 |
| 65 | Ga0068868_100024878 | 3300005338 | Bacteria | 4547 |
| 66 | Ga0068868_100172332 | 3300005338 | Unclassified | 1792 |
| 67 | Ga0068868_100362297 | 3300005338 | Bacteria | 1244 |
| 68 | Ga0070689_100025100 | 3300005340 | Bacteria | 4476 |
| 69 | Ga0070687_100080326 | 3300005343 | Bacteria | 1777 |
| 70 | Ga0070661_100071842 | 3300005344 | Bacteria | 2547 |
| 71 | Ga0070661_100183699 | 3300005344 | Unclassified | 1592 |
| 72 | Ga0070668_100005959 | 3300005347 | Bacteria | 9039 |
| 73 | Ga0070669_100072924 | 3300005353 | Bacteria | 2543 |
| 74 | Ga0070675_100000914 | 3300005354 | Bacteria | 20982 |
| 75 | Ga0070675_100012844 | 3300005354 | Bacteria | 6572 |
| 76 | Ga0070675_100133025 | 3300005354 | Bacteria | 2121 |
| 77 | Ga0070675_100257453 | 3300005354 | Unclassified | 1529 |
| 78 | Ga0070671_100004642 | 3300005355 | Bacteria | 10895 |
| 79 | Ga0070674_100063629 | 3300005356 | Bacteria | 2582 |
| 80 | Ga0070674_100261913 | 3300005356 | Bacteria | 1363 |
| 81 | Ga0070674_100335875 | 3300005356 | Bacteria | 1216 |
| 82 | Ga0070673_100038019 | 3300005364 | Bacteria | 3672 |
| 83 | Ga0070673_100246948 | 3300005364 | Bacteria | 1554 |
| 84 | Ga0070673_100336883 | 3300005364 | Bacteria | 1336 |
| 85 | Ga0070673_100441156 | 3300005364 | Unclassified | 1170 |
| 86 | Ga0070688_100083362 | 3300005365 | Bacteria | 2075 |
| 87 | Ga0070688_100351196 | 3300005365 | Bacteria | 1080 |
| 88 | Ga0070659_100052983 | 3300005366 | Bacteria | 3193 |
| 89 | Ga0070667_100015926 | 3300005367 | Bacteria | 6220 |
| 90 | Ga0070705_100178274 | 3300005440 | Bacteria | 1437 |
| 91 | Ga0070678_100001277 | 3300005456 | Bacteria | 13347 |
| 92 | Ga0070678_100048291 | 3300005456 | Bacteria | 3064 |
| 93 | Ga0070678_100180341 | 3300005456 | Bacteria | 1728 |
| 94 | Ga0070678_100281895 | 3300005456 | Unclassified | 1406 |
| 95 | Ga0070662_100018544 | 3300005457 | Bacteria | 4709 |
| 96 | Ga0070662_100317753 | 3300005457 | Bacteria | 1269 |
| 97 | Ga0070681_10021386 | 3300005458 | Bacteria | 6487 |
| 98 | Ga0070681_10109756 | 3300005458 | Bacteria | 2699 |
| 99 | Ga0068867_100017628 | 3300005459 | Bacteria | 5070 |
| 100 | Ga0070706_100008752 | 3300005467 | Bacteria | 9428 |
| 101 | Ga0070706_100115470 | 3300005467 | Bacteria | 2500 |
| 102 | Ga0070707_100009514 | 3300005468 | Bacteria | 9033 |
| 103 | Ga0070679_100037763 | 3300005530 | Bacteria | 4799 |
| 104 | Ga0070679_100629100 | 3300005530 | Bacteria | 1016 |
| 105 | Ga0070697_100038873 | 3300005536 | Unclassified | 3846 |
| 106 | Ga0070697_100296300 | 3300005536 | Bacteria | 1390 |
| 107 | Ga0068853_100030557 | 3300005539 | Bacteria | 4551 |
| 108 | Ga0070672_100027831 | 3300005543 | Bacteria | 4220 |
| 109 | Ga0070672_100031956 | 3300005543 | Bacteria | 3968 |
| 110 | Ga0070672_100066885 | 3300005543 | Bacteria | 2846 |
| 111 | Ga0070672_100090460 | 3300005543 | Bacteria | 2468 |
| 112 | Ga0070672_100213859 | 3300005543 | Bacteria | 1615 |
| 113 | Ga0070672_100236720 | 3300005543 | Unclassified | 1535 |
| 114 | Ga0070686_100067257 | 3300005544 | Bacteria | 2334 |
| 115 | Ga0070686_100166254 | 3300005544 | Bacteria | 1557 |
| 116 | Ga0070695_100198857 | 3300005545 | Bacteria | 1431 |
| 117 | Ga0070696_100001426 | 3300005546 | Bacteria | 15634 |
| 118 | Ga0070693_100027532 | 3300005547 | Bacteria | 3082 |
| 119 | Ga0070665_100092556 | 3300005548 | Bacteria | 3028 |
| 120 | Ga0070665_100165689 | 3300005548 | Bacteria | 2212 |
| 121 | Ga0070665_100211692 | 3300005548 | Bacteria | 1939 |
| 122 | Ga0068855_100010517 | 3300005563 | Bacteria | 11164 |
| 123 | Ga0068855_100102443 | 3300005563 | Bacteria | 3295 |
| 124 | Ga0070664_100118953 | 3300005564 | Bacteria | 2311 |
| 125 | Ga0068857_100197071 | 3300005577 | Bacteria | 1835 |
| 126 | Ga0068854_100003877 | 3300005578 | Bacteria | 9370 |
| 127 | Ga0068854_100060076 | 3300005578 | Bacteria | 2749 |
| 128 | Ga0068854_100429708 | 3300005578 | Unclassified | 1099 |
| 129 | Ga0068856_100050075 | 3300005614 | Bacteria | 4117 |
| 130 | Ga0068852_100000171 | 3300005616 | Bacteria | 43711 |
| 131 | Ga0068852_100007385 | 3300005616 | Bacteria | 8019 |
| 132 | Ga0068852_100014091 | 3300005616 | Bacteria | 6138 |
| 133 | Ga0068852_100069343 | 3300005616 | Bacteria | 3090 |
| 134 | Ga0068852_100075529 | 3300005616 | Unclassified | 2973 |
| 135 | Ga0068852_100294180 | 3300005616 | Bacteria | 1570 |
| 136 | Ga0068864_100012735 | 3300005618 | Bacteria | 6953 |
| 137 | Ga0068864_100386951 | 3300005618 | Unclassified | 1327 |
| 138 | Ga0068866_10085982 | 3300005718 | Bacteria | 1700 |
| 139 | Ga0068866_10188643 | 3300005718 | Bacteria | 1223 |
| 140 | Ga0068861_100245834 | 3300005719 | Bacteria | 1524 |
| 141 | Ga0068851_10004408 | 3300005834 | Bacteria | 6346 |
| 142 | Ga0068851_10006790 | 3300005834 | Bacteria | 5236 |
| 143 | Ga0068851_10046969 | 3300005834 | Bacteria | 2185 |
| 144 | Ga0068870_10027639 | 3300005840 | Bacteria | 2840 |
| 145 | Ga0068863_100025452 | 3300005841 | Bacteria | 5643 |
| 146 | Ga0068863_100055454 | 3300005841 | Unclassified | 3753 |
| 147 | Ga0068858_100044878 | 3300005842 | Bacteria | 4096 |
| 148 | Ga0068860_100006642 | 3300005843 | Bacteria | 11617 |
| 149 | Ga0068860_100017353 | 3300005843 | Bacteria | 7014 |
| 150 | Ga0068862_100009331 | 3300005844 | Bacteria | 8121 |
| 151 | Ga0068862_100095862 | 3300005844 | Bacteria | 2589 |
| 152 | Ga0081455_10002647 | 3300005937 | Bacteria | 21202 |
| 153 | Ga0081540_1000003 | 3300005983 | Bacteria | 233942 |
| 154 | Ga0081540_1010836 | 3300005983 | Bacteria | 6127 |
| 155 | Ga0081539_10068990 | 3300005985 | Bacteria | 1905 |
| 156 | Ga0070717_10360635 | 3300006028 | Bacteria | 1301 |
| 157 | Ga0075365_10072295 | 3300006038 | Bacteria | 2323 |
| 158 | Ga0075368_10022773 | 3300006042 | Bacteria | 2386 |
| 159 | Ga0075363_100018174 | 3300006048 | Bacteria | 3497 |
| 160 | Ga0075362_10003439 | 3300006177 | Bacteria | 5533 |
| 161 | Ga0075367_10113943 | 3300006178 | Bacteria | 1662 |
| 162 | Ga0075367_10179125 | 3300006178 | Bacteria | 1321 |
| 163 | Ga0075369_10014473 | 3300006186 | Bacteria | 3151 |
| 164 | Ga0075369_10127696 | 3300006186 | Bacteria | 1154 |
| 165 | Ga0075366_10010050 | 3300006195 | Bacteria | 5304 |
| 166 | Ga0075366_10013463 | 3300006195 | Bacteria | 4658 |
| 167 | Ga0075366_10018874 | 3300006195 | Bacteria | 3985 |
| 168 | Ga0097621_100008234 | 3300006237 | Bacteria | 7498 |
| 169 | Ga0097621_100011792 | 3300006237 | Bacteria | 6455 |
| 170 | Ga0097621_100023333 | 3300006237 | Bacteria | 4816 |
| 171 | Ga0097621_100036740 | 3300006237 | Bacteria | 3920 |
| 172 | Ga0097621_100209049 | 3300006237 | Bacteria | 1697 |
| 173 | Ga0075370_10002278 | 3300006353 | Bacteria | 8848 |
| 174 | Ga0075370_10003866 | 3300006353 | Bacteria | 7176 |
| 175 | Ga0075370_10057372 | 3300006353 | Bacteria | 2213 |
| 176 | Ga0075370_10073892 | 3300006353 | Bacteria | 1953 |
| 177 | Ga0075370_10181533 | 3300006353 | Bacteria | 1239 |
| 178 | Ga0068871_100018406 | 3300006358 | Bacteria | 5308 |
| 179 | Ga0068871_100023560 | 3300006358 | Bacteria | 4764 |
| 180 | Ga0068871_100052034 | 3300006358 | Bacteria | 3316 |
| 181 | Ga0075428_100022170 | 3300006844 | Bacteria | 7031 |
| 182 | Ga0075433_10063312 | 3300006852 | Bacteria | 3240 |
| 183 | Ga0075434_100346312 | 3300006871 | Archaea | 1507 |
| 184 | Ga0099826_10000004 | 3300006948 | Bacteria | 802669 |
| 185 | Ga0099826_10000031 | 3300006948 | Bacteria | 124966 |
| 186 | Ga0099826_10000074 | 3300006948 | Bacteria | 52710 |
| 187 | Ga0075435_100010512 | 3300007076 | Bacteria | 6770 |
| 188 | Ga0075435_100159174 | 3300007076 | Bacteria | 1901 |
| 189 | Ga0099794_10025206 | 3300007265 | Bacteria | 2737 |
| 190 | Ga0099795_10003770 | 3300007788 | Bacteria | 3806 |
| 191 | Ga0105251_10015793 | 3300009011 | Bacteria | 4109 |
| 192 | Ga0105251_10105976 | 3300009011 | Bacteria | 1283 |
| 193 | Ga0105244_10001011 | 3300009036 | Bacteria | 23532 |
| 194 | Ga0105240_10006246 | 3300009093 | Bacteria | 17532 |
| 195 | Ga0105240_10155520 | 3300009093 | Bacteria | 2720 |
| 196 | Ga0111539_10002462 | 3300009094 | Bacteria | 24586 |
| 197 | Ga0111539_10056832 | 3300009094 | Bacteria | 4649 |
| 198 | Ga0111539_10072650 | 3300009094 | Bacteria | 4057 |
| 199 | Ga0111539_10235027 | 3300009094 | Bacteria | 2134 |
| 200 | Ga0105245_10225345 | 3300009098 | Bacteria | 1811 |
| 201 | Ga0105243_10007533 | 3300009148 | Bacteria | 8370 |
| 202 | Ga0105243_10061593 | 3300009148 | Bacteria | 3002 |
| 203 | Ga0105243_10245814 | 3300009148 | Bacteria | 1595 |
| 204 | Ga0105241_10375077 | 3300009174 | Bacteria | 1241 |
| 205 | Ga0105242_10217568 | 3300009176 | Bacteria | 1705 |
| 206 | Ga0105242_10276480 | 3300009176 | Bacteria | 1523 |
| 207 | Ga0105248_10049948 | 3300009177 | Bacteria | 4690 |
| 208 | Ga0105248_10258815 | 3300009177 | Unclassified | 1959 |
| 209 | Ga0105248_10311044 | 3300009177 | Bacteria | 1774 |
| 210 | Ga0105238_10174994 | 3300009551 | Bacteria | 2123 |
| 211 | Ga0105249_10018182 | 3300009553 | Bacteria | 6248 |
| 212 | Ga0099796_10000615 | 3300010159 | Bacteria | 6187 |
| 213 | Ga0105239_10200687 | 3300010375 | Bacteria | 2234 |
| 214 | Ga0105246_10076961 | 3300011119 | Bacteria | 2365 |
| 215 | Ga0157347_1005083 | 3300012502 | Bacteria | 1247 |
| 216 | Ga0157373_10054161 | 3300013100 | Bacteria | 2851 |
| 217 | Ga0157371_10095083 | 3300013102 | Bacteria | 2112 |
| 218 | Ga0157371_10103219 | 3300013102 | Bacteria | 2023 |
| 219 | Ga0157370_10069039 | 3300013104 | Bacteria | 3339 |
| 220 | Ga0157369_10225383 | 3300013105 | Bacteria | 1961 |
| 221 | Ga0157374_10019302 | 3300013296 | Bacteria | 6032 |
| 222 | Ga0157374_10185066 | 3300013296 | Unclassified | 2036 |
| 223 | Ga0157378_10012649 | 3300013297 | Bacteria | 7385 |
| 224 | Ga0157378_10088487 | 3300013297 | Bacteria | 2810 |
| 225 | Ga0163162_10004924 | 3300013306 | Bacteria | 12876 |
| 226 | Ga0163162_10043534 | 3300013306 | Unclassified | 4496 |
| 227 | Ga0163162_10306712 | 3300013306 | Bacteria | 1720 |
| 228 | Ga0163162_10527774 | 3300013306 | Unclassified | 1310 |
| 229 | Ga0157372_10157194 | 3300013307 | Bacteria | 2626 |
| 230 | Ga0157375_10005076 | 3300013308 | Bacteria | 11422 |
| 231 | Ga0157375_10020023 | 3300013308 | Bacteria | 6103 |
| 232 | Ga0157375_10058319 | 3300013308 | Bacteria | 3818 |
| 233 | Ga0157375_10271601 | 3300013308 | Bacteria | 1858 |
| 234 | Ga0163163_10095474 | 3300014325 | Bacteria | 2993 |
| 235 | Ga0157380_10048578 | 3300014326 | Bacteria | 3342 |
| 236 | Ga0157380_10086697 | 3300014326 | Bacteria | 2573 |
| 237 | Ga0182008_10005597 | 3300014497 | Bacteria | 7121 |
| 238 | Ga0182008_10013054 | 3300014497 | Bacteria | 4370 |
| 239 | Ga0157379_10042185 | 3300014968 | Bacteria | 4073 |
| 240 | Ga0157379_10139400 | 3300014968 | Bacteria | 2186 |
| 241 | Ga0157376_10007773 | 3300014969 | Bacteria | 7685 |
| 242 | Ga0157376_10050947 | 3300014969 | Bacteria | 3437 |
| 243 | Ga0157376_10052692 | 3300014969 | Bacteria | 3384 |
| 244 | Ga0157376_10105920 | 3300014969 | Unclassified | 2466 |
| 245 | Ga0157376_10181673 | 3300014969 | Bacteria | 1923 |
| 246 | Ga0157376_10377297 | 3300014969 | Bacteria | 1365 |
| 247 | Ga0182007_10000617 | 3300015262 | Bacteria | 20740 |
| 248 | Ga0182007_10003714 | 3300015262 | Bacteria | 7132 |
| 249 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 250 | Ga0163161_10000065 | 3300017792 | Bacteria | 108321 |
| 251 | Ga0163161_10026628 | 3300017792 | Bacteria | 4096 |
| 252 | Ga0163161_10030339 | 3300017792 | Bacteria | 3847 |
| 253 | Ga0163161_10047330 | 3300017792 | Bacteria | 3106 |
| 254 | Ga0163161_10343367 | 3300017792 | Unclassified | 1185 |
| 255 | Ga0213872_10001596 | 3300021361 | Bacteria | 14405 |
| 256 | Ga0209672_100961 | 3300025228 | Bacteria | 12819 |
| 257 | Ga0209147_102289 | 3300025229 | Bacteria | 4993 |
| 258 | Ga0209258_100022 | 3300025242 | Bacteria | 553584 |
| 259 | Ga0207425_1000138 | 3300025245 | Bacteria | 65477 |
| 260 | Ga0207425_1003117 | 3300025245 | Bacteria | 5463 |
| 261 | Ga0209148_1000034 | 3300025254 | Bacteria | 553584 |
| 262 | Ga0209129_1000023 | 3300025258 | Bacteria | 420646 |
| 263 | Ga0209129_1002257 | 3300025258 | Bacteria | 9620 |
| 264 | Ga0209129_1004158 | 3300025258 | Bacteria | 5845 |
| 265 | Ga0209129_1007672 | 3300025258 | Bacteria | 3150 |
| 266 | Ga0209565_1000053 | 3300025263 | Bacteria | 210249 |
| 267 | Ga0209565_1000649 | 3300025263 | Bacteria | 22398 |
| 268 | Ga0209565_1003299 | 3300025263 | Bacteria | 5292 |
| 269 | Ga0209565_1014171 | 3300025263 | Bacteria | 1840 |
| 270 | Ga0209673_1001445 | 3300025273 | Bacteria | 22547 |
| 271 | Ga0209673_1001448 | 3300025273 | Bacteria | 22538 |
| 272 | Ga0209130_1000222 | 3300025284 | Bacteria | 74607 |
| 273 | Ga0209130_1001231 | 3300025284 | Bacteria | 17981 |
| 274 | Ga0209130_1002576 | 3300025284 | Bacteria | 8828 |
| 275 | Ga0209675_1000078 | 3300025291 | Bacteria | 156111 |
| 276 | Ga0209675_1000091 | 3300025291 | Bacteria | 146390 |
| 277 | Ga0209675_1001996 | 3300025291 | Bacteria | 10953 |
| 278 | Ga0209675_1002241 | 3300025291 | Bacteria | 10106 |
| 279 | Ga0209675_1002494 | 3300025291 | Bacteria | 9420 |
| 280 | Ga0209675_1010439 | 3300025291 | Bacteria | 3169 |
| 281 | Ga0209675_1011454 | 3300025291 | Bacteria | 2941 |
| 282 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 283 | Ga0209676_1000121 | 3300025292 | Bacteria | 198920 |
| 284 | Ga0209676_1001320 | 3300025292 | Bacteria | 25099 |
| 285 | Ga0209676_1001396 | 3300025292 | Bacteria | 23358 |
| 286 | Ga0209676_1008874 | 3300025292 | Bacteria | 4419 |
| 287 | Ga0209676_1017867 | 3300025292 | Bacteria | 2492 |
| 288 | Ga0209025_1000027 | 3300025294 | Bacteria | 505882 |
| 289 | Ga0209025_1000038 | 3300025294 | Bacteria | 380508 |
| 290 | Ga0209025_1000051 | 3300025294 | Bacteria | 330080 |
| 291 | Ga0209025_1000085 | 3300025294 | Bacteria | 263782 |
| 292 | Ga0209025_1000096 | 3300025294 | Bacteria | 239153 |
| 293 | Ga0209025_1000157 | 3300025294 | Bacteria | 168790 |
| 294 | Ga0209025_1000476 | 3300025294 | Bacteria | 77754 |
| 295 | Ga0209025_1001087 | 3300025294 | Bacteria | 39361 |
| 296 | Ga0209025_1001694 | 3300025294 | Bacteria | 26906 |
| 297 | Ga0209025_1016183 | 3300025294 | Bacteria | 4426 |
| 298 | Ga0209025_1023843 | 3300025294 | Bacteria | 3181 |
| 299 | Ga0209025_1023882 | 3300025294 | Bacteria | 3178 |
| 300 | Ga0209564_1000133 | 3300025295 | Bacteria | 189140 |
| 301 | Ga0209564_1000170 | 3300025295 | Bacteria | 156293 |
| 302 | Ga0209564_1000400 | 3300025295 | Bacteria | 77039 |
| 303 | Ga0209564_1001022 | 3300025295 | Bacteria | 34533 |
| 304 | Ga0209564_1001357 | 3300025295 | Bacteria | 25809 |
| 305 | Ga0209758_1000064 | 3300025297 | Bacteria | 311812 |
| 306 | Ga0209758_1000556 | 3300025297 | Bacteria | 59164 |
| 307 | Ga0209758_1020079 | 3300025297 | Bacteria | 3181 |
| 308 | Ga0209758_1020110 | 3300025297 | Bacteria | 3178 |
| 309 | Ga0209758_1035488 | 3300025297 | Bacteria | 1965 |
| 310 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 311 | Ga0209050_1002090 | 3300025298 | Bacteria | 18300 |
| 312 | Ga0209256_1000038 | 3300025299 | Bacteria | 375225 |
| 313 | Ga0209256_1000115 | 3300025299 | Bacteria | 173607 |
| 314 | Ga0209256_1000400 | 3300025299 | Bacteria | 68737 |
| 315 | Ga0209256_1005552 | 3300025299 | Bacteria | 7201 |
| 316 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 317 | Ga0207426_1000090 | 3300025302 | Bacteria | 280662 |
| 318 | Ga0209051_1000009 | 3300025303 | Bacteria | 706778 |
| 319 | Ga0209051_1000092 | 3300025303 | Bacteria | 170056 |
| 320 | Ga0209051_1000490 | 3300025303 | Bacteria | 51070 |
| 321 | Ga0209051_1000944 | 3300025303 | Bacteria | 28691 |
| 322 | Ga0209051_1004615 | 3300025303 | Bacteria | 8392 |
| 323 | Ga0209051_1008125 | 3300025303 | Bacteria | 5608 |
| 324 | Ga0209051_1012472 | 3300025303 | Bacteria | 4108 |
| 325 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 326 | Ga0209257_1000508 | 3300025304 | Bacteria | 68156 |
| 327 | Ga0209257_1014189 | 3300025304 | Bacteria | 3449 |
| 328 | Ga0207697_10102400 | 3300025315 | Unclassified | 1221 |
| 329 | Ga0207656_10001376 | 3300025321 | Bacteria | 8019 |
| 330 | Ga0207656_10002176 | 3300025321 | Bacteria | 6555 |
| 331 | Ga0207656_10025627 | 3300025321 | Bacteria | 2396 |
| 332 | Ga0207655_1018003 | 3300025728 | Bacteria | 3777 |
| 333 | Ga0207713_1027016 | 3300025735 | Bacteria | 2615 |
| 334 | Ga0207713_1083263 | 3300025735 | Bacteria | 1144 |
| 335 | Ga0207688_10018087 | 3300025901 | Bacteria | 3836 |
| 336 | Ga0207643_10101752 | 3300025908 | Bacteria | 1685 |
| 337 | Ga0207705_10011222 | 3300025909 | Bacteria | 6493 |
| 338 | Ga0207705_10128615 | 3300025909 | Bacteria | 1884 |
| 339 | Ga0207684_10070260 | 3300025910 | Unclassified | 2976 |
| 340 | Ga0207684_10349691 | 3300025910 | Bacteria | 1272 |
| 341 | Ga0207695_10088739 | 3300025913 | Bacteria | 3111 |
| 342 | Ga0207671_10102403 | 3300025914 | Bacteria | 2170 |
| 343 | Ga0207662_10048840 | 3300025918 | Bacteria | 2508 |
| 344 | Ga0207662_10207325 | 3300025918 | Bacteria | 1271 |
| 345 | Ga0207657_10059989 | 3300025919 | Bacteria | 3266 |
| 346 | Ga0207649_10060535 | 3300025920 | Bacteria | 2380 |
| 347 | Ga0207652_10097886 | 3300025921 | Bacteria | 2586 |
| 348 | Ga0207681_10004690 | 3300025923 | Bacteria | 8412 |
| 349 | Ga0207681_10104523 | 3300025923 | Bacteria | 2049 |
| 350 | Ga0207694_10157198 | 3300025924 | Bacteria | 1835 |
| 351 | Ga0207650_10001095 | 3300025925 | Bacteria | 20014 |
| 352 | Ga0207650_10138185 | 3300025925 | Bacteria | 1913 |
| 353 | Ga0207650_10259037 | 3300025925 | Unclassified | 1410 |
| 354 | Ga0207659_10000875 | 3300025926 | Bacteria | 17884 |
| 355 | Ga0207644_10000147 | 3300025931 | Bacteria | 50433 |
| 356 | Ga0207644_10047172 | 3300025931 | Bacteria | 3072 |
| 357 | Ga0207690_10031808 | 3300025932 | Bacteria | 3380 |
| 358 | Ga0207706_10010532 | 3300025933 | Bacteria | 8448 |
| 359 | Ga0207686_10138439 | 3300025934 | Bacteria | 1679 |
| 360 | Ga0207709_10000785 | 3300025935 | Bacteria | 24867 |
| 361 | Ga0207709_10001556 | 3300025935 | Bacteria | 15728 |
| 362 | Ga0207670_10005808 | 3300025936 | Bacteria | 6812 |
| 363 | Ga0207670_10206722 | 3300025936 | Bacteria | 1494 |
| 364 | Ga0207669_10267641 | 3300025937 | Bacteria | 1282 |
| 365 | Ga0207704_10103158 | 3300025938 | Bacteria | 1907 |
| 366 | Ga0207691_10000123 | 3300025940 | Bacteria | 70472 |
| 367 | Ga0207691_10007342 | 3300025940 | Bacteria | 10630 |
| 368 | Ga0207691_10008538 | 3300025940 | Bacteria | 9838 |
| 369 | Ga0207691_10020665 | 3300025940 | Bacteria | 6225 |
| 370 | Ga0207691_10085090 | 3300025940 | Bacteria | 2838 |
| 371 | Ga0207691_10248234 | 3300025940 | Bacteria | 1537 |
| 372 | Ga0207711_10046360 | 3300025941 | Bacteria | 3714 |
| 373 | Ga0207711_10109994 | 3300025941 | Bacteria | 2449 |
| 374 | Ga0207689_10100992 | 3300025942 | Unclassified | 2369 |
| 375 | Ga0207689_10118136 | 3300025942 | Bacteria | 2181 |
| 376 | Ga0207689_10157411 | 3300025942 | Bacteria | 1873 |
| 377 | Ga0207661_10068925 | 3300025944 | Bacteria | 2882 |
| 378 | Ga0207661_10081039 | 3300025944 | Unclassified | 2680 |
| 379 | Ga0207679_10026007 | 3300025945 | Bacteria | 4032 |
| 380 | Ga0207679_10269642 | 3300025945 | Unclassified | 1455 |
| 381 | Ga0207712_10009743 | 3300025961 | Bacteria | 6088 |
| 382 | Ga0207668_10007850 | 3300025972 | Bacteria | 6346 |
| 383 | Ga0207640_10024546 | 3300025981 | Unclassified | 3639 |
| 384 | Ga0207640_10302892 | 3300025981 | Bacteria | 1265 |
| 385 | Ga0207640_10421569 | 3300025981 | Unclassified | 1092 |
| 386 | Ga0207677_10002235 | 3300026023 | Bacteria | 10167 |
| 387 | Ga0207703_10077554 | 3300026035 | Bacteria | 2759 |
| 388 | Ga0207703_10309919 | 3300026035 | Bacteria | 1442 |
| 389 | Ga0207703_10402975 | 3300026035 | Bacteria | 1270 |
| 390 | Ga0207639_10004693 | 3300026041 | Bacteria | 9197 |
| 391 | Ga0207702_10475372 | 3300026078 | Bacteria | 1216 |
| 392 | Ga0207641_10067354 | 3300026088 | Bacteria | 3067 |
| 393 | Ga0207641_10101764 | 3300026088 | Bacteria | 2532 |
| 394 | Ga0207648_10000853 | 3300026089 | Bacteria | 34345 |
| 395 | Ga0207648_10124451 | 3300026089 | Bacteria | 2268 |
| 396 | Ga0207648_10187049 | 3300026089 | Bacteria | 1834 |
| 397 | Ga0207676_10009521 | 3300026095 | Bacteria | 6915 |
| 398 | Ga0207676_10158841 | 3300026095 | Bacteria | 1956 |
| 399 | Ga0207674_10162470 | 3300026116 | Bacteria | 2188 |
| 400 | Ga0207675_100000415 | 3300026118 | Bacteria | 41041 |
| 401 | Ga0207675_100369363 | 3300026118 | Bacteria | 1409 |
| 402 | Ga0207683_10000317 | 3300026121 | Bacteria | 43905 |
| 403 | Ga0207683_10082033 | 3300026121 | Bacteria | 2863 |
| 404 | Ga0207683_10115737 | 3300026121 | Bacteria | 2403 |
| 405 | Ga0207683_10213359 | 3300026121 | Unclassified | 1757 |
| 406 | Ga0207698_10001729 | 3300026142 | Bacteria | 12735 |
| 407 | Ga0207698_10009508 | 3300026142 | Bacteria | 6202 |
| 408 | Ga0207698_10032159 | 3300026142 | Bacteria | 3797 |
| 409 | Ga0209179_1001332 | 3300027512 | Bacteria | 2989 |
| 410 | Ga0209179_1001419 | 3300027512 | Bacteria | 2925 |
| 411 | Ga0209282_1000011 | 3300027666 | Bacteria | 217665 |
| 412 | Ga0209282_1000078 | 3300027666 | Bacteria | 76811 |
| 413 | Ga0209282_1000113 | 3300027666 | Bacteria | 52714 |
| 414 | Ga0209588_1029369 | 3300027671 | Bacteria | 1754 |
| 415 | Ga0209971_1005391 | 3300027682 | Bacteria | 3038 |
| 416 | Ga0207428_10014340 | 3300027907 | Bacteria | 6893 |
| 417 | Ga0268266_10158651 | 3300028379 | Bacteria | 2045 |
| 418 | Ga0268266_10192689 | 3300028379 | Bacteria | 1862 |
| 419 | Ga0268266_10302226 | 3300028379 | Bacteria | 1493 |
| 420 | Ga0268266_10325305 | 3300028379 | Bacteria | 1440 |
| 421 | Ga0268265_10549953 | 3300028380 | Bacteria | 1096 |
| 422 | Ga0268264_10007630 | 3300028381 | Bacteria | 9017 |
| 423 | Ga0268264_10015304 | 3300028381 | Bacteria | 6291 |
| 424 | Ga0265318_10012091 | 3300028577 | Bacteria | 3686 |
| 425 | Ga0307515_10000028 | 3300028794 | Bacteria | 368467 |
| 426 | Ga0307515_10201912 | 3300028794 | Bacteria | 1861 |
| 427 | Ga0307511_10000976 | 3300030521 | Bacteria | 30361 |
| 428 | Ga0265330_10032538 | 3300031235 | Bacteria | 2336 |
| 429 | Ga0265332_10003766 | 3300031238 | Bacteria | 7248 |
| 430 | Ga0265329_10012356 | 3300031242 | Bacteria | 3070 |
| 431 | Ga0265331_10039398 | 3300031250 | Bacteria | 2304 |
| 432 | Ga0265327_10000465 | 3300031251 | Bacteria | 72062 |
| 433 | Ga0265327_10022499 | 3300031251 | Bacteria | 3766 |
| 434 | Ga0265316_10040384 | 3300031344 | Bacteria | 3740 |
| 435 | Ga0307408_100013471 | 3300031548 | Bacteria | 5428 |
| 436 | Ga0307408_100044752 | 3300031548 | Bacteria | 3156 |
| 437 | Ga0307514_10001952 | 3300031649 | Bacteria | 22533 |
| 438 | Ga0265314_10011575 | 3300031711 | Bacteria | 7268 |
| 439 | Ga0265342_10005301 | 3300031712 | Bacteria | 9883 |
| 440 | Ga0307410_10220145 | 3300031852 | Bacteria | 1460 |
| 441 | Ga0307406_10000194 | 3300031901 | Bacteria | 36252 |
| 442 | Ga0307412_10005778 | 3300031911 | Bacteria | 6957 |
| 443 | Ga0307412_10015702 | 3300031911 | Bacteria | 4495 |
| 444 | Ga0307412_10115904 | 3300031911 | Bacteria | 1921 |
| 445 | Ga0307412_10144364 | 3300031911 | Bacteria | 1747 |
| 446 | Ga0307412_10219676 | 3300031911 | Bacteria | 1456 |
| 447 | Ga0307409_100139767 | 3300031995 | Bacteria | 2085 |
| 448 | Ga0307416_100309661 | 3300032002 | Bacteria | 1575 |
| 449 | Ga0307416_100796514 | 3300032002 | Bacteria | 1040 |
| 450 | Ga0307414_10078323 | 3300032004 | Bacteria | 2409 |
| 451 | Ga0307411_10044619 | 3300032005 | Bacteria | 2846 |
| 452 | Ga0307411_10150192 | 3300032005 | Bacteria | 1730 |
| 453 | Ga0307507_10029624 | 3300033179 | Bacteria | 5799 |
| 454 | Ga0307507_10096976 | 3300033179 | Bacteria | 2490 |
| 455 | Ga0373948_0015631 | 3300034817 | Bacteria | 1395 |
| 456 | Ga0373940_0014482 | 3300035088 | Bacteria | 1924 |
| 457 | Ga0373923_0052214 | 3300035111 | Bacteria | 1717 |
| 458 | Ga0373932_0004013 | 3300035112 | Bacteria | 3505 |
| 459 | Ga0373953_0032856 | 3300035117 | Bacteria | 2027 |
| 460 | Ga0373954_0050054 | 3300035118 | Bacteria | 1960 |
| 461 | Ga0373960_0045939 | 3300035121 | Bacteria | 1280 |
| 462 | Ga0373943_0005457 | 3300035170 | Bacteria | 5722 |
| 463 | Ga0373946_0040510 | 3300035171 | Bacteria | 1906 |
| 464 | Ga0373955_0031741 | 3300035172 | Bacteria | 2768 |
| 465 | Ga0373962_0015036 | 3300035242 | Bacteria | 1979 |
| 466 | Ga0373924_0005756 | 3300035410 | Bacteria | 4405 |
| 467 | Ga0373931_0002752 | 3300035691 | Bacteria | 7827 |
| 468 | Ga0373931_0047510 | 3300035691 | Bacteria | 2272 |
| 469 | Ga0373935_0054057 | 3300035692 | Bacteria | 2555 |
| 470 | Ga0373933_0006656 | 3300035724 | Bacteria | 6294 |
| 471 | Ga0373947_0022660 | 3300035725 | Bacteria | 3644 |
| 472 | Ga0373947_0073539 | 3300035725 | Bacteria | 2101 |
| 473 | Ga0373937_0002785 | 3300036401 | Bacteria | 14599 |
| 474 | Ga0373925_0224588 | 3300037068 | Bacteria | 1500 |
| 475 | Ga0395899_0001705 | 3300037312 | Bacteria | 18309 |
| 476 | Ga0395899_0003707 | 3300037312 | Bacteria | 12084 |
| 477 | Ga0395900_0001713 | 3300037418 | Bacteria | 25348 |
| 478 | Ga0395900_0005201 | 3300037418 | Bacteria | 13656 |
| 479 | Ga0395900_0029035 | 3300037418 | Bacteria | 5672 |
| 480 | Ga0395898_0006230 | 3300037466 | Bacteria | 12778 |
| 481 | Ga0395898_0011212 | 3300037466 | Bacteria | 9329 |
| 482 | Ga0395898_0191534 | 3300037466 | Bacteria | 1954 |
| 483 | Ga0395905_0060121 | 3300037471 | Bacteria | 3553 |
| 484 | Ga0395905_0393399 | 3300037471 | Bacteria | 1280 |
| 485 | Ga0395901_0004147 | 3300038443 | Bacteria | 14621 |
| 486 | Ga0395901_0010742 | 3300038443 | Bacteria | 9284 |
| 487 | Ga0395901_0022578 | 3300038443 | Bacteria | 6449 |
| 488 | Ga0395901_0087117 | 3300038443 | Bacteria | 3265 |
| 489 | Ga0436361_1065084 | 3300039447 | Bacteria | 19022 |
| 490 | Ga0439436_0003275 | 3300041404 | Bacteria | 4911 |
| 491 | Ga0439438_011801 | 3300041405 | Bacteria | 2704 |
| 492 | Ga0451798_0667220 | 3300041458 | Bacteria | 1210 |
| 493 | Ga0451807_1303413 | 3300041486 | Bacteria | 1557 |
| 494 | Ga0439432_004127 | 3300042006 | Bacteria | 5308 |
| 495 | Ga0439449_0000184 | 3300042007 | Bacteria | 21742 |
| 496 | Ga0439449_0007495 | 3300042007 | Bacteria | 4146 |
| 497 | Ga0439455_0019893 | 3300042012 | Bacteria | 1587 |
| 498 | Ga0450907_019469 | 3300042146 | Bacteria | 1137 |
| 499 | Ga0450908_003708 | 3300042184 | Bacteria | 2963 |
| 500 | Ga0450909_001072 | 3300042185 | Bacteria | 3767 |
| 501 | Ga0439434_0001880 | 3300042435 | Bacteria | 6104 |
| 502 | Ga0450893_0003656 | 3300042532 | Bacteria | 2430 |
| 503 | Ga0451577_0548946 | 3300042876 | Bacteria | 1049 |
| 504 | Ga0466963_0031491 | 3300044694 | Bacteria | 3429 |
| 505 | Ga0453684_0492139 | 3300044712 | Bacteria | 1359 |
| 506 | Ga0466960_0077707 | 3300044901 | Bacteria | 1665 |
| 507 | Ga0451576_0006369 | 3300045051 | Bacteria | 14494 |
| 508 | Ga0451576_0028907 | 3300045051 | Bacteria | 5937 |
| 509 | Ga0451576_0250681 | 3300045051 | Bacteria | 1850 |
| 510 | Ga0451576_0314990 | 3300045051 | Bacteria | 1637 |
| 511 | Ga0451576_0614576 | 3300045051 | Bacteria | 1142 |
| 512 | Ga0466967_0034573 | 3300045976 | Bacteria | 4292 |
| 513 | Ga0495592_0042728 | 3300046454 | Bacteria | 3394 |
| 514 | Ga0495590_0021611 | 3300046457 | Bacteria | 2280 |
| 515 | Ga0495638_0038991 | 3300046460 | Bacteria | 3018 |
| 516 | Ga0495638_0067291 | 3300046460 | Bacteria | 2200 |
| 517 | Ga0495605_0001934 | 3300046474 | Bacteria | 13169 |
| 518 | Ga0495605_0003185 | 3300046474 | Bacteria | 9850 |
| 519 | Ga0495605_0011006 | 3300046474 | Bacteria | 5053 |
| 520 | Ga0495639_0002606 | 3300046475 | Bacteria | 7848 |
| 521 | Ga0495664_0065888 | 3300046477 | Bacteria | 2160 |
| 522 | Ga0495584_0016039 | 3300046491 | Bacteria | 3823 |
| 523 | Ga0495584_0049005 | 3300046491 | Bacteria | 2129 |
| 524 | Ga0495596_0000121 | 3300046500 | Bacteria | 53954 |
| 525 | Ga0495596_0000568 | 3300046500 | Bacteria | 23065 |
| 526 | Ga0495596_0000624 | 3300046500 | Bacteria | 22231 |
| 527 | Ga0495607_0005823 | 3300046501 | Bacteria | 8766 |
| 528 | Ga0495607_0021307 | 3300046501 | Bacteria | 4080 |
| 529 | Ga0495610_0000387 | 3300046512 | Bacteria | 45513 |
| 530 | Ga0495610_0001269 | 3300046512 | Bacteria | 22626 |
| 531 | Ga0495610_0003249 | 3300046512 | Bacteria | 12843 |
| 532 | Ga0495616_0004854 | 3300046513 | Bacteria | 8415 |
| 533 | Ga0495616_0004925 | 3300046513 | Bacteria | 8343 |
| 534 | Ga0495616_0005358 | 3300046513 | Bacteria | 7913 |
| 535 | Ga0495616_0022482 | 3300046513 | Bacteria | 3406 |
| 536 | Ga0495620_0009726 | 3300046515 | Bacteria | 5103 |
| 537 | Ga0495663_0012540 | 3300046525 | Bacteria | 2361 |
| 538 | Ga0495642_0033512 | 3300046528 | Bacteria | 2065 |
| 539 | Ga0495652_0115235 | 3300046529 | Bacteria | 2154 |
| 540 | Ga0495654_0031657 | 3300046530 | Bacteria | 2685 |
| 541 | Ga0495587_0011304 | 3300046536 | Bacteria | 5658 |
| 542 | Ga0495609_0001256 | 3300046538 | Bacteria | 17410 |
| 543 | Ga0495609_0001279 | 3300046538 | Bacteria | 17171 |
| 544 | Ga0495609_0002814 | 3300046538 | Bacteria | 10454 |
| 545 | Ga0495621_0008890 | 3300046539 | Bacteria | 3028 |
| 546 | Ga0495621_0035327 | 3300046539 | Bacteria | 1731 |
| 547 | Ga0495597_0000116 | 3300046542 | Bacteria | 72210 |
| 548 | Ga0495645_0002809 | 3300046543 | Bacteria | 11813 |
| 549 | Ga0495645_0104857 | 3300046543 | Bacteria | 2007 |
| 550 | Ga0495622_0085934 | 3300046557 | Bacteria | 1447 |
| 551 | Ga0495667_0038499 | 3300046559 | Bacteria | 3184 |
| 552 | Ga0495656_0000109 | 3300046615 | Bacteria | 32861 |
| 553 | Ga0495668_0036686 | 3300046616 | Bacteria | 2746 |
| 554 | Ga0495661_0003687 | 3300046665 | Bacteria | 11251 |
| 555 | Ga0495588_0086032 | 3300046674 | Bacteria | 1644 |
| 556 | Ga0495599_0036314 | 3300046678 | Bacteria | 3094 |
| 557 | Ga0495658_0056819 | 3300046683 | Bacteria | 2233 |
| 558 | Ga0495669_0032233 | 3300046684 | Bacteria | 2303 |
| 559 | Ga0495669_0039820 | 3300046684 | Bacteria | 2082 |
| 560 | Ga0495670_0022371 | 3300046691 | Bacteria | 3122 |
| 561 | Ga0495670_0051539 | 3300046691 | Bacteria | 2060 |
| 562 | Ga0495671_0000494 | 3300046692 | Bacteria | 30400 |
| 563 | Ga0495671_0003887 | 3300046692 | Bacteria | 9075 |
| 564 | Ga0495671_0004931 | 3300046692 | Bacteria | 7877 |
| 565 | Ga0495649_0025646 | 3300046694 | Bacteria | 3283 |
| 566 | Ga0495649_0026589 | 3300046694 | Bacteria | 3217 |
| 567 | Ga0495600_0017664 | 3300046809 | Bacteria | 4539 |
| 568 | Ga0495600_0051794 | 3300046809 | Bacteria | 2680 |
| 569 | Ga0495600_0169662 | 3300046809 | Bacteria | 1409 |
| 570 | Ga0495604_0203311 | 3300047317 | Bacteria | 1373 |
| 571 | Ga0495636_0009262 | 3300047318 | Bacteria | 3877 |
| 572 | Ga0495636_0039683 | 3300047318 | Bacteria | 1951 |
| 573 | Ga0495672_0017538 | 3300047320 | Bacteria | 4787 |
| 574 | Ga0495672_0062151 | 3300047320 | Bacteria | 2149 |
| 575 | Ga0495676_0110862 | 3300047321 | Bacteria | 2013 |
| 576 | Ga0495686_0116498 | 3300047472 | Bacteria | 1597 |
| 577 | Ga0495614_0031760 | 3300048089 | Bacteria | 2273 |
| 578 | Ga0495615_0002030 | 3300048090 | Bacteria | 3155 |
| 579 | Ga0496100_0014235 | 3300048903 | Bacteria | 4613 |
| 580 | Ga0496101_0004822 | 3300048904 | Bacteria | 8557 |
| 581 | Ga0496101_0106158 | 3300048904 | Bacteria | 2109 |
| 582 | Ga0496104_0193296 | 3300048907 | Bacteria | 1947 |
| 583 | Ga0496105_0001248 | 3300048908 | Bacteria | 17765 |
| 584 | Ga0496105_0127141 | 3300048908 | Bacteria | 2101 |
| 585 | Ga0496107_0204234 | 3300048910 | Bacteria | 1469 |
| 586 | Ga0496108_0085734 | 3300048911 | Bacteria | 2674 |
| 587 | Ga0496108_0199476 | 3300048911 | Bacteria | 1736 |
| 588 | Ga0496108_0199692 | 3300048911 | Bacteria | 1735 |
| 589 | Ga0496109_0006848 | 3300048912 | Bacteria | 9615 |
| 590 | Ga0496109_0060743 | 3300048912 | Bacteria | 3454 |
| 591 | Ga0496109_0355070 | 3300048912 | Bacteria | 1385 |
| 592 | Ga0496110_0019955 | 3300048913 | Bacteria | 5650 |
| 593 | Ga0496110_0078584 | 3300048913 | Bacteria | 2937 |
| 594 | Ga0496110_0106462 | 3300048913 | Bacteria | 2516 |
| 595 | Ga0496111_0015901 | 3300048914 | Bacteria | 5175 |
| 596 | Ga0496111_0179651 | 3300048914 | Unclassified | 1573 |
| 597 | Ga0496111_0192173 | 3300048914 | Bacteria | 1518 |
| 598 | Ga0496114_0043438 | 3300048917 | Bacteria | 3727 |
| 599 | Ga0496116_0004217 | 3300048919 | Bacteria | 13819 |
| 600 | Ga0496116_0008659 | 3300048919 | Bacteria | 8800 |
| 601 | Ga0496116_0011913 | 3300048919 | Bacteria | 7148 |
| 602 | Ga0496116_0014246 | 3300048919 | Bacteria | 6360 |
| 603 | Ga0496116_0028519 | 3300048919 | Bacteria | 4041 |
| 604 | Ga0496116_0030472 | 3300048919 | Bacteria | 3874 |
| 605 | Ga0496117_0035438 | 3300048920 | Bacteria | 3745 |
| 606 | Ga0496117_0037362 | 3300048920 | Bacteria | 3619 |
| 607 | Ga0496118_0041873 | 3300048921 | Bacteria | 3620 |
| 608 | Ga0496118_0056153 | 3300048921 | Bacteria | 2963 |
| 609 | Ga0496121_0001338 | 3300048924 | Bacteria | 42197 |
| 610 | Ga0496121_0007784 | 3300048924 | Bacteria | 12833 |
| 611 | Ga0496121_0046495 | 3300048924 | Bacteria | 3714 |
| 612 | Ga0496121_0051016 | 3300048924 | Bacteria | 3488 |
| 613 | Ga0496121_0052904 | 3300048924 | Bacteria | 3405 |
| 614 | Ga0496121_0118983 | 3300048924 | Bacteria | 1998 |
| 615 | Ga0496122_0000383 | 3300048925 | Bacteria | 94797 |
| 616 | Ga0496122_0000930 | 3300048925 | Bacteria | 53414 |
| 617 | Ga0496122_0001583 | 3300048925 | Bacteria | 35761 |
| 618 | Ga0496122_0009575 | 3300048925 | Bacteria | 10165 |
| 619 | Ga0496122_0019704 | 3300048925 | Bacteria | 6147 |
| 620 | Ga0496122_0101846 | 3300048925 | Bacteria | 1916 |
| 621 | Ga0496123_0000249 | 3300048926 | Bacteria | 108969 |
| 622 | Ga0496123_0000369 | 3300048926 | Bacteria | 84409 |
| 623 | Ga0496123_0000967 | 3300048926 | Bacteria | 44394 |
| 624 | Ga0496123_0001943 | 3300048926 | Bacteria | 26909 |
| 625 | Ga0496123_0002298 | 3300048926 | Bacteria | 23994 |
| 626 | Ga0496124_0024187 | 3300048927 | Bacteria | 5529 |
| 627 | Ga0496124_0053851 | 3300048927 | Bacteria | 3408 |
| 628 | Ga0496125_0001761 | 3300048928 | Bacteria | 30044 |
| 629 | Ga0496125_0023627 | 3300048928 | Bacteria | 5669 |
| 630 | Ga0496125_0056558 | 3300048928 | Bacteria | 3185 |
| 631 | Ga0496126_0025267 | 3300048929 | Bacteria | 5718 |
| 632 | Ga0496126_0069817 | 3300048929 | Bacteria | 3132 |
| 633 | Ga0501033_0005170 | 3300049570 | Bacteria | 10374 |
| 634 | Ga0501033_0058449 | 3300049570 | Bacteria | 2848 |
| 635 | Ga0501034_0041075 | 3300049571 | Bacteria | 4680 |
| 636 | Ga0501034_0161318 | 3300049571 | Bacteria | 2213 |
| 637 | Ga0501034_0631930 | 3300049571 | Bacteria | 974 |
| 638 | Ga0501037_0039939 | 3300049573 | Bacteria | 3454 |
| 639 | Ga0501038_0147400 | 3300049574 | Bacteria | 1921 |
| 640 | Ga0501039_0190641 | 3300049575 | Bacteria | 1612 |
| 641 | Ga0501040_0050091 | 3300049576 | Bacteria | 2856 |
| 642 | Ga0501041_0002800 | 3300049577 | Bacteria | 9963 |
| 643 | Ga0501041_0028277 | 3300049577 | Bacteria | 3382 |
| 644 | Ga0501042_0029825 | 3300049578 | Bacteria | 3848 |
| 645 | Ga0501047_0026159 | 3300049581 | Bacteria | 5613 |
| 646 | Ga0501048_0010243 | 3300049582 | Bacteria | 7009 |
| 647 | Ga0501071_0117450 | 3300049587 | Bacteria | 1970 |
| 648 | Ga0501072_0012735 | 3300049588 | Bacteria | 6431 |
| 649 | Ga0501072_0141064 | 3300049588 | Bacteria | 1921 |
| 650 | Ga0501074_0029127 | 3300049590 | Bacteria | 4000 |
| 651 | Ga0501075_0002431 | 3300049591 | Bacteria | 12396 |
| 652 | Ga0501075_0020736 | 3300049591 | Bacteria | 4783 |
| 653 | Ga0501075_0043541 | 3300049591 | Bacteria | 3367 |
| 654 | Ga0501076_0009377 | 3300049592 | Bacteria | 7227 |
| 655 | Ga0501076_0012563 | 3300049592 | Bacteria | 6334 |
| 656 | Ga0501076_0134672 | 3300049592 | Bacteria | 2005 |
| 657 | Ga0501077_0147788 | 3300049593 | Bacteria | 1491 |
| 658 | Ga0501079_0017990 | 3300049741 | Bacteria | 5396 |
| 659 | Ga0501080_0014848 | 3300049742 | Bacteria | 7172 |
| 660 | Ga0501081_0029233 | 3300049743 | Bacteria | 3724 |
| 661 | Ga0501081_0116000 | 3300049743 | Bacteria | 1904 |
| 662 | Ga0501083_0179249 | 3300049744 | Bacteria | 1384 |
| 663 | Ga0501035_0013969 | 3300049822 | Bacteria | 7408 |
| 664 | Ga0501044_0002878 | 3300049823 | Bacteria | 19586 |
| 665 | Ga0501045_0003422 | 3300049824 | Bacteria | 10853 |
| 666 | Ga0501045_0388915 | 3300049824 | Bacteria | 1038 |
| 667 | nmdc:mga03683_13376_c1 | 3300050489 | Bacteria | 3019 |
| 668 | nmdc:mga03n38_4600_c1 | 3300050490 | Bacteria | 4593 |
| 669 | nmdc:mga0yw44_20945_c1 | 3300050492 | Bacteria | 3639 |
| 670 | nmdc:mga0yw44_37002_c1 | 3300050492 | Bacteria | 2879 |
| 671 | nmdc:mga0k408_19531_c1 | 3300050493 | Bacteria | 3788 |
| 672 | nmdc:mga0k408_28320_c1 | 3300050493 | Bacteria | 3185 |
| 673 | nmdc:mga06z11_55443_c1 | 3300050494 | Bacteria | 2046 |
| 674 | nmdc:mga07m45_103017_c1 | 3300050496 | Bacteria | 1640 |
| 675 | nmdc:mga07m45_14964_c1 | 3300050496 | Bacteria | 4141 |
| 676 | nmdc:mga07m45_169966_c1 | 3300050496 | Bacteria | 1267 |
| 677 | nmdc:mga07m45_17022_c1 | 3300050496 | Bacteria | 3898 |
| 678 | nmdc:mga07m45_6982_c1 | 3300050496 | Bacteria | 5743 |
| 679 | nmdc:mga0qj67_3607_c1 | 3300050509 | Bacteria | 11173 |
| 680 | nmdc:mga08y16_10093_c1 | 3300050511 | Bacteria | 9914 |
| 681 | nmdc:mga08y16_210911_c1 | 3300050511 | Bacteria | 2011 |
| 682 | nmdc:mga0n895_96007_c1 | 3300050512 | Unclassified | 2969 |
| 683 | nmdc:mga0rr50_327348_c1 | 3300050513 | Bacteria | 1286 |
| 684 | nmdc:mga08x19_18905_c1 | 3300050514 | Bacteria | 4224 |
| 685 | nmdc:mga0a205_31700_c1 | 3300050515 | Bacteria | 5066 |
| 686 | Ga0495601_0006318 | 3300053077 | Bacteria | 6926 |
| 687 | Ga0500610_0001394 | 3300053079 | Bacteria | 8204 |
| 688 | Ga0500610_0005581 | 3300053079 | Bacteria | 5175 |
| 689 | Ga0495619_0069933 | 3300053085 | Bacteria | 2347 |
| 690 | Ga0500578_0025224 | 3300053086 | Bacteria | 3814 |
| 691 | Ga0500646_0002708 | 3300053090 | Bacteria | 4576 |
| 692 | Ga0500646_0008750 | 3300053090 | Bacteria | 2594 |
| 693 | Ga0500651_0000038 | 3300053093 | Bacteria | 101707 |
| 694 | Ga0500650_0035802 | 3300053098 | Bacteria | 2276 |
| 695 | Ga0500571_000054 | 3300053110 | Bacteria | 35459 |
| 696 | Ga0500593_000385 | 3300053117 | Bacteria | 17539 |
| 697 | Ga0500607_013519 | 3300053121 | Bacteria | 4764 |
| 698 | Ga0500608_003408 | 3300053122 | Bacteria | 5954 |
| 699 | Ga0500626_019208 | 3300053128 | Bacteria | 3030 |
| 700 | Ga0500655_000123 | 3300053133 | Bacteria | 19862 |
| 701 | Ga0500658_0000237 | 3300053134 | Bacteria | 25766 |
| 702 | Ga0500658_0000266 | 3300053134 | Bacteria | 23921 |
| 703 | Ga0500559_0001462 | 3300053136 | Bacteria | 13377 |
| 704 | Ga0500559_0008198 | 3300053136 | Bacteria | 4594 |
| 705 | Ga0500559_0050126 | 3300053136 | Bacteria | 1841 |
| 706 | Ga0500564_024230 | 3300053138 | Bacteria | 2785 |
| 707 | Ga0500568_0005096 | 3300053139 | Bacteria | 6870 |
| 708 | Ga0500573_0069348 | 3300053140 | Bacteria | 2012 |
| 709 | Ga0500574_007801 | 3300053141 | Bacteria | 2242 |
| 710 | Ga0500590_045762 | 3300053148 | Bacteria | 2239 |
| 711 | Ga0500590_056422 | 3300053148 | Bacteria | 1984 |
| 712 | Ga0500604_0001071 | 3300053151 | Bacteria | 7638 |
| 713 | Ga0500616_0030328 | 3300053153 | Bacteria | 2970 |
| 714 | Ga0500616_0073468 | 3300053153 | Bacteria | 1736 |
| 715 | Ga0500619_000081 | 3300053154 | Bacteria | 26977 |
| 716 | Ga0500619_000088 | 3300053154 | Bacteria | 25738 |
| 717 | Ga0500627_0004346 | 3300053158 | Bacteria | 4536 |
| 718 | Ga0500634_0015722 | 3300053161 | Bacteria | 4025 |
| 719 | Ga0500634_0048318 | 3300053161 | Bacteria | 2296 |
| 720 | Ga0500636_0136336 | 3300053177 | Bacteria | 1363 |
| 721 | Ga0500645_005317 | 3300053730 | Bacteria | 4766 |
| 722 | Ga0590075_012593 | 3300059424 | Bacteria | 2056 |
| 723 | Ga0501082_0015431 | 3300060353 | Bacteria | 6574 |
| 724 | Ga0501082_0074944 | 3300060353 | Bacteria | 2915 |
| 725 | Ga0501082_0201645 | 3300060353 | Bacteria | 1731 |
| 726 | Ga0530510_0002501 | 3300061734 | Bacteria | 12630 |
| 727 | Ga0530510_0004066 | 3300061734 | Bacteria | 10096 |
| 728 | Ga0530510_0011205 | 3300061734 | Bacteria | 6291 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045051 | Ga0451576_0614576 | Ga0451576_0614576_338_1120 | 248 |
| 2 | 3300045051 | Ga0451576_0250681 | Ga0451576_0250681_1029_1835 | 253 |
| 3 | 3300005340 | Ga0070689_100025100 | Ga0070689_1000251005 | 274 |
| 4 | 3300005356 | Ga0070674_100335875 | Ga0070674_1003358751 | 274 |
| 5 | 3300005364 | Ga0070673_100038019 | Ga0070673_1000380193 | 274 |
| 6 | 3300005365 | Ga0070688_100083362 | Ga0070688_1000833623 | 274 |
| 7 | 3300005543 | Ga0070672_100213859 | Ga0070672_1002138592 | 274 |
| 8 | 3300025901 | Ga0207688_10018087 | Ga0207688_100180873 | 274 |
| 9 | 3300025936 | Ga0207670_10005808 | Ga0207670_100058082 | 274 |
| 10 | 3300025937 | Ga0207669_10267641 | Ga0207669_102676412 | 274 |
| 11 | 3300025940 | Ga0207691_10020665 | Ga0207691_100206654 | 274 |
| 12 | 3300014969 | Ga0157376_10105920 | Ga0157376_101059203 | 275 |
| 13 | 3300026116 | Ga0207674_10162470 | Ga0207674_101624702 | 275 |
| 14 | 3300003215 | JGI25153J46596_10002741 | JGI25153J46596_100027417 | 277 |
| 15 | 3300003215 | JGI25153J46596_10003269 | JGI25153J46596_100032699 | 277 |
| 16 | 3300025297 | Ga0209758_1000556 | Ga0209758_100055636 | 277 |
| 17 | 3300046684 | Ga0495669_0032233 | Ga0495669_0032233_26_925 | 277 |
| 18 | 3300049743 | Ga0501081_0029233 | Ga0501081_0029233_1129_2004 | 277 |
| 19 | 3300048912 | Ga0496109_0355070 | Ga0496109_0355070_478_1359 | 279 |
| 20 | 3300049571 | Ga0501034_0631930 | Ga0501034_0631930_61_942 | 279 |
| 21 | 3300009174 | Ga0105241_10375077 | Ga0105241_103750772 | 280 |
| 22 | 3300014969 | Ga0157376_10052692 | Ga0157376_100526924 | 281 |
| 23 | 3300003775 | Ga0055524_1000236 | Ga0055524_100023632 | 283 |
| 24 | 3300003187 | JGI25151J46595_10000360 | JGI25151J46595_1000036039 | 284 |
| 25 | 3300003187 | JGI25151J46595_10000362 | JGI25151J46595_1000036210 | 284 |
| 26 | 3300003771 | Ga0055526_1005204 | Ga0055526_10052045 | 284 |
| 27 | 3300003784 | Ga0055534_1000233 | Ga0055534_100023329 | 284 |
| 28 | 3300025263 | Ga0209565_1000053 | Ga0209565_100005342 | 284 |
| 29 | 3300025291 | Ga0209675_1000091 | Ga0209675_100009142 | 284 |
| 30 | 3300025294 | Ga0209025_1000085 | Ga0209025_1000085148 | 284 |
| 31 | 3300025295 | Ga0209564_1001022 | Ga0209564_100102221 | 284 |
| 32 | 3300025297 | Ga0209758_1035488 | Ga0209758_10354883 | 284 |
| 33 | 3300025299 | Ga0209256_1005552 | Ga0209256_10055523 | 284 |
| 34 | 3300046542 | Ga0495597_0000116 | Ga0495597_0000116_36282_37202 | 284 |
| 35 | 3300048925 | Ga0496122_0001583 | Ga0496122_0001583_33896_34864 | 285 |
| 36 | 3300048926 | Ga0496123_0001943 | Ga0496123_0001943_25022_25990 | 285 |
| 37 | 3300046474 | Ga0495605_0011006 | Ga0495605_0011006_435_1421 | 286 |
| 38 | 3300046500 | Ga0495596_0000568 | Ga0495596_0000568_9109_10095 | 286 |
| 39 | 3300046501 | Ga0495607_0021307 | Ga0495607_0021307_2219_3205 | 286 |
| 40 | 3300046513 | Ga0495616_0004925 | Ga0495616_0004925_1559_2545 | 286 |
| 41 | 3300046694 | Ga0495649_0025646 | Ga0495649_0025646_1611_2597 | 286 |
| 42 | 3300047320 | Ga0495672_0062151 | Ga0495672_0062151_663_1649 | 286 |
| 43 | 3300048907 | Ga0496104_0193296 | Ga0496104_0193296_219_1235 | 286 |
| 44 | 3300048925 | Ga0496122_0009575 | Ga0496122_0009575_5942_6928 | 286 |
| 45 | 3300048926 | Ga0496123_0002298 | Ga0496123_0002298_16745_17731 | 286 |
| 46 | 3300048927 | Ga0496124_0024187 | Ga0496124_0024187_3128_4096 | 286 |
| 47 | 3300025926 | Ga0207659_10000875 | Ga0207659_100008754 | 287 |
| 48 | 3300025936 | Ga0207670_10206722 | Ga0207670_102067222 | 287 |
| 49 | 3300003187 | JGI25151J46595_10003214 | JGI25151J46595_100032145 | 288 |
| 50 | 3300006237 | Ga0097621_100209049 | Ga0097621_1002090492 | 288 |
| 51 | 3300025294 | Ga0209025_1000038 | Ga0209025_1000038297 | 288 |
| 52 | 3300042876 | Ga0451577_0548946 | Ga0451577_0548946_107_1033 | 288 |
| 53 | 3300053090 | Ga0500646_0008750 | Ga0500646_0008750_602_1570 | 288 |
| 54 | 3300005337 | Ga0070682_100082607 | Ga0070682_1000826072 | 289 |
| 55 | 3300005456 | Ga0070678_100048291 | Ga0070678_1000482912 | 289 |
| 56 | 3300026121 | Ga0207683_10115737 | Ga0207683_101157372 | 289 |
| 57 | 3300006028 | Ga0070717_10360635 | Ga0070717_103606352 | 291 |
| 58 | 3300009148 | Ga0105243_10245814 | Ga0105243_102458141 | 291 |
| 59 | 3300050494 | nmdc:mga06z11_55443_c1 | nmdc:mga06z11_55443_c1_792_1715 | 291 |
| 60 | 3300005545 | Ga0070695_100198857 | Ga0070695_1001988572 | 292 |
| 61 | 3300006852 | Ga0075433_10063312 | Ga0075433_100633124 | 293 |
| 62 | 3300031911 | Ga0307412_10115904 | Ga0307412_101159042 | 293 |
| 63 | 3300046460 | Ga0495638_0067291 | Ga0495638_0067291_628_1596 | 293 |
| 64 | 3300046491 | Ga0495584_0016039 | Ga0495584_0016039_1161_2126 | 293 |
| 65 | 3300046525 | Ga0495663_0012540 | Ga0495663_0012540_847_1770 | 293 |
| 66 | 3300046539 | Ga0495621_0008890 | Ga0495621_0008890_383_1306 | 293 |
| 67 | 3300046615 | Ga0495656_0000109 | Ga0495656_0000109_31215_32138 | 293 |
| 68 | 3300048090 | Ga0495615_0002030 | Ga0495615_0002030_2185_3108 | 293 |
| 69 | 3300049824 | Ga0501045_0388915 | Ga0501045_0388915_87_1016 | 293 |
| 70 | 3300005467 | Ga0070706_100008752 | Ga0070706_1000087528 | 294 |
| 71 | 3300005468 | Ga0070707_100009514 | Ga0070707_1000095145 | 294 |
| 72 | 3300025910 | Ga0207684_10070260 | Ga0207684_100702602 | 294 |
| 73 | 3300050512 | nmdc:mga0n895_96007_c1 | nmdc:mga0n895_96007_c1_1023_1955 | 294 |
| 74 | 3300053154 | Ga0500619_000088 | Ga0500619_000088_12358_13332 | 294 |
| 75 | 3300003784 | Ga0055534_1010916 | Ga0055534_10109162 | 295 |
| 76 | 3300025284 | Ga0209130_1002576 | Ga0209130_10025762 | 295 |
| 77 | 3300025291 | Ga0209675_1010439 | Ga0209675_10104392 | 295 |
| 78 | 3300025292 | Ga0209676_1017867 | Ga0209676_10178672 | 295 |
| 79 | 3300025303 | Ga0209051_1012472 | Ga0209051_10124723 | 295 |
| 80 | 3300035170 | Ga0373943_0005457 | Ga0373943_0005457_2901_3848 | 295 |
| 81 | 3300035171 | Ga0373946_0040510 | Ga0373946_0040510_695_1642 | 295 |
| 82 | 3300035692 | Ga0373935_0054057 | Ga0373935_0054057_1397_2344 | 295 |
| 83 | 3300035725 | Ga0373947_0022660 | Ga0373947_0022660_1278_2225 | 295 |
| 84 | 3300039447 | Ga0436361_1065084 | Ga0436361_1065084_7684_8631 | 295 |
| 85 | 3300005616 | Ga0068852_100000171 | Ga0068852_10000017126 | 296 |
| 86 | 3300005834 | Ga0068851_10004408 | Ga0068851_100044082 | 296 |
| 87 | 3300006237 | Ga0097621_100036740 | Ga0097621_1000367404 | 296 |
| 88 | 3300006358 | Ga0068871_100052034 | Ga0068871_1000520342 | 296 |
| 89 | 3300007076 | Ga0075435_100010512 | Ga0075435_1000105122 | 296 |
| 90 | 3300009177 | Ga0105248_10049948 | Ga0105248_100499483 | 296 |
| 91 | 3300025321 | Ga0207656_10001376 | Ga0207656_100013762 | 296 |
| 92 | 3300025913 | Ga0207695_10088739 | Ga0207695_100887392 | 296 |
| 93 | 3300025941 | Ga0207711_10109994 | Ga0207711_101099942 | 296 |
| 94 | 3300026142 | Ga0207698_10001729 | Ga0207698_100017297 | 296 |
| 95 | 3300048908 | Ga0496105_0127141 | Ga0496105_0127141_42_1013 | 296 |
| 96 | 3300049570 | Ga0501033_0058449 | Ga0501033_0058449_1483_2439 | 296 |
| 97 | 3300049577 | Ga0501041_0002800 | Ga0501041_0002800_1965_2921 | 296 |
| 98 | 3300049590 | Ga0501074_0029127 | Ga0501074_0029127_2218_3174 | 296 |
| 99 | 3300049591 | Ga0501075_0002431 | Ga0501075_0002431_4969_5925 | 296 |
| 100 | 3300049592 | Ga0501076_0012563 | Ga0501076_0012563_802_1758 | 296 |
| 101 | 3300049741 | Ga0501079_0017990 | Ga0501079_0017990_3062_4018 | 296 |
| 102 | 3300050514 | nmdc:mga08x19_18905_c1 | nmdc:mga08x19_18905_c1_207_1157 | 296 |
| 103 | 3300050515 | nmdc:mga0a205_31700_c1 | nmdc:mga0a205_31700_c1_3972_4922 | 296 |
| 104 | 3300061734 | Ga0530510_0002501 | Ga0530510_0002501_4969_5925 | 296 |
| 105 | iso_pu_bacteria | 2513020051 | 2513229949 | 296 |
| 106 | 3300005329 | Ga0070683_100149766 | Ga0070683_1001497663 | 297 |
| 107 | 3300005331 | Ga0070670_100020391 | Ga0070670_1000203916 | 297 |
| 108 | 3300005338 | Ga0068868_100006062 | Ga0068868_1000060629 | 297 |
| 109 | 3300005343 | Ga0070687_100080326 | Ga0070687_1000803262 | 297 |
| 110 | 3300005354 | Ga0070675_100000914 | Ga0070675_10000091419 | 297 |
| 111 | 3300005355 | Ga0070671_100004642 | Ga0070671_1000046427 | 297 |
| 112 | 3300005356 | Ga0070674_100261913 | Ga0070674_1002619131 | 297 |
| 113 | 3300005456 | Ga0070678_100001277 | Ga0070678_1000012779 | 297 |
| 114 | 3300005543 | Ga0070672_100236720 | Ga0070672_1002367201 | 297 |
| 115 | 3300005564 | Ga0070664_100118953 | Ga0070664_1001189532 | 297 |
| 116 | 3300005578 | Ga0068854_100003877 | Ga0068854_1000038779 | 297 |
| 117 | 3300005618 | Ga0068864_100012735 | Ga0068864_1000127353 | 297 |
| 118 | 3300006358 | Ga0068871_100018406 | Ga0068871_1000184062 | 297 |
| 119 | 3300006358 | Ga0068871_100023560 | Ga0068871_1000235602 | 297 |
| 120 | 3300013296 | Ga0157374_10019302 | Ga0157374_100193026 | 297 |
| 121 | 3300013297 | Ga0157378_10088487 | Ga0157378_100884872 | 297 |
| 122 | 3300013306 | Ga0163162_10043534 | Ga0163162_100435343 | 297 |
| 123 | 3300013308 | Ga0157375_10020023 | Ga0157375_100200234 | 297 |
| 124 | 3300014969 | Ga0157376_10377297 | Ga0157376_103772972 | 297 |
| 125 | 3300017792 | Ga0163161_10343367 | Ga0163161_103433672 | 297 |
| 126 | 3300025918 | Ga0207662_10048840 | Ga0207662_100488402 | 297 |
| 127 | 3300025925 | Ga0207650_10001095 | Ga0207650_100010952 | 297 |
| 128 | 3300025931 | Ga0207644_10000147 | Ga0207644_1000014735 | 297 |
| 129 | 3300025942 | Ga0207689_10100992 | Ga0207689_101009922 | 297 |
| 130 | 3300025944 | Ga0207661_10068925 | Ga0207661_100689252 | 297 |
| 131 | 3300025944 | Ga0207661_10081039 | Ga0207661_100810392 | 297 |
| 132 | 3300025981 | Ga0207640_10302892 | Ga0207640_103028922 | 297 |
| 133 | 3300026095 | Ga0207676_10158841 | Ga0207676_101588412 | 297 |
| 134 | 3300026121 | Ga0207683_10000317 | Ga0207683_1000031747 | 297 |
| 135 | 3300041458 | Ga0451798_0667220 | Ga0451798_0667220_18_965 | 297 |
| 136 | 3300041486 | Ga0451807_1303413 | Ga0451807_1303413_363_1310 | 297 |
| 137 | 3300046674 | Ga0495588_0086032 | Ga0495588_0086032_647_1633 | 297 |
| 138 | 3300048904 | Ga0496101_0106158 | Ga0496101_0106158_249_1193 | 297 |
| 139 | 3300048910 | Ga0496107_0204234 | Ga0496107_0204234_167_1111 | 297 |
| 140 | 3300048912 | Ga0496109_0006848 | Ga0496109_0006848_4526_5470 | 297 |
| 141 | 3300048913 | Ga0496110_0019955 | Ga0496110_0019955_253_1197 | 297 |
| 142 | 3300048914 | Ga0496111_0179651 | Ga0496111_0179651_78_1022 | 297 |
| 143 | 3300005295 | Ga0065707_10092445 | Ga0065707_100924453 | 298 |
| 144 | 3300005458 | Ga0070681_10021386 | Ga0070681_100213864 | 298 |
| 145 | 3300005544 | Ga0070686_100067257 | Ga0070686_1000672572 | 298 |
| 146 | 3300005544 | Ga0070686_100166254 | Ga0070686_1001662542 | 298 |
| 147 | 3300005548 | Ga0070665_100211692 | Ga0070665_1002116922 | 298 |
| 148 | 3300006237 | Ga0097621_100011792 | Ga0097621_1000117926 | 298 |
| 149 | 3300014497 | Ga0182008_10005597 | Ga0182008_100055973 | 298 |
| 150 | 3300015262 | Ga0182007_10000617 | Ga0182007_1000061711 | 298 |
| 151 | 3300028379 | Ga0268266_10192689 | Ga0268266_101926891 | 298 |
| 152 | 3300034817 | Ga0373948_0015631 | Ga0373948_0015631_130_1089 | 298 |
| 153 | 3300035088 | Ga0373940_0014482 | Ga0373940_0014482_25_984 | 298 |
| 154 | 3300035112 | Ga0373932_0004013 | Ga0373932_0004013_2103_3062 | 298 |
| 155 | 3300035121 | Ga0373960_0045939 | Ga0373960_0045939_154_1113 | 298 |
| 156 | 3300035242 | Ga0373962_0015036 | Ga0373962_0015036_308_1267 | 298 |
| 157 | 3300035691 | Ga0373931_0002752 | Ga0373931_0002752_2411_3370 | 298 |
| 158 | 3300035691 | Ga0373931_0047510 | Ga0373931_0047510_1139_2080 | 298 |
| 159 | 3300045051 | Ga0451576_0028907 | Ga0451576_0028907_27_986 | 298 |
| 160 | 3300053148 | Ga0500590_056422 | Ga0500590_056422_760_1731 | 298 |
| 161 | 3300007076 | Ga0075435_100159174 | Ga0075435_1001591741 | 299 |
| 162 | 3300009011 | Ga0105251_10105976 | Ga0105251_101059761 | 299 |
| 163 | 3300009094 | Ga0111539_10235027 | Ga0111539_102350272 | 299 |
| 164 | 3300010159 | Ga0099796_10000615 | Ga0099796_100006155 | 299 |
| 165 | 3300028380 | Ga0268265_10549953 | Ga0268265_105499531 | 299 |
| 166 | 3300046474 | Ga0495605_0003185 | Ga0495605_0003185_3894_4841 | 299 |
| 167 | 3300046500 | Ga0495596_0000624 | Ga0495596_0000624_10891_11838 | 299 |
| 168 | 3300046501 | Ga0495607_0005823 | Ga0495607_0005823_835_1782 | 299 |
| 169 | 3300046512 | Ga0495610_0003249 | Ga0495610_0003249_1012_1959 | 299 |
| 170 | 3300046513 | Ga0495616_0004854 | Ga0495616_0004854_5954_6901 | 299 |
| 171 | 3300046538 | Ga0495609_0002814 | Ga0495609_0002814_8378_9325 | 299 |
| 172 | 3300046692 | Ga0495671_0003887 | Ga0495671_0003887_1190_2137 | 299 |
| 173 | 3300048919 | Ga0496116_0011913 | Ga0496116_0011913_5522_6469 | 299 |
| 174 | 3300048924 | Ga0496121_0007784 | Ga0496121_0007784_10728_11675 | 299 |
| 175 | 3300048926 | Ga0496123_0000967 | Ga0496123_0000967_42534_43481 | 299 |
| 176 | 3300050513 | nmdc:mga0rr50_327348_c1 | nmdc:mga0rr50_327348_c1_231_1181 | 299 |
| 177 | 3300005327 | Ga0070658_10019749 | Ga0070658_100197492 | 300 |
| 178 | 3300005330 | Ga0070690_100000575 | Ga0070690_1000005754 | 300 |
| 179 | 3300005334 | Ga0068869_100137325 | Ga0068869_1001373252 | 300 |
| 180 | 3300005344 | Ga0070661_100071842 | Ga0070661_1000718423 | 300 |
| 181 | 3300005366 | Ga0070659_100052983 | Ga0070659_1000529833 | 300 |
| 182 | 3300005457 | Ga0070662_100018544 | Ga0070662_1000185442 | 300 |
| 183 | 3300005546 | Ga0070696_100001426 | Ga0070696_10000142619 | 300 |
| 184 | 3300005578 | Ga0068854_100060076 | Ga0068854_1000600763 | 300 |
| 185 | 3300006353 | Ga0075370_10002278 | Ga0075370_100022787 | 300 |
| 186 | 3300009036 | Ga0105244_10001011 | Ga0105244_1000101114 | 300 |
| 187 | 3300009148 | Ga0105243_10007533 | Ga0105243_100075333 | 300 |
| 188 | 3300010375 | Ga0105239_10200687 | Ga0105239_102006872 | 300 |
| 189 | 3300011119 | Ga0105246_10076961 | Ga0105246_100769612 | 300 |
| 190 | 3300015262 | Ga0182007_10003714 | Ga0182007_100037147 | 300 |
| 191 | 3300025728 | Ga0207655_1018003 | Ga0207655_10180034 | 300 |
| 192 | 3300025920 | Ga0207649_10060535 | Ga0207649_100605351 | 300 |
| 193 | 3300025932 | Ga0207690_10031808 | Ga0207690_100318082 | 300 |
| 194 | 3300025933 | Ga0207706_10010532 | Ga0207706_100105328 | 300 |
| 195 | 3300025935 | Ga0207709_10001556 | Ga0207709_1000155612 | 300 |
| 196 | 3300025942 | Ga0207689_10118136 | Ga0207689_101181362 | 300 |
| 197 | 3300027682 | Ga0209971_1005391 | Ga0209971_10053913 | 300 |
| 198 | 3300035111 | Ga0373923_0052214 | Ga0373923_0052214_192_1154 | 300 |
| 199 | 3300035117 | Ga0373953_0032856 | Ga0373953_0032856_105_1067 | 300 |
| 200 | 3300035118 | Ga0373954_0050054 | Ga0373954_0050054_837_1799 | 300 |
| 201 | 3300035172 | Ga0373955_0031741 | Ga0373955_0031741_380_1342 | 300 |
| 202 | 3300035410 | Ga0373924_0005756 | Ga0373924_0005756_925_1887 | 300 |
| 203 | 3300035724 | Ga0373933_0006656 | Ga0373933_0006656_4163_5125 | 300 |
| 204 | 3300035725 | Ga0373947_0073539 | Ga0373947_0073539_508_1482 | 300 |
| 205 | 3300036401 | Ga0373937_0002785 | Ga0373937_0002785_5120_6082 | 300 |
| 206 | 3300044712 | Ga0453684_0492139 | Ga0453684_0492139_269_1225 | 300 |
| 207 | 3300045051 | Ga0451576_0006369 | Ga0451576_0006369_5428_6384 | 300 |
| 208 | 3300046529 | Ga0495652_0115235 | Ga0495652_0115235_995_1957 | 300 |
| 209 | 3300047317 | Ga0495604_0203311 | Ga0495604_0203311_120_1082 | 300 |
| 210 | 3300048919 | Ga0496116_0014246 | Ga0496116_0014246_1813_2757 | 300 |
| 211 | 3300048924 | Ga0496121_0046495 | Ga0496121_0046495_1046_1990 | 300 |
| 212 | 3300048927 | Ga0496124_0053851 | Ga0496124_0053851_2193_3137 | 300 |
| 213 | 3300048928 | Ga0496125_0023627 | Ga0496125_0023627_1899_2843 | 300 |
| 214 | 3300049743 | Ga0501081_0116000 | Ga0501081_0116000_160_1131 | 300 |
| 215 | 3300050496 | nmdc:mga07m45_14964_c1 | nmdc:mga07m45_14964_c1_2507_3451 | 300 |
| 216 | iso_pu_bacteria | 2881101125 | 2881104697 | 300 |
| 217 | 3300003781 | Ga0055536_1009558 | Ga0055536_10095584 | 301 |
| 218 | 3300003792 | Ga0055540_1010547 | Ga0055540_10105472 | 301 |
| 219 | 3300006038 | Ga0075365_10072295 | Ga0075365_100722952 | 301 |
| 220 | 3300006042 | Ga0075368_10022773 | Ga0075368_100227732 | 301 |
| 221 | 3300006048 | Ga0075363_100018174 | Ga0075363_1000181743 | 301 |
| 222 | 3300006177 | Ga0075362_10003439 | Ga0075362_100034393 | 301 |
| 223 | 3300006178 | Ga0075367_10179125 | Ga0075367_101791251 | 301 |
| 224 | 3300006186 | Ga0075369_10014473 | Ga0075369_100144733 | 301 |
| 225 | 3300006353 | Ga0075370_10057372 | Ga0075370_100573721 | 301 |
| 226 | 3300032005 | Ga0307411_10044619 | Ga0307411_100446193 | 301 |
| 227 | 3300046512 | Ga0495610_0001269 | Ga0495610_0001269_5858_6835 | 301 |
| 228 | 3300046538 | Ga0495609_0001256 | Ga0495609_0001256_6043_7020 | 301 |
| 229 | 3300048919 | Ga0496116_0028519 | Ga0496116_0028519_229_1206 | 301 |
| 230 | 3300048924 | Ga0496121_0051016 | Ga0496121_0051016_1708_2685 | 301 |
| 231 | 3300049573 | Ga0501037_0039939 | Ga0501037_0039939_1027_1995 | 301 |
| 232 | 3300049576 | Ga0501040_0050091 | Ga0501040_0050091_405_1373 | 301 |
| 233 | 3300049577 | Ga0501041_0028277 | Ga0501041_0028277_619_1587 | 301 |
| 234 | 3300049578 | Ga0501042_0029825 | Ga0501042_0029825_1440_2408 | 301 |
| 235 | 3300049582 | Ga0501048_0010243 | Ga0501048_0010243_5414_6382 | 301 |
| 236 | 3300049588 | Ga0501072_0141064 | Ga0501072_0141064_941_1909 | 301 |
| 237 | 3300049591 | Ga0501075_0020736 | Ga0501075_0020736_1661_2629 | 301 |
| 238 | 3300049592 | Ga0501076_0134672 | Ga0501076_0134672_458_1426 | 301 |
| 239 | 3300049593 | Ga0501077_0147788 | Ga0501077_0147788_74_1042 | 301 |
| 240 | 3300049742 | Ga0501080_0014848 | Ga0501080_0014848_5368_6336 | 301 |
| 241 | 3300049744 | Ga0501083_0179249 | Ga0501083_0179249_43_1011 | 301 |
| 242 | 3300049824 | Ga0501045_0003422 | Ga0501045_0003422_1724_2692 | 301 |
| 243 | 3300050490 | nmdc:mga03n38_4600_c1 | nmdc:mga03n38_4600_c1_1881_2858 | 301 |
| 244 | 3300050492 | nmdc:mga0yw44_20945_c1 | nmdc:mga0yw44_20945_c1_980_1957 | 301 |
| 245 | 3300050493 | nmdc:mga0k408_28320_c1 | nmdc:mga0k408_28320_c1_641_1618 | 301 |
| 246 | 3300050496 | nmdc:mga07m45_17022_c1 | nmdc:mga07m45_17022_c1_473_1450 | 301 |
| 247 | 3300050509 | nmdc:mga0qj67_3607_c1 | nmdc:mga0qj67_3607_c1_292_1470 | 301 |
| 248 | 3300060353 | Ga0501082_0015431 | Ga0501082_0015431_1583_2551 | 301 |
| 249 | 3300061734 | Ga0530510_0004066 | Ga0530510_0004066_85_1053 | 301 |
| 250 | iso_pu_bacteria | 2643221683 | 2644468795 | 301 |
| 251 | iso_pu_bacteria | 2842733646 | 2842736530 | 301 |
| 252 | iso_pu_bacteria | 2881412998 | 2881414546 | 301 |
| 253 | 3300005327 | Ga0070658_10009897 | Ga0070658_100098975 | 302 |
| 254 | 3300005334 | Ga0068869_100077556 | Ga0068869_1000775563 | 302 |
| 255 | 3300005459 | Ga0068867_100017628 | Ga0068867_1000176281 | 302 |
| 256 | 3300005530 | Ga0070679_100629100 | Ga0070679_1006291001 | 302 |
| 257 | 3300005543 | Ga0070672_100031956 | Ga0070672_1000319563 | 302 |
| 258 | 3300005548 | Ga0070665_100092556 | Ga0070665_1000925563 | 302 |
| 259 | 3300005616 | Ga0068852_100069343 | Ga0068852_1000693432 | 302 |
| 260 | 3300005718 | Ga0068866_10085982 | Ga0068866_100859822 | 302 |
| 261 | 3300005842 | Ga0068858_100044878 | Ga0068858_1000448785 | 302 |
| 262 | 3300005843 | Ga0068860_100006642 | Ga0068860_10000664213 | 302 |
| 263 | 3300005844 | Ga0068862_100009331 | Ga0068862_1000093315 | 302 |
| 264 | 3300005844 | Ga0068862_100095862 | Ga0068862_1000958622 | 302 |
| 265 | 3300006186 | Ga0075369_10127696 | Ga0075369_101276962 | 302 |
| 266 | 3300006195 | Ga0075366_10013463 | Ga0075366_100134633 | 302 |
| 267 | 3300006195 | Ga0075366_10018874 | Ga0075366_100188744 | 302 |
| 268 | 3300006353 | Ga0075370_10181533 | Ga0075370_101815331 | 302 |
| 269 | 3300009093 | Ga0105240_10155520 | Ga0105240_101555203 | 302 |
| 270 | 3300009176 | Ga0105242_10217568 | Ga0105242_102175682 | 302 |
| 271 | 3300009553 | Ga0105249_10018182 | Ga0105249_100181823 | 302 |
| 272 | 3300013297 | Ga0157378_10012649 | Ga0157378_100126498 | 302 |
| 273 | 3300013308 | Ga0157375_10058319 | Ga0157375_100583193 | 302 |
| 274 | 3300014326 | Ga0157380_10086697 | Ga0157380_100866972 | 302 |
| 275 | 3300014968 | Ga0157379_10042185 | Ga0157379_100421852 | 302 |
| 276 | 3300014969 | Ga0157376_10050947 | Ga0157376_100509472 | 302 |
| 277 | 3300017792 | Ga0163161_10026628 | Ga0163161_100266284 | 302 |
| 278 | 3300017792 | Ga0163161_10047330 | Ga0163161_100473302 | 302 |
| 279 | 3300025909 | Ga0207705_10011222 | Ga0207705_100112223 | 302 |
| 280 | 3300025923 | Ga0207681_10004690 | Ga0207681_100046905 | 302 |
| 281 | 3300025938 | Ga0207704_10103158 | Ga0207704_101031583 | 302 |
| 282 | 3300025940 | Ga0207691_10008538 | Ga0207691_100085386 | 302 |
| 283 | 3300025942 | Ga0207689_10157411 | Ga0207689_101574112 | 302 |
| 284 | 3300025961 | Ga0207712_10009743 | Ga0207712_100097435 | 302 |
| 285 | 3300026035 | Ga0207703_10077554 | Ga0207703_100775543 | 302 |
| 286 | 3300026088 | Ga0207641_10067354 | Ga0207641_100673542 | 302 |
| 287 | 3300026089 | Ga0207648_10000853 | Ga0207648_100008537 | 302 |
| 288 | 3300026118 | Ga0207675_100000415 | Ga0207675_10000041540 | 302 |
| 289 | 3300028379 | Ga0268266_10325305 | Ga0268266_103253052 | 302 |
| 290 | 3300028381 | Ga0268264_10007630 | Ga0268264_100076308 | 302 |
| 291 | 3300028577 | Ga0265318_10012091 | Ga0265318_100120914 | 302 |
| 292 | 3300031235 | Ga0265330_10032538 | Ga0265330_100325382 | 302 |
| 293 | 3300031238 | Ga0265332_10003766 | Ga0265332_100037663 | 302 |
| 294 | 3300031242 | Ga0265329_10012356 | Ga0265329_100123562 | 302 |
| 295 | 3300031250 | Ga0265331_10039398 | Ga0265331_100393982 | 302 |
| 296 | 3300031344 | Ga0265316_10040384 | Ga0265316_100403842 | 302 |
| 297 | 3300031711 | Ga0265314_10011575 | Ga0265314_100115755 | 302 |
| 298 | 3300031712 | Ga0265342_10005301 | Ga0265342_100053017 | 302 |
| 299 | 3300032002 | Ga0307416_100796514 | Ga0307416_1007965141 | 302 |
| 300 | 3300033179 | Ga0307507_10029624 | Ga0307507_100296243 | 302 |
| 301 | 3300033179 | Ga0307507_10096976 | Ga0307507_100969762 | 302 |
| 302 | 3300042007 | Ga0439449_0007495 | Ga0439449_0007495_45_995 | 302 |
| 303 | 3300047318 | Ga0495636_0009262 | Ga0495636_0009262_2397_3350 | 302 |
| 304 | 3300048919 | Ga0496116_0008659 | Ga0496116_0008659_2950_3903 | 302 |
| 305 | 3300048925 | Ga0496122_0000383 | Ga0496122_0000383_57032_58015 | 302 |
| 306 | 3300048926 | Ga0496123_0000249 | Ga0496123_0000249_36697_37680 | 302 |
| 307 | 3300050493 | nmdc:mga0k408_19531_c1 | nmdc:mga0k408_19531_c1_1218_2183 | 302 |
| 308 | 3300053136 | Ga0500559_0001462 | Ga0500559_0001462_7871_8854 | 302 |
| 309 | 3300053136 | Ga0500559_0050126 | Ga0500559_0050126_176_1159 | 302 |
| 310 | 3300053140 | Ga0500573_0069348 | Ga0500573_0069348_420_1403 | 302 |
| 311 | 3300053153 | Ga0500616_0073468 | Ga0500616_0073468_187_1200 | 302 |
| 312 | 3300053177 | Ga0500636_0136336 | Ga0500636_0136336_103_1083 | 302 |
| 313 | iso_pu_bacteria | 2513237150 | 2513952555 | 302 |
| 314 | iso_pu_bacteria | 2513237150 | 2513957469 | 302 |
| 315 | 3300003187 | JGI25151J46595_10003352 | JGI25151J46595_100033523 | 303 |
| 316 | 3300003187 | JGI25151J46595_10022894 | JGI25151J46595_100228942 | 303 |
| 317 | 3300003659 | JGI25404J52841_10003784 | JGI25404J52841_100037842 | 303 |
| 318 | 3300003771 | Ga0055526_1000288 | Ga0055526_100028830 | 303 |
| 319 | 3300003781 | Ga0055536_1000201 | Ga0055536_10002013 | 303 |
| 320 | 3300003784 | Ga0055534_1000191 | Ga0055534_10001918 | 303 |
| 321 | 3300005295 | Ga0065707_10084818 | Ga0065707_100848184 | 303 |
| 322 | 3300005331 | Ga0070670_100010321 | Ga0070670_1000103214 | 303 |
| 323 | 3300005338 | Ga0068868_100024878 | Ga0068868_1000248783 | 303 |
| 324 | 3300005347 | Ga0070668_100005959 | Ga0070668_1000059592 | 303 |
| 325 | 3300005353 | Ga0070669_100072924 | Ga0070669_1000729242 | 303 |
| 326 | 3300005356 | Ga0070674_100063629 | Ga0070674_1000636293 | 303 |
| 327 | 3300005456 | Ga0070678_100180341 | Ga0070678_1001803413 | 303 |
| 328 | 3300005543 | Ga0070672_100066885 | Ga0070672_1000668853 | 303 |
| 329 | 3300005547 | Ga0070693_100027532 | Ga0070693_1000275323 | 303 |
| 330 | 3300005577 | Ga0068857_100197071 | Ga0068857_1001970712 | 303 |
| 331 | 3300005719 | Ga0068861_100245834 | Ga0068861_1002458342 | 303 |
| 332 | 3300005840 | Ga0068870_10027639 | Ga0068870_100276392 | 303 |
| 333 | 3300005841 | Ga0068863_100025452 | Ga0068863_1000254523 | 303 |
| 334 | 3300005843 | Ga0068860_100017353 | Ga0068860_1000173534 | 303 |
| 335 | 3300005983 | Ga0081540_1000003 | Ga0081540_10000039 | 303 |
| 336 | 3300006237 | Ga0097621_100008234 | Ga0097621_1000082342 | 303 |
| 337 | 3300006844 | Ga0075428_100022170 | Ga0075428_1000221706 | 303 |
| 338 | 3300007265 | Ga0099794_10025206 | Ga0099794_100252062 | 303 |
| 339 | 3300009094 | Ga0111539_10002462 | Ga0111539_100024629 | 303 |
| 340 | 3300009551 | Ga0105238_10174994 | Ga0105238_101749943 | 303 |
| 341 | 3300013308 | Ga0157375_10005076 | Ga0157375_100050764 | 303 |
| 342 | 3300014325 | Ga0163163_10095474 | Ga0163163_100954742 | 303 |
| 343 | 3300014969 | Ga0157376_10007773 | Ga0157376_100077737 | 303 |
| 344 | 3300021361 | Ga0213872_10001596 | Ga0213872_100015967 | 303 |
| 345 | 3300025291 | Ga0209675_1000078 | Ga0209675_1000078112 | 303 |
| 346 | 3300025292 | Ga0209676_1000121 | Ga0209676_100012172 | 303 |
| 347 | 3300025292 | Ga0209676_1001320 | Ga0209676_10013204 | 303 |
| 348 | 3300025294 | Ga0209025_1000051 | Ga0209025_1000051116 | 303 |
| 349 | 3300025294 | Ga0209025_1001694 | Ga0209025_100169423 | 303 |
| 350 | 3300025295 | Ga0209564_1000133 | Ga0209564_100013367 | 303 |
| 351 | 3300025303 | Ga0209051_1000944 | Ga0209051_10009445 | 303 |
| 352 | 3300025908 | Ga0207643_10101752 | Ga0207643_101017522 | 303 |
| 353 | 3300025923 | Ga0207681_10104523 | Ga0207681_101045232 | 303 |
| 354 | 3300025925 | Ga0207650_10138185 | Ga0207650_101381852 | 303 |
| 355 | 3300025935 | Ga0207709_10000785 | Ga0207709_100007853 | 303 |
| 356 | 3300025940 | Ga0207691_10085090 | Ga0207691_100850902 | 303 |
| 357 | 3300025972 | Ga0207668_10007850 | Ga0207668_100078504 | 303 |
| 358 | 3300026035 | Ga0207703_10402975 | Ga0207703_104029752 | 303 |
| 359 | 3300026088 | Ga0207641_10101764 | Ga0207641_101017643 | 303 |
| 360 | 3300026089 | Ga0207648_10187049 | Ga0207648_101870491 | 303 |
| 361 | 3300026095 | Ga0207676_10009521 | Ga0207676_100095215 | 303 |
| 362 | 3300026118 | Ga0207675_100369363 | Ga0207675_1003693632 | 303 |
| 363 | 3300026121 | Ga0207683_10082033 | Ga0207683_100820332 | 303 |
| 364 | 3300027512 | Ga0209179_1001332 | Ga0209179_10013322 | 303 |
| 365 | 3300027671 | Ga0209588_1029369 | Ga0209588_10293692 | 303 |
| 366 | 3300027907 | Ga0207428_10014340 | Ga0207428_100143404 | 303 |
| 367 | 3300028381 | Ga0268264_10015304 | Ga0268264_100153044 | 303 |
| 368 | 3300046477 | Ga0495664_0065888 | Ga0495664_0065888_743_1795 | 303 |
| 369 | 3300050511 | nmdc:mga08y16_10093_c1 | nmdc:mga08y16_10093_c1_5599_6567 | 303 |
| 370 | 3300053117 | Ga0500593_000385 | Ga0500593_000385_6139_7101 | 303 |
| 371 | 3300053153 | Ga0500616_0030328 | Ga0500616_0030328_873_1943 | 303 |
| 372 | iso_pu_bacteria | 2842733646 | 2842736050 | 303 |
| 373 | iso_pu_bacteria | 2842747753 | 2842749131 | 303 |
| 374 | iso_pu_bacteria | 2904541872 | 2904542348 | 303 |
| 375 | iso_pu_bacteria | 2929160207 | 2929167621 | 303 |
| 376 | iso_pu_bacteria | 644736347 | 644750637 | 303 |
| 377 | 3300003771 | Ga0055526_1001419 | Ga0055526_100141913 | 304 |
| 378 | 3300003775 | Ga0055524_1015676 | Ga0055524_10156762 | 304 |
| 379 | 3300005364 | Ga0070673_100246948 | Ga0070673_1002469482 | 304 |
| 380 | 3300005563 | Ga0068855_100010517 | Ga0068855_1000105174 | 304 |
| 381 | 3300007788 | Ga0099795_10003770 | Ga0099795_100037703 | 304 |
| 382 | 3300009093 | Ga0105240_10006246 | Ga0105240_1000624618 | 304 |
| 383 | 3300009177 | Ga0105248_10311044 | Ga0105248_103110442 | 304 |
| 384 | 3300013104 | Ga0157370_10069039 | Ga0157370_100690393 | 304 |
| 385 | 3300025294 | Ga0209025_1001087 | Ga0209025_100108710 | 304 |
| 386 | 3300025295 | Ga0209564_1000170 | Ga0209564_100017081 | 304 |
| 387 | 3300025299 | Ga0209256_1000400 | Ga0209256_100040029 | 304 |
| 388 | 3300025909 | Ga0207705_10128615 | Ga0207705_101286152 | 304 |
| 389 | 3300025919 | Ga0207657_10059989 | Ga0207657_100599893 | 304 |
| 390 | 3300025921 | Ga0207652_10097886 | Ga0207652_100978863 | 304 |
| 391 | 3300025941 | Ga0207711_10046360 | Ga0207711_100463603 | 304 |
| 392 | 3300027512 | Ga0209179_1001419 | Ga0209179_10014192 | 304 |
| 393 | 3300031852 | Ga0307410_10220145 | Ga0307410_102201452 | 304 |
| 394 | 3300031911 | Ga0307412_10219676 | Ga0307412_102196762 | 304 |
| 395 | 3300031995 | Ga0307409_100139767 | Ga0307409_1001397672 | 304 |
| 396 | 3300032002 | Ga0307416_100309661 | Ga0307416_1003096612 | 304 |
| 397 | 3300038443 | Ga0395901_0087117 | Ga0395901_0087117_1599_2570 | 304 |
| 398 | 3300046539 | Ga0495621_0035327 | Ga0495621_0035327_297_1262 | 304 |
| 399 | 3300046543 | Ga0495645_0104857 | Ga0495645_0104857_352_1356 | 304 |
| 400 | 3300047472 | Ga0495686_0116498 | Ga0495686_0116498_82_1050 | 304 |
| 401 | 3300053086 | Ga0500578_0025224 | Ga0500578_0025224_2063_3031 | 304 |
| 402 | 3300053730 | Ga0500645_005317 | Ga0500645_005317_80_1048 | 304 |
| 403 | iso_pu_bacteria | 2513237165 | 2514040297 | 304 |
| 404 | iso_pu_bacteria | 2643221609 | 2644058447 | 304 |
| 405 | iso_pu_bacteria | 2643221683 | 2644465266 | 304 |
| 406 | 3300003911 | JGI25405J52794_10018190 | JGI25405J52794_100181901 | 305 |
| 407 | 3300005329 | Ga0070683_100496653 | Ga0070683_1004966531 | 305 |
| 408 | 3300005331 | Ga0070670_100138989 | Ga0070670_1001389892 | 305 |
| 409 | 3300005338 | Ga0068868_100172332 | Ga0068868_1001723323 | 305 |
| 410 | 3300005344 | Ga0070661_100183699 | Ga0070661_1001836992 | 305 |
| 411 | 3300005354 | Ga0070675_100257453 | Ga0070675_1002574532 | 305 |
| 412 | 3300005364 | Ga0070673_100441156 | Ga0070673_1004411561 | 305 |
| 413 | 3300005440 | Ga0070705_100178274 | Ga0070705_1001782741 | 305 |
| 414 | 3300005456 | Ga0070678_100281895 | Ga0070678_1002818951 | 305 |
| 415 | 3300005458 | Ga0070681_10109756 | Ga0070681_101097562 | 305 |
| 416 | 3300005467 | Ga0070706_100115470 | Ga0070706_1001154702 | 305 |
| 417 | 3300005536 | Ga0070697_100296300 | Ga0070697_1002963001 | 305 |
| 418 | 3300005543 | Ga0070672_100027831 | Ga0070672_1000278312 | 305 |
| 419 | 3300005578 | Ga0068854_100429708 | Ga0068854_1004297081 | 305 |
| 420 | 3300005616 | Ga0068852_100075529 | Ga0068852_1000755293 | 305 |
| 421 | 3300005618 | Ga0068864_100386951 | Ga0068864_1003869511 | 305 |
| 422 | 3300005937 | Ga0081455_10002647 | Ga0081455_1000264716 | 305 |
| 423 | 3300006237 | Ga0097621_100023333 | Ga0097621_1000233334 | 305 |
| 424 | 3300006948 | Ga0099826_10000031 | Ga0099826_1000003144 | 305 |
| 425 | 3300009098 | Ga0105245_10225345 | Ga0105245_102253452 | 305 |
| 426 | 3300009176 | Ga0105242_10276480 | Ga0105242_102764802 | 305 |
| 427 | 3300009177 | Ga0105248_10258815 | Ga0105248_102588152 | 305 |
| 428 | 3300013296 | Ga0157374_10185066 | Ga0157374_101850662 | 305 |
| 429 | 3300013306 | Ga0163162_10306712 | Ga0163162_103067121 | 305 |
| 430 | 3300013306 | Ga0163162_10527774 | Ga0163162_105277741 | 305 |
| 431 | 3300013308 | Ga0157375_10271601 | Ga0157375_102716012 | 305 |
| 432 | 3300014326 | Ga0157380_10048578 | Ga0157380_100485783 | 305 |
| 433 | 3300014968 | Ga0157379_10139400 | Ga0157379_101394003 | 305 |
| 434 | 3300014969 | Ga0157376_10181673 | Ga0157376_101816732 | 305 |
| 435 | 3300025263 | Ga0209565_1003299 | Ga0209565_10032995 | 305 |
| 436 | 3300025291 | Ga0209675_1001996 | Ga0209675_10019967 | 305 |
| 437 | 3300025303 | Ga0209051_1004615 | Ga0209051_10046156 | 305 |
| 438 | 3300025315 | Ga0207697_10102400 | Ga0207697_101024001 | 305 |
| 439 | 3300025910 | Ga0207684_10349691 | Ga0207684_103496911 | 305 |
| 440 | 3300025918 | Ga0207662_10207325 | Ga0207662_102073252 | 305 |
| 441 | 3300025925 | Ga0207650_10259037 | Ga0207650_102590371 | 305 |
| 442 | 3300025931 | Ga0207644_10047172 | Ga0207644_100471723 | 305 |
| 443 | 3300025934 | Ga0207686_10138439 | Ga0207686_101384392 | 305 |
| 444 | 3300025940 | Ga0207691_10007342 | Ga0207691_100073424 | 305 |
| 445 | 3300025945 | Ga0207679_10269642 | Ga0207679_102696421 | 305 |
| 446 | 3300025981 | Ga0207640_10421569 | Ga0207640_104215691 | 305 |
| 447 | 3300026035 | Ga0207703_10309919 | Ga0207703_103099191 | 305 |
| 448 | 3300026121 | Ga0207683_10213359 | Ga0207683_102133592 | 305 |
| 449 | 3300027666 | Ga0209282_1000011 | Ga0209282_1000011161 | 305 |
| 450 | 3300045051 | Ga0451576_0314990 | Ga0451576_0314990_263_1237 | 305 |
| 451 | 3300046454 | Ga0495592_0042728 | Ga0495592_0042728_1621_2595 | 305 |
| 452 | 3300046536 | Ga0495587_0011304 | Ga0495587_0011304_528_1502 | 305 |
| 453 | 3300046543 | Ga0495645_0002809 | Ga0495645_0002809_4464_5438 | 305 |
| 454 | 3300046559 | Ga0495667_0038499 | Ga0495667_0038499_1771_2745 | 305 |
| 455 | 3300046678 | Ga0495599_0036314 | Ga0495599_0036314_155_1129 | 305 |
| 456 | 3300046694 | Ga0495649_0026589 | Ga0495649_0026589_1478_2533 | 305 |
| 457 | 3300046809 | Ga0495600_0017664 | Ga0495600_0017664_1232_2206 | 305 |
| 458 | 3300046809 | Ga0495600_0169662 | Ga0495600_0169662_24_992 | 305 |
| 459 | 3300048911 | Ga0496108_0199692 | Ga0496108_0199692_424_1404 | 305 |
| 460 | 3300048913 | Ga0496110_0106462 | Ga0496110_0106462_1306_2286 | 305 |
| 461 | 3300048914 | Ga0496111_0015901 | Ga0496111_0015901_255_1235 | 305 |
| 462 | 3300048914 | Ga0496111_0192173 | Ga0496111_0192173_506_1495 | 305 |
| 463 | 3300053077 | Ga0495601_0006318 | Ga0495601_0006318_2313_3287 | 305 |
| 464 | 3300053085 | Ga0495619_0069933 | Ga0495619_0069933_1011_1985 | 305 |
| 465 | iso_pu_bacteria | 2842775625 | 2842779442 | 305 |
| 466 | 3300005329 | Ga0070683_100021732 | Ga0070683_1000217324 | 306 |
| 467 | 3300005365 | Ga0070688_100351196 | Ga0070688_1003511961 | 306 |
| 468 | 3300005563 | Ga0068855_100102443 | Ga0068855_1001024433 | 306 |
| 469 | 3300005614 | Ga0068856_100050075 | Ga0068856_1000500754 | 306 |
| 470 | 3300005616 | Ga0068852_100014091 | Ga0068852_1000140913 | 306 |
| 471 | 3300005718 | Ga0068866_10188643 | Ga0068866_101886432 | 306 |
| 472 | 3300009094 | Ga0111539_10056832 | Ga0111539_100568322 | 306 |
| 473 | 3300013102 | Ga0157371_10095083 | Ga0157371_100950832 | 306 |
| 474 | 3300013105 | Ga0157369_10225383 | Ga0157369_102253832 | 306 |
| 475 | 3300013307 | Ga0157372_10157194 | Ga0157372_101571943 | 306 |
| 476 | 3300025914 | Ga0207671_10102403 | Ga0207671_101024032 | 306 |
| 477 | 3300026142 | Ga0207698_10032159 | Ga0207698_100321594 | 306 |
| 478 | 3300028379 | Ga0268266_10158651 | Ga0268266_101586512 | 306 |
| 479 | 3300030521 | Ga0307511_10000976 | Ga0307511_1000097621 | 306 |
| 480 | 3300037418 | Ga0395900_0005201 | Ga0395900_0005201_1269_2261 | 306 |
| 481 | 3300038443 | Ga0395901_0010742 | Ga0395901_0010742_4319_5311 | 306 |
| 482 | 3300048917 | Ga0496114_0043438 | Ga0496114_0043438_1842_2840 | 306 |
| 483 | 3300053090 | Ga0500646_0002708 | Ga0500646_0002708_3260_4273 | 306 |
| 484 | 3300053098 | Ga0500650_0035802 | Ga0500650_0035802_243_1256 | 306 |
| 485 | 3300053151 | Ga0500604_0001071 | Ga0500604_0001071_5816_6829 | 306 |
| 486 | 3300053154 | Ga0500619_000081 | Ga0500619_000081_13083_14054 | 306 |
| 487 | iso_pu_bacteria | 2855730933 | 2855735703 | 306 |
| 488 | iso_pu_bacteria | 2855767633 | 2855772641 | 306 |
| 489 | 3300005289 | Ga0065704_10074045 | Ga0065704_100740453 | 307 |
| 490 | 3300005338 | Ga0068868_100362297 | Ga0068868_1003622972 | 307 |
| 491 | 3300005354 | Ga0070675_100012844 | Ga0070675_1000128443 | 307 |
| 492 | 3300005457 | Ga0070662_100317753 | Ga0070662_1003177531 | 307 |
| 493 | 3300005548 | Ga0070665_100165689 | Ga0070665_1001656892 | 307 |
| 494 | 3300005616 | Ga0068852_100294180 | Ga0068852_1002941802 | 307 |
| 495 | 3300005983 | Ga0081540_1010836 | Ga0081540_10108364 | 307 |
| 496 | 3300006178 | Ga0075367_10113943 | Ga0075367_101139432 | 307 |
| 497 | 3300006195 | Ga0075366_10010050 | Ga0075366_100100504 | 307 |
| 498 | 3300009094 | Ga0111539_10072650 | Ga0111539_100726502 | 307 |
| 499 | 3300025940 | Ga0207691_10248234 | Ga0207691_102482342 | 307 |
| 500 | 3300026089 | Ga0207648_10124451 | Ga0207648_101244511 | 307 |
| 501 | 3300037068 | Ga0373925_0224588 | Ga0373925_0224588_175_1152 | 307 |
| 502 | 3300037471 | Ga0395905_0393399 | Ga0395905_0393399_238_1227 | 307 |
| 503 | 3300048911 | Ga0496108_0085734 | Ga0496108_0085734_622_1599 | 307 |
| 504 | 3300048925 | Ga0496122_0019704 | Ga0496122_0019704_4290_5270 | 307 |
| 505 | 3300048928 | Ga0496125_0001761 | Ga0496125_0001761_9863_10843 | 307 |
| 506 | 3300048929 | Ga0496126_0025267 | Ga0496126_0025267_590_1570 | 307 |
| 507 | 3300049574 | Ga0501038_0147400 | Ga0501038_0147400_691_1668 | 307 |
| 508 | 3300049587 | Ga0501071_0117450 | Ga0501071_0117450_968_1945 | 307 |
| 509 | 3300049588 | Ga0501072_0012735 | Ga0501072_0012735_3468_4541 | 307 |
| 510 | 3300049591 | Ga0501075_0043541 | Ga0501075_0043541_1552_2625 | 307 |
| 511 | 3300049592 | Ga0501076_0009377 | Ga0501076_0009377_961_2034 | 307 |
| 512 | 3300050511 | nmdc:mga08y16_210911_c1 | nmdc:mga08y16_210911_c1_318_1301 | 307 |
| 513 | 3300053148 | Ga0500590_045762 | Ga0500590_045762_354_1331 | 307 |
| 514 | 3300060353 | Ga0501082_0074944 | Ga0501082_0074944_248_1321 | 307 |
| 515 | 3300060353 | Ga0501082_0201645 | Ga0501082_0201645_390_1367 | 307 |
| 516 | 3300061734 | Ga0530510_0011205 | Ga0530510_0011205_1768_2841 | 307 |
| 517 | iso_pu_bacteria | 2838054893 | 2838056811 | 307 |
| 518 | 3300005335 | Ga0070666_10069130 | Ga0070666_100691303 | 308 |
| 519 | 3300005530 | Ga0070679_100037763 | Ga0070679_1000377631 | 308 |
| 520 | 3300005536 | Ga0070697_100038873 | Ga0070697_1000388732 | 308 |
| 521 | 3300005616 | Ga0068852_100007385 | Ga0068852_1000073856 | 308 |
| 522 | 3300005834 | Ga0068851_10006790 | Ga0068851_100067904 | 308 |
| 523 | 3300005841 | Ga0068863_100055454 | Ga0068863_1000554542 | 308 |
| 524 | 3300006871 | Ga0075434_100346312 | Ga0075434_1003463122 | 308 |
| 525 | 3300006948 | Ga0099826_10000074 | Ga0099826_1000007437 | 308 |
| 526 | 3300009011 | Ga0105251_10015793 | Ga0105251_100157932 | 308 |
| 527 | 3300025321 | Ga0207656_10002176 | Ga0207656_100021765 | 308 |
| 528 | 3300025735 | Ga0207713_1027016 | Ga0207713_10270162 | 308 |
| 529 | 3300025940 | Ga0207691_10000123 | Ga0207691_1000012345 | 308 |
| 530 | 3300025981 | Ga0207640_10024546 | Ga0207640_100245462 | 308 |
| 531 | 3300026023 | Ga0207677_10002235 | Ga0207677_100022359 | 308 |
| 532 | 3300026142 | Ga0207698_10009508 | Ga0207698_100095082 | 308 |
| 533 | 3300027666 | Ga0209282_1000113 | Ga0209282_100011310 | 308 |
| 534 | 3300031911 | Ga0307412_10144364 | Ga0307412_101443642 | 308 |
| 535 | 3300032004 | Ga0307414_10078323 | Ga0307414_100783232 | 308 |
| 536 | 3300042007 | Ga0439449_0000184 | Ga0439449_0000184_7773_8747 | 308 |
| 537 | 3300042532 | Ga0450893_0003656 | Ga0450893_0003656_389_1360 | 308 |
| 538 | 3300044694 | Ga0466963_0031491 | Ga0466963_0031491_163_1125 | 308 |
| 539 | 3300045976 | Ga0466967_0034573 | Ga0466967_0034573_1399_2361 | 308 |
| 540 | 3300046457 | Ga0495590_0021611 | Ga0495590_0021611_352_1497 | 308 |
| 541 | 3300046474 | Ga0495605_0001934 | Ga0495605_0001934_8636_9781 | 308 |
| 542 | 3300046491 | Ga0495584_0049005 | Ga0495584_0049005_844_1989 | 308 |
| 543 | 3300046500 | Ga0495596_0000121 | Ga0495596_0000121_6638_7633 | 308 |
| 544 | 3300046512 | Ga0495610_0000387 | Ga0495610_0000387_6571_7566 | 308 |
| 545 | 3300046513 | Ga0495616_0005358 | Ga0495616_0005358_6424_7569 | 308 |
| 546 | 3300046538 | Ga0495609_0001279 | Ga0495609_0001279_10446_11441 | 308 |
| 547 | 3300046665 | Ga0495661_0003687 | Ga0495661_0003687_654_1649 | 308 |
| 548 | 3300046691 | Ga0495670_0051539 | Ga0495670_0051539_181_1176 | 308 |
| 549 | 3300046692 | Ga0495671_0000494 | Ga0495671_0000494_6343_7488 | 308 |
| 550 | 3300047320 | Ga0495672_0017538 | Ga0495672_0017538_175_1170 | 308 |
| 551 | 3300048919 | Ga0496116_0004217 | Ga0496116_0004217_10020_11165 | 308 |
| 552 | 3300048924 | Ga0496121_0001338 | Ga0496121_0001338_5509_6654 | 308 |
| 553 | 3300048925 | Ga0496122_0000930 | Ga0496122_0000930_4234_5379 | 308 |
| 554 | 3300048926 | Ga0496123_0000369 | Ga0496123_0000369_6475_7620 | 308 |
| 555 | 3300048928 | Ga0496125_0056558 | Ga0496125_0056558_522_1667 | 308 |
| 556 | 3300048929 | Ga0496126_0069817 | Ga0496126_0069817_115_1110 | 308 |
| 557 | 3300059424 | Ga0590075_012593 | Ga0590075_012593_543_1514 | 308 |
| 558 | 3300005985 | Ga0081539_10068990 | Ga0081539_100689902 | 309 |
| 559 | 3300037312 | Ga0395899_0003707 | Ga0395899_0003707_8940_9905 | 309 |
| 560 | 3300037418 | Ga0395900_0029035 | Ga0395900_0029035_891_1856 | 309 |
| 561 | 3300037466 | Ga0395898_0006230 | Ga0395898_0006230_3731_4696 | 309 |
| 562 | 3300037466 | Ga0395898_0191534 | Ga0395898_0191534_305_1279 | 309 |
| 563 | 3300037471 | Ga0395905_0060121 | Ga0395905_0060121_1567_2541 | 309 |
| 564 | 3300038443 | Ga0395901_0022578 | Ga0395901_0022578_2095_3060 | 309 |
| 565 | 3300046684 | Ga0495669_0039820 | Ga0495669_0039820_29_1003 | 309 |
| 566 | 3300047318 | Ga0495636_0039683 | Ga0495636_0039683_547_1521 | 309 |
| 567 | 3300048924 | Ga0496121_0052904 | Ga0496121_0052904_2280_3284 | 309 |
| 568 | 3300049570 | Ga0501033_0005170 | Ga0501033_0005170_2397_3401 | 309 |
| 569 | 3300049571 | Ga0501034_0041075 | Ga0501034_0041075_1974_2978 | 309 |
| 570 | 3300049575 | Ga0501039_0190641 | Ga0501039_0190641_225_1229 | 309 |
| 571 | 3300049581 | Ga0501047_0026159 | Ga0501047_0026159_1903_2907 | 309 |
| 572 | 3300049822 | Ga0501035_0013969 | Ga0501035_0013969_4138_5142 | 309 |
| 573 | 3300049823 | Ga0501044_0002878 | Ga0501044_0002878_17427_18431 | 309 |
| 574 | 3300050492 | nmdc:mga0yw44_37002_c1 | nmdc:mga0yw44_37002_c1_725_1765 | 309 |
| 575 | iso_pu_bacteria | 2738543013 | 2739249236 | 309 |
| 576 | iso_pu_bacteria | 2834641062 | 2834644212 | 309 |
| 577 | iso_pu_bacteria | 2928115317 | 2928120274 | 309 |
| 578 | iso_pu_bacteria | 8003400568 | 8003401918 | 309 |
| 579 | 3300003187 | JGI25151J46595_10000075 | JGI25151J46595_1000007551 | 310 |
| 580 | 3300005834 | Ga0068851_10046969 | Ga0068851_100469691 | 310 |
| 581 | 3300006948 | Ga0099826_10000004 | Ga0099826_1000000441 | 310 |
| 582 | 3300025294 | Ga0209025_1000027 | Ga0209025_1000027291 | 310 |
| 583 | 3300025321 | Ga0207656_10025627 | Ga0207656_100256272 | 310 |
| 584 | 3300025735 | Ga0207713_1083263 | Ga0207713_10832631 | 310 |
| 585 | 3300025945 | Ga0207679_10026007 | Ga0207679_100260073 | 310 |
| 586 | 3300026078 | Ga0207702_10475372 | Ga0207702_104753721 | 310 |
| 587 | 3300027666 | Ga0209282_1000078 | Ga0209282_100007842 | 310 |
| 588 | iso_pu_bacteria | 2904541872 | 2904546169 | 310 |
| 589 | iso_pu_bacteria | 2929160207 | 2929163988 | 310 |
| 590 | 3300015683 | Ga0183362_10001 | Ga0183362_100011677 | 311 |
| 591 | 3300046528 | Ga0495642_0033512 | Ga0495642_0033512_541_1524 | 311 |
| 592 | 3300037312 | Ga0395899_0001705 | Ga0395899_0001705_9695_10678 | 312 |
| 593 | 3300037418 | Ga0395900_0001713 | Ga0395900_0001713_7507_8490 | 312 |
| 594 | 3300037466 | Ga0395898_0011212 | Ga0395898_0011212_715_1698 | 312 |
| 595 | 3300038443 | Ga0395901_0004147 | Ga0395901_0004147_7632_8615 | 312 |
| 596 | iso_pu_bacteria | 2904449895 | 2904455341 | 312 |
| 597 | iso_pu_bacteria | 2904456579 | 2904460509 | 312 |
| 598 | iso_pu_bacteria | 2929520902 | 2929524713 | 312 |
| 599 | iso_pu_bacteria | 2945972063 | 2945976823 | 312 |
| 600 | 3300049571 | Ga0501034_0161318 | Ga0501034_0161318_15_998 | 313 |
| 601 | iso_pu_bacteria | 2831265667 | 2831270587 | 313 |
| 602 | iso_pu_bacteria | 2899924645 | 2899925452 | 313 |
| 603 | iso_pu_bacteria | 2928051484 | 2928053642 | 313 |
| 604 | iso_pu_bacteria | 2928064002 | 2928067189 | 313 |
| 605 | iso_pu_bacteria | 2928084124 | 2928085134 | 313 |
| 606 | iso_pu_bacteria | 8003400568 | 8003405207 | 313 |
| 607 | 3300003187 | JGI25151J46595_10011276 | JGI25151J46595_100112763 | 314 |
| 608 | 3300012502 | Ga0157347_1005083 | Ga0157347_10050832 | 314 |
| 609 | 3300014497 | Ga0182008_10013054 | Ga0182008_100130544 | 314 |
| 610 | 3300017792 | Ga0163161_10000065 | Ga0163161_10000065109 | 314 |
| 611 | 3300025294 | Ga0209025_1000096 | Ga0209025_100009636 | 314 |
| 612 | 3300028794 | Ga0307515_10201912 | Ga0307515_102019122 | 314 |
| 613 | 3300031911 | Ga0307412_10015702 | Ga0307412_100157023 | 314 |
| 614 | iso_pu_bacteria | 2945909444 | 2945912662 | 314 |
| 615 | iso_pu_bacteria | 2945984333 | 2945985049 | 314 |
| 616 | 3300005364 | Ga0070673_100336883 | Ga0070673_1003368832 | 315 |
| 617 | 3300005367 | Ga0070667_100015926 | Ga0070667_1000159261 | 315 |
| 618 | 3300005543 | Ga0070672_100090460 | Ga0070672_1000904602 | 315 |
| 619 | 3300013306 | Ga0163162_10004924 | Ga0163162_1000492412 | 315 |
| 620 | 3300017792 | Ga0163161_10030339 | Ga0163161_100303393 | 315 |
| 621 | 3300025924 | Ga0207694_10157198 | Ga0207694_101571982 | 315 |
| 622 | 3300028379 | Ga0268266_10302226 | Ga0268266_103022262 | 315 |
| 623 | 3300031251 | Ga0265327_10022499 | Ga0265327_100224992 | 315 |
| 624 | 3300046475 | Ga0495639_0002606 | Ga0495639_0002606_4682_5677 | 315 |
| 625 | 3300046557 | Ga0495622_0085934 | Ga0495622_0085934_93_1088 | 315 |
| 626 | 3300046691 | Ga0495670_0022371 | Ga0495670_0022371_138_1133 | 315 |
| 627 | 3300048903 | Ga0496100_0014235 | Ga0496100_0014235_1776_2771 | 315 |
| 628 | 3300048904 | Ga0496101_0004822 | Ga0496101_0004822_1712_2707 | 315 |
| 629 | 3300048908 | Ga0496105_0001248 | Ga0496105_0001248_5022_6017 | 315 |
| 630 | 3300048911 | Ga0496108_0199476 | Ga0496108_0199476_263_1258 | 315 |
| 631 | 3300048912 | Ga0496109_0060743 | Ga0496109_0060743_645_1640 | 315 |
| 632 | 3300048913 | Ga0496110_0078584 | Ga0496110_0078584_911_1906 | 315 |
| 633 | 3300003187 | JGI25151J46595_10001007 | JGI25151J46595_100010073 | 316 |
| 634 | 3300003187 | JGI25151J46595_10003059 | JGI25151J46595_100030597 | 316 |
| 635 | 3300003578 | Ga0006562J51391_1118556 | Ga0006562J51391_11185564 | 316 |
| 636 | 3300003781 | Ga0055536_1011408 | Ga0055536_10114084 | 316 |
| 637 | 3300003792 | Ga0055540_1002232 | Ga0055540_10022329 | 316 |
| 638 | 3300003792 | Ga0055540_1009260 | Ga0055540_10092604 | 316 |
| 639 | 3300003794 | Ga0055531_10006424 | Ga0055531_100064244 | 316 |
| 640 | 3300005288 | Ga0065714_10078094 | Ga0065714_100780943 | 316 |
| 641 | 3300005354 | Ga0070675_100133025 | Ga0070675_1001330251 | 316 |
| 642 | 3300006353 | Ga0075370_10003866 | Ga0075370_100038666 | 316 |
| 643 | 3300006353 | Ga0075370_10073892 | Ga0075370_100738922 | 316 |
| 644 | 3300009148 | Ga0105243_10061593 | Ga0105243_100615932 | 316 |
| 645 | 3300013100 | Ga0157373_10054161 | Ga0157373_100541612 | 316 |
| 646 | 3300025258 | Ga0209129_1004158 | Ga0209129_10041584 | 316 |
| 647 | 3300025292 | Ga0209676_1001396 | Ga0209676_10013965 | 316 |
| 648 | 3300025294 | Ga0209025_1000157 | Ga0209025_1000157103 | 316 |
| 649 | 3300025298 | Ga0209050_1002090 | Ga0209050_10020902 | 316 |
| 650 | 3300025303 | Ga0209051_1000092 | Ga0209051_1000092140 | 316 |
| 651 | 3300025303 | Ga0209051_1000490 | Ga0209051_100049045 | 316 |
| 652 | 3300025304 | Ga0209257_1000508 | Ga0209257_100050855 | 316 |
| 653 | 3300028794 | Ga0307515_10000028 | Ga0307515_10000028176 | 316 |
| 654 | 3300031251 | Ga0265327_10000465 | Ga0265327_1000046557 | 316 |
| 655 | 3300031548 | Ga0307408_100013471 | Ga0307408_1000134713 | 316 |
| 656 | 3300031548 | Ga0307408_100044752 | Ga0307408_1000447524 | 316 |
| 657 | 3300031649 | Ga0307514_10001952 | Ga0307514_100019524 | 316 |
| 658 | 3300031901 | Ga0307406_10000194 | Ga0307406_1000019417 | 316 |
| 659 | 3300031911 | Ga0307412_10005778 | Ga0307412_100057784 | 316 |
| 660 | 3300032005 | Ga0307411_10150192 | Ga0307411_101501923 | 316 |
| 661 | 3300041404 | Ga0439436_0003275 | Ga0439436_0003275_250_1260 | 316 |
| 662 | 3300041405 | Ga0439438_011801 | Ga0439438_011801_710_1705 | 316 |
| 663 | 3300042006 | Ga0439432_004127 | Ga0439432_004127_1879_2874 | 316 |
| 664 | 3300042146 | Ga0450907_019469 | Ga0450907_019469_14_1009 | 316 |
| 665 | 3300042184 | Ga0450908_003708 | Ga0450908_003708_1006_2016 | 316 |
| 666 | 3300042185 | Ga0450909_001072 | Ga0450909_001072_950_1945 | 316 |
| 667 | 3300042435 | Ga0439434_0001880 | Ga0439434_0001880_3182_4192 | 316 |
| 668 | 3300044901 | Ga0466960_0077707 | Ga0466960_0077707_579_1580 | 316 |
| 669 | 3300046515 | Ga0495620_0009726 | Ga0495620_0009726_2528_3538 | 316 |
| 670 | 3300046616 | Ga0495668_0036686 | Ga0495668_0036686_317_1327 | 316 |
| 671 | 3300046692 | Ga0495671_0004931 | Ga0495671_0004931_6779_7789 | 316 |
| 672 | 3300046809 | Ga0495600_0051794 | Ga0495600_0051794_12_1091 | 316 |
| 673 | 3300050489 | nmdc:mga03683_13376_c1 | nmdc:mga03683_13376_c1_1619_2629 | 316 |
| 674 | 3300050496 | nmdc:mga07m45_103017_c1 | nmdc:mga07m45_103017_c1_44_1036 | 316 |
| 675 | 3300050496 | nmdc:mga07m45_6982_c1 | nmdc:mga07m45_6982_c1_4345_5355 | 316 |
| 676 | 3300053079 | Ga0500610_0001394 | Ga0500610_0001394_1299_2309 | 316 |
| 677 | 3300053079 | Ga0500610_0005581 | Ga0500610_0005581_766_1776 | 316 |
| 678 | 3300053121 | Ga0500607_013519 | Ga0500607_013519_1948_2958 | 316 |
| 679 | 3300053122 | Ga0500608_003408 | Ga0500608_003408_3257_4249 | 316 |
| 680 | 3300053158 | Ga0500627_0004346 | Ga0500627_0004346_2884_3894 | 316 |
| 681 | 3300053161 | Ga0500634_0015722 | Ga0500634_0015722_1357_2367 | 316 |
| 682 | iso_pu_bacteria | 2643221672 | 2644398459 | 316 |
| 683 | 3300002773 | JGI25152J39213_1006739 | JGI25152J39213_10067391 | 317 |
| 684 | 3300002774 | JGI25150J39212_1004124 | JGI25150J39212_10041242 | 317 |
| 685 | 3300002987 | JGI25159J45721_1003238 | JGI25159J45721_10032382 | 317 |
| 686 | 3300003187 | JGI25151J46595_10023197 | JGI25151J46595_100231973 | 317 |
| 687 | 3300003354 | JGI25160J50197_1005351 | JGI25160J50197_10053512 | 317 |
| 688 | 3300003374 | JGI25161J50226_1001166 | JGI25161J50226_10011664 | 317 |
| 689 | 3300003374 | JGI25161J50226_1003857 | JGI25161J50226_10038572 | 317 |
| 690 | 3300003761 | Ga0055535_1001794 | Ga0055535_10017947 | 317 |
| 691 | 3300003762 | Ga0055542_1000004 | Ga0055542_1000004303 | 317 |
| 692 | 3300003771 | Ga0055526_1010824 | Ga0055526_10108244 | 317 |
| 693 | 3300003773 | Ga0055537_1004186 | Ga0055537_10041864 | 317 |
| 694 | 3300003775 | Ga0055524_1008320 | Ga0055524_10083203 | 317 |
| 695 | 3300003781 | Ga0055536_1010487 | Ga0055536_10104874 | 317 |
| 696 | 3300003791 | Ga0055530_10002962 | Ga0055530_100029627 | 317 |
| 697 | 3300003794 | Ga0055531_10015624 | Ga0055531_100156244 | 317 |
| 698 | 3300004625 | Ga0055543_1001238 | Ga0055543_10012385 | 317 |
| 699 | 3300005262 | Ga0065165_1003020 | Ga0065165_10030208 | 317 |
| 700 | 3300005539 | Ga0068853_100030557 | Ga0068853_1000305572 | 317 |
| 701 | 3300013102 | Ga0157371_10103219 | Ga0157371_101032192 | 317 |
| 702 | 3300025228 | Ga0209672_100961 | Ga0209672_10096112 | 317 |
| 703 | 3300025229 | Ga0209147_102289 | Ga0209147_1022895 | 317 |
| 704 | 3300025242 | Ga0209258_100022 | Ga0209258_100022304 | 317 |
| 705 | 3300025245 | Ga0207425_1000138 | Ga0207425_10001385 | 317 |
| 706 | 3300025245 | Ga0207425_1003117 | Ga0207425_10031172 | 317 |
| 707 | 3300025254 | Ga0209148_1000034 | Ga0209148_1000034304 | 317 |
| 708 | 3300025258 | Ga0209129_1000023 | Ga0209129_1000023377 | 317 |
| 709 | 3300025258 | Ga0209129_1002257 | Ga0209129_10022579 | 317 |
| 710 | 3300025258 | Ga0209129_1007672 | Ga0209129_10076722 | 317 |
| 711 | 3300025263 | Ga0209565_1000649 | Ga0209565_10006499 | 317 |
| 712 | 3300025263 | Ga0209565_1014171 | Ga0209565_10141712 | 317 |
| 713 | 3300025273 | Ga0209673_1001445 | Ga0209673_100144514 | 317 |
| 714 | 3300025273 | Ga0209673_1001448 | Ga0209673_10014489 | 317 |
| 715 | 3300025284 | Ga0209130_1000222 | Ga0209130_100022258 | 317 |
| 716 | 3300025284 | Ga0209130_1001231 | Ga0209130_10012314 | 317 |
| 717 | 3300025291 | Ga0209675_1002241 | Ga0209675_10022413 | 317 |
| 718 | 3300025291 | Ga0209675_1002494 | Ga0209675_10024947 | 317 |
| 719 | 3300025291 | Ga0209675_1011454 | Ga0209675_10114542 | 317 |
| 720 | 3300025292 | Ga0209676_1000005 | Ga0209676_1000005420 | 317 |
| 721 | 3300025292 | Ga0209676_1008874 | Ga0209676_10088745 | 317 |
| 722 | 3300025294 | Ga0209025_1000476 | Ga0209025_100047618 | 317 |
| 723 | 3300025294 | Ga0209025_1016183 | Ga0209025_10161834 | 317 |
| 724 | 3300025294 | Ga0209025_1023843 | Ga0209025_10238433 | 317 |
| 725 | 3300025294 | Ga0209025_1023882 | Ga0209025_10238822 | 317 |
| 726 | 3300025295 | Ga0209564_1000400 | Ga0209564_100040014 | 317 |
| 727 | 3300025295 | Ga0209564_1001357 | Ga0209564_10013575 | 317 |
| 728 | 3300025297 | Ga0209758_1000064 | Ga0209758_1000064278 | 317 |
| 729 | 3300025297 | Ga0209758_1020079 | Ga0209758_10200793 | 317 |
| 730 | 3300025297 | Ga0209758_1020110 | Ga0209758_10201102 | 317 |
| 731 | 3300025298 | Ga0209050_1000007 | Ga0209050_1000007677 | 317 |
| 732 | 3300025299 | Ga0209256_1000038 | Ga0209256_1000038286 | 317 |
| 733 | 3300025299 | Ga0209256_1000115 | Ga0209256_100011519 | 317 |
| 734 | 3300025302 | Ga0207426_1000001 | Ga0207426_10000011285 | 317 |
| 735 | 3300025302 | Ga0207426_1000090 | Ga0207426_1000090237 | 317 |
| 736 | 3300025303 | Ga0209051_1000009 | Ga0209051_1000009420 | 317 |
| 737 | 3300025303 | Ga0209051_1008125 | Ga0209051_10081254 | 317 |
| 738 | 3300025304 | Ga0209257_1000011 | Ga0209257_1000011394 | 317 |
| 739 | 3300025304 | Ga0209257_1014189 | Ga0209257_10141894 | 317 |
| 740 | 3300026041 | Ga0207639_10004693 | Ga0207639_100046936 | 317 |
| 741 | 3300042012 | Ga0439455_0019893 | Ga0439455_0019893_259_1275 | 317 |
| 742 | 3300046460 | Ga0495638_0038991 | Ga0495638_0038991_943_1956 | 317 |
| 743 | 3300046513 | Ga0495616_0022482 | Ga0495616_0022482_1503_2498 | 317 |
| 744 | 3300046530 | Ga0495654_0031657 | Ga0495654_0031657_1523_2518 | 317 |
| 745 | 3300046683 | Ga0495658_0056819 | Ga0495658_0056819_1132_2127 | 317 |
| 746 | 3300047321 | Ga0495676_0110862 | Ga0495676_0110862_912_1907 | 317 |
| 747 | 3300048089 | Ga0495614_0031760 | Ga0495614_0031760_20_1015 | 317 |
| 748 | 3300048919 | Ga0496116_0030472 | Ga0496116_0030472_1113_2126 | 317 |
| 749 | 3300048920 | Ga0496117_0035438 | Ga0496117_0035438_1067_2080 | 317 |
| 750 | 3300048920 | Ga0496117_0037362 | Ga0496117_0037362_192_1208 | 317 |
| 751 | 3300048921 | Ga0496118_0041873 | Ga0496118_0041873_530_1546 | 317 |
| 752 | 3300048921 | Ga0496118_0056153 | Ga0496118_0056153_289_1284 | 317 |
| 753 | 3300048924 | Ga0496121_0118983 | Ga0496121_0118983_135_1130 | 317 |
| 754 | 3300048925 | Ga0496122_0101846 | Ga0496122_0101846_166_1161 | 317 |
| 755 | 3300050496 | nmdc:mga07m45_169966_c1 | nmdc:mga07m45_169966_c1_30_1025 | 317 |
| 756 | 3300053093 | Ga0500651_0000038 | Ga0500651_0000038_31586_32581 | 317 |
| 757 | 3300053110 | Ga0500571_000054 | Ga0500571_000054_19602_20597 | 317 |
| 758 | 3300053128 | Ga0500626_019208 | Ga0500626_019208_1890_2885 | 317 |
| 759 | 3300053133 | Ga0500655_000123 | Ga0500655_000123_17050_18045 | 317 |
| 760 | 3300053134 | Ga0500658_0000237 | Ga0500658_0000237_21201_22196 | 317 |
| 761 | 3300053134 | Ga0500658_0000266 | Ga0500658_0000266_15213_16208 | 317 |
| 762 | 3300053136 | Ga0500559_0008198 | Ga0500559_0008198_2040_3035 | 317 |
| 763 | 3300053138 | Ga0500564_024230 | Ga0500564_024230_145_1140 | 317 |
| 764 | 3300053139 | Ga0500568_0005096 | Ga0500568_0005096_476_1471 | 317 |
| 765 | 3300053141 | Ga0500574_007801 | Ga0500574_007801_613_1608 | 317 |
| 766 | 3300053161 | Ga0500634_0048318 | Ga0500634_0048318_528_1523 | 317 |
| 767 | iso_pu_bacteria | 2599185214 | 2599624723 | 317 |
| 768 | iso_pu_bacteria | 2599185226 | 2599672415 | 317 |
| 769 | iso_pu_bacteria | 2599185227 | 2599685003 | 317 |
| 770 | iso_pu_bacteria | 2599185229 | 2599694024 | 317 |
| 771 | iso_pu_bacteria | 2643221658 | 2644329405 | 317 |
| 772 | iso_pu_bacteria | 2818991446 | 2819596101 | 317 |
| 773 | iso_pu_bacteria | 2928070936 | 2928076151 | 317 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hkb-assembly1.cif.gz_A | tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d | 0.9398 | 37 | 315 |
| 5oku-assembly1.cif.gz_A | r. palustris rpa4515 with adipate | 0.9328 | 36 | 313 |
| 2dvz-assembly1.cif.gz_A | structure of a periplasmic transporter | 0.9216 | 36 | 315 |
| 2f5x-assembly3.cif.gz_C | structure of periplasmic binding protein bugd | 0.9014 | 36 | 315 |
| 6hke-assembly1.cif.gz_A | matc (rpa3494) from rhodopseudomonas palustris with bound malate | 0.8927 | 36 | 307 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2dvzA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.9043 | 36 | 315 | 3.40.190.150 |
| 2qpqB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.903 | 36 | 315 | 3.40.190.150 |
| 2qpqB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.8878 | 36 | 315 | 3.40.190.150 |
| 2dvzA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.8845 | 36 | 315 | 3.40.190.150 |
| 4x9tA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.8837 | 36 | 309 | 3.40.190.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3G8H9M1-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9447 | 38 | 315 |
|
| AF-A0A5C8CF86-F1-model_v4 | deleted | 0.9419 | 44 | 315 |
|
| AF-A0A520EAY2-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9382 | 37 | 315 |
|
| AF-A0A537DML3-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9382 | 42 | 315 |
|
| AF-V8QW12-F1-model_v4 | ABC transporter substrate-binding protein | 0.9368 | 41 | 315 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar