F480181

General Info

Members Datasets Scaffolds Average Seq Length
773 429 728 325

Family's Representative Sequence

Representative Sequence 3300046457|Ga0495590_0021611|Ga0495590_0021611_352_1497
Length 381
Sequence MRKPLFDLQKVVYTVSDRIDKISLYKLLPKTSRKRCHGGSIAIAKHGEPEVNRHLSRLAAAWLLPVALSWAAPASAQPDTHSTYPAKPVRIIVPFAAGGVADALPRLIGQKLGEKWGKSIVVDNKPGAAGNIGMEAVARAAPDGYTLGLAPAGNLTVNPILFPKLGYETRDFVPVTMLAASPNVLVVNPAVHARSLKDLVSYAKAHPGELNFSSPGNGSGAHLAGELLNLEAGIKMVHVPYNGMAPALNDVLAGQVQMMFGGISTVLQHIRTGKLVPLAVASPRRLPQLPNVPTVAESGYPGFDVTSWYGLVAPKGTPDAIVQKWQADVATVLRQPDVKEKLDALGLEPVGNSAQAFGGTIAAETLKWRAIVHRANIPPMQ

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
3 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
4 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
5 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
6 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
7 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
8 2643221609 Acidovorax sp. Root217 Isolate Unclassified
9 2643221658 Variovorax sp. Root411 Isolate Unclassified
10 2643221672 Variovorax sp. Root434 Isolate Unclassified
11 2643221683 Variovorax sp. Root473 Isolate Unclassified
12 2738543013 Variovorax sp. BT01 Isolate Unclassified
13 2818991446 Variovorax sp. 1180 Isolate Unclassified
14 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
15 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
16 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
17 2842733646 Variovorax sp. R-72446 Isolate Unclassified
18 2842747753 Variovorax sp. R-72060 Isolate Unclassified
19 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
20 2855730933 Achromobacter sp. HZ28 Isolate Nodule
21 2855767633 Achromobacter sp. HZ34 Isolate Nodule
22 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
23 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
24 2899924645 Variovorax sp. 369 Isolate Unclassified
25 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
26 2904456579 Variovorax sp. 2002 Isolate Unclassified
27 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
28 2928051484 Variovorax sp. 1133 Isolate Unclassified
29 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
30 2928070936 Variovorax gossypii 1167 Isolate Unclassified
31 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
32 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
33 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
34 2929520902 Variovorax beijingensis 502 Isolate Unclassified
35 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
36 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
37 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
38 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
39 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
40 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
41 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
42 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
43 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
44 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
45 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
46 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
48 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
49 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
50 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
51 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
52 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
53 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
54 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
55 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
56 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
57 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
59 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
60 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
61 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
62 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
63 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
64 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
65 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
66 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
67 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
68 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
69 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
70 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
71 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
72 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
73 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
74 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
75 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
76 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
77 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
78 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
79 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
80 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
81 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
82 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
83 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
84 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
85 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
86 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
87 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
88 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
89 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
90 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
91 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
92 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
93 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
94 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
95 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
96 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
97 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
98 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
99 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
100 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
101 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
102 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
103 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
104 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
105 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
106 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
107 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
108 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
109 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
110 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
111 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
112 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
113 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
114 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
115 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
116 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
117 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
118 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
119 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
120 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
121 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
122 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
123 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
124 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
125 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
126 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
127 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
128 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
129 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
130 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
131 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
132 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
133 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
134 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
135 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
136 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
137 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
138 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
140 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
141 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
142 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
143 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
144 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
145 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
146 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
147 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
148 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
149 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
150 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
151 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
152 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
153 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
154 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
155 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
156 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
157 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
158 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
159 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
160 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
161 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
162 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
163 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
164 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
165 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
166 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
167 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
168 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
172 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
174 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
177 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
180 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
182 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
185 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
234 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
237 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
241 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
242 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
243 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
244 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
245 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
246 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
247 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
248 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
249 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
250 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
251 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
252 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
253 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
254 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
255 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
256 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
257 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
258 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
259 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
260 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
261 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
262 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
263 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
264 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
265 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
266 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
267 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
268 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
269 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
270 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
271 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
272 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
273 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
274 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
275 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
276 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
277 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
278 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
279 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
280 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
281 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
282 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
283 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
284 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
285 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
286 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
287 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
288 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
289 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
290 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
291 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
292 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
293 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
294 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
295 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
296 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
297 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
298 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
299 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
300 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
301 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
302 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
303 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
304 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
305 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
306 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
307 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
308 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
309 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
310 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
311 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
312 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
313 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
314 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
315 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
316 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
317 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
318 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
319 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
320 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
321 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
322 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
323 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
324 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
325 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
326 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
327 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
328 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
329 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
330 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
331 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
332 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
333 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
334 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
335 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
336 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
337 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
338 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
339 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
340 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
341 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
342 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
343 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
344 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
345 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
346 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
347 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
348 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
349 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
350 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
351 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
352 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
353 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
354 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
355 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
356 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
357 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
358 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
359 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
360 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
361 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
362 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
363 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
374 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
375 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
376 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
377 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
378 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
379 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
380 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
381 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
382 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
383 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
386 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
387 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
388 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
389 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
390 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
391 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
392 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
393 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
394 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
395 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
396 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
397 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
398 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
399 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
400 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
401 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
402 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
403 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
404 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
405 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
406 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
407 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
408 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
409 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
410 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
411 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
412 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
413 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
414 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
415 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
416 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
417 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
418 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
419 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
420 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
421 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
422 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
423 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
424 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
425 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
426 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
427 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
428 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
429 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.05
Metatranscriptomes 0.13
Isolates 5.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.03
Nodule 1.68
Rhizoplane 3.23
Rhizosphere 64.04
Stem 0
Stem Tuber 0
Unclassified 8.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1006739 3300002773 Bacteria 3063
2 JGI25150J39212_1004124 3300002774 Bacteria 3278
3 JGI25159J45721_1003238 3300002987 Bacteria 5838
4 JGI25151J46595_10000075 3300003187 Bacteria 135181
5 JGI25151J46595_10000360 3300003187 Bacteria 48149
6 JGI25151J46595_10000362 3300003187 Bacteria 47753
7 JGI25151J46595_10001007 3300003187 Bacteria 21295
8 JGI25151J46595_10003059 3300003187 Bacteria 9460
9 JGI25151J46595_10003214 3300003187 Bacteria 9145
10 JGI25151J46595_10003352 3300003187 Bacteria 8879
11 JGI25151J46595_10011276 3300003187 Bacteria 4116
12 JGI25151J46595_10022894 3300003187 Bacteria 2584
13 JGI25151J46595_10023197 3300003187 Bacteria 2562
14 JGI25153J46596_10002741 3300003215 Bacteria 10031
15 JGI25153J46596_10003269 3300003215 Bacteria 9110
16 JGI25160J50197_1005351 3300003354 Bacteria 5359
17 JGI25161J50226_1001166 3300003374 Bacteria 8720
18 JGI25161J50226_1003857 3300003374 Bacteria 3290
19 Ga0006562J51391_1118556 3300003578 Bacteria 3380
20 JGI25404J52841_10003784 3300003659 Bacteria 3019
21 Ga0055535_1001794 3300003761 Bacteria 9420
22 Ga0055542_1000004 3300003762 Bacteria 553532
23 Ga0055526_1000288 3300003771 Bacteria 42040
24 Ga0055526_1001419 3300003771 Bacteria 17047
25 Ga0055526_1005204 3300003771 Bacteria 7555
26 Ga0055526_1010824 3300003771 Bacteria 4194
27 Ga0055537_1004186 3300003773 Bacteria 4194
28 Ga0055524_1000236 3300003775 Bacteria 58057
29 Ga0055524_1008320 3300003775 Bacteria 4318
30 Ga0055524_1015676 3300003775 Bacteria 2752
31 Ga0055536_1000201 3300003781 Bacteria 48808
32 Ga0055536_1009558 3300003781 Bacteria 3988
33 Ga0055536_1010487 3300003781 Bacteria 3667
34 Ga0055536_1011408 3300003781 Bacteria 3413
35 Ga0055534_1000191 3300003784 Bacteria 45111
36 Ga0055534_1000233 3300003784 Bacteria 40184
37 Ga0055534_1010916 3300003784 Bacteria 1874
38 Ga0055530_10002962 3300003791 Bacteria 10231
39 Ga0055540_1002232 3300003792 Bacteria 10483
40 Ga0055540_1009260 3300003792 Bacteria 3422
41 Ga0055540_1010547 3300003792 Bacteria 3066
42 Ga0055531_10006424 3300003794 Bacteria 6677
43 Ga0055531_10015624 3300003794 Bacteria 3331
44 JGI25405J52794_10018190 3300003911 Bacteria 1401
45 Ga0055543_1001238 3300004625 Bacteria 10652
46 Ga0065165_1003020 3300005262 Bacteria 12691
47 Ga0065714_10078094 3300005288 Bacteria 2630
48 Ga0065704_10074045 3300005289 Bacteria 6577
49 Ga0065707_10084818 3300005295 Bacteria 6743
50 Ga0065707_10092445 3300005295 Bacteria 3770
51 Ga0070658_10009897 3300005327 Bacteria 7662
52 Ga0070658_10019749 3300005327 Bacteria 5396
53 Ga0070683_100021732 3300005329 Bacteria 5729
54 Ga0070683_100149766 3300005329 Bacteria 2212
55 Ga0070683_100496653 3300005329 Unclassified 1166
56 Ga0070690_100000575 3300005330 Bacteria 18554
57 Ga0070670_100010321 3300005331 Bacteria 7971
58 Ga0070670_100020391 3300005331 Bacteria 5698
59 Ga0070670_100138989 3300005331 Unclassified 2100
60 Ga0068869_100077556 3300005334 Bacteria 2472
61 Ga0068869_100137325 3300005334 Bacteria 1885
62 Ga0070666_10069130 3300005335 Bacteria 2401
63 Ga0070682_100082607 3300005337 Bacteria 2083
64 Ga0068868_100006062 3300005338 Bacteria 8536
65 Ga0068868_100024878 3300005338 Bacteria 4547
66 Ga0068868_100172332 3300005338 Unclassified 1792
67 Ga0068868_100362297 3300005338 Bacteria 1244
68 Ga0070689_100025100 3300005340 Bacteria 4476
69 Ga0070687_100080326 3300005343 Bacteria 1777
70 Ga0070661_100071842 3300005344 Bacteria 2547
71 Ga0070661_100183699 3300005344 Unclassified 1592
72 Ga0070668_100005959 3300005347 Bacteria 9039
73 Ga0070669_100072924 3300005353 Bacteria 2543
74 Ga0070675_100000914 3300005354 Bacteria 20982
75 Ga0070675_100012844 3300005354 Bacteria 6572
76 Ga0070675_100133025 3300005354 Bacteria 2121
77 Ga0070675_100257453 3300005354 Unclassified 1529
78 Ga0070671_100004642 3300005355 Bacteria 10895
79 Ga0070674_100063629 3300005356 Bacteria 2582
80 Ga0070674_100261913 3300005356 Bacteria 1363
81 Ga0070674_100335875 3300005356 Bacteria 1216
82 Ga0070673_100038019 3300005364 Bacteria 3672
83 Ga0070673_100246948 3300005364 Bacteria 1554
84 Ga0070673_100336883 3300005364 Bacteria 1336
85 Ga0070673_100441156 3300005364 Unclassified 1170
86 Ga0070688_100083362 3300005365 Bacteria 2075
87 Ga0070688_100351196 3300005365 Bacteria 1080
88 Ga0070659_100052983 3300005366 Bacteria 3193
89 Ga0070667_100015926 3300005367 Bacteria 6220
90 Ga0070705_100178274 3300005440 Bacteria 1437
91 Ga0070678_100001277 3300005456 Bacteria 13347
92 Ga0070678_100048291 3300005456 Bacteria 3064
93 Ga0070678_100180341 3300005456 Bacteria 1728
94 Ga0070678_100281895 3300005456 Unclassified 1406
95 Ga0070662_100018544 3300005457 Bacteria 4709
96 Ga0070662_100317753 3300005457 Bacteria 1269
97 Ga0070681_10021386 3300005458 Bacteria 6487
98 Ga0070681_10109756 3300005458 Bacteria 2699
99 Ga0068867_100017628 3300005459 Bacteria 5070
100 Ga0070706_100008752 3300005467 Bacteria 9428
101 Ga0070706_100115470 3300005467 Bacteria 2500
102 Ga0070707_100009514 3300005468 Bacteria 9033
103 Ga0070679_100037763 3300005530 Bacteria 4799
104 Ga0070679_100629100 3300005530 Bacteria 1016
105 Ga0070697_100038873 3300005536 Unclassified 3846
106 Ga0070697_100296300 3300005536 Bacteria 1390
107 Ga0068853_100030557 3300005539 Bacteria 4551
108 Ga0070672_100027831 3300005543 Bacteria 4220
109 Ga0070672_100031956 3300005543 Bacteria 3968
110 Ga0070672_100066885 3300005543 Bacteria 2846
111 Ga0070672_100090460 3300005543 Bacteria 2468
112 Ga0070672_100213859 3300005543 Bacteria 1615
113 Ga0070672_100236720 3300005543 Unclassified 1535
114 Ga0070686_100067257 3300005544 Bacteria 2334
115 Ga0070686_100166254 3300005544 Bacteria 1557
116 Ga0070695_100198857 3300005545 Bacteria 1431
117 Ga0070696_100001426 3300005546 Bacteria 15634
118 Ga0070693_100027532 3300005547 Bacteria 3082
119 Ga0070665_100092556 3300005548 Bacteria 3028
120 Ga0070665_100165689 3300005548 Bacteria 2212
121 Ga0070665_100211692 3300005548 Bacteria 1939
122 Ga0068855_100010517 3300005563 Bacteria 11164
123 Ga0068855_100102443 3300005563 Bacteria 3295
124 Ga0070664_100118953 3300005564 Bacteria 2311
125 Ga0068857_100197071 3300005577 Bacteria 1835
126 Ga0068854_100003877 3300005578 Bacteria 9370
127 Ga0068854_100060076 3300005578 Bacteria 2749
128 Ga0068854_100429708 3300005578 Unclassified 1099
129 Ga0068856_100050075 3300005614 Bacteria 4117
130 Ga0068852_100000171 3300005616 Bacteria 43711
131 Ga0068852_100007385 3300005616 Bacteria 8019
132 Ga0068852_100014091 3300005616 Bacteria 6138
133 Ga0068852_100069343 3300005616 Bacteria 3090
134 Ga0068852_100075529 3300005616 Unclassified 2973
135 Ga0068852_100294180 3300005616 Bacteria 1570
136 Ga0068864_100012735 3300005618 Bacteria 6953
137 Ga0068864_100386951 3300005618 Unclassified 1327
138 Ga0068866_10085982 3300005718 Bacteria 1700
139 Ga0068866_10188643 3300005718 Bacteria 1223
140 Ga0068861_100245834 3300005719 Bacteria 1524
141 Ga0068851_10004408 3300005834 Bacteria 6346
142 Ga0068851_10006790 3300005834 Bacteria 5236
143 Ga0068851_10046969 3300005834 Bacteria 2185
144 Ga0068870_10027639 3300005840 Bacteria 2840
145 Ga0068863_100025452 3300005841 Bacteria 5643
146 Ga0068863_100055454 3300005841 Unclassified 3753
147 Ga0068858_100044878 3300005842 Bacteria 4096
148 Ga0068860_100006642 3300005843 Bacteria 11617
149 Ga0068860_100017353 3300005843 Bacteria 7014
150 Ga0068862_100009331 3300005844 Bacteria 8121
151 Ga0068862_100095862 3300005844 Bacteria 2589
152 Ga0081455_10002647 3300005937 Bacteria 21202
153 Ga0081540_1000003 3300005983 Bacteria 233942
154 Ga0081540_1010836 3300005983 Bacteria 6127
155 Ga0081539_10068990 3300005985 Bacteria 1905
156 Ga0070717_10360635 3300006028 Bacteria 1301
157 Ga0075365_10072295 3300006038 Bacteria 2323
158 Ga0075368_10022773 3300006042 Bacteria 2386
159 Ga0075363_100018174 3300006048 Bacteria 3497
160 Ga0075362_10003439 3300006177 Bacteria 5533
161 Ga0075367_10113943 3300006178 Bacteria 1662
162 Ga0075367_10179125 3300006178 Bacteria 1321
163 Ga0075369_10014473 3300006186 Bacteria 3151
164 Ga0075369_10127696 3300006186 Bacteria 1154
165 Ga0075366_10010050 3300006195 Bacteria 5304
166 Ga0075366_10013463 3300006195 Bacteria 4658
167 Ga0075366_10018874 3300006195 Bacteria 3985
168 Ga0097621_100008234 3300006237 Bacteria 7498
169 Ga0097621_100011792 3300006237 Bacteria 6455
170 Ga0097621_100023333 3300006237 Bacteria 4816
171 Ga0097621_100036740 3300006237 Bacteria 3920
172 Ga0097621_100209049 3300006237 Bacteria 1697
173 Ga0075370_10002278 3300006353 Bacteria 8848
174 Ga0075370_10003866 3300006353 Bacteria 7176
175 Ga0075370_10057372 3300006353 Bacteria 2213
176 Ga0075370_10073892 3300006353 Bacteria 1953
177 Ga0075370_10181533 3300006353 Bacteria 1239
178 Ga0068871_100018406 3300006358 Bacteria 5308
179 Ga0068871_100023560 3300006358 Bacteria 4764
180 Ga0068871_100052034 3300006358 Bacteria 3316
181 Ga0075428_100022170 3300006844 Bacteria 7031
182 Ga0075433_10063312 3300006852 Bacteria 3240
183 Ga0075434_100346312 3300006871 Archaea 1507
184 Ga0099826_10000004 3300006948 Bacteria 802669
185 Ga0099826_10000031 3300006948 Bacteria 124966
186 Ga0099826_10000074 3300006948 Bacteria 52710
187 Ga0075435_100010512 3300007076 Bacteria 6770
188 Ga0075435_100159174 3300007076 Bacteria 1901
189 Ga0099794_10025206 3300007265 Bacteria 2737
190 Ga0099795_10003770 3300007788 Bacteria 3806
191 Ga0105251_10015793 3300009011 Bacteria 4109
192 Ga0105251_10105976 3300009011 Bacteria 1283
193 Ga0105244_10001011 3300009036 Bacteria 23532
194 Ga0105240_10006246 3300009093 Bacteria 17532
195 Ga0105240_10155520 3300009093 Bacteria 2720
196 Ga0111539_10002462 3300009094 Bacteria 24586
197 Ga0111539_10056832 3300009094 Bacteria 4649
198 Ga0111539_10072650 3300009094 Bacteria 4057
199 Ga0111539_10235027 3300009094 Bacteria 2134
200 Ga0105245_10225345 3300009098 Bacteria 1811
201 Ga0105243_10007533 3300009148 Bacteria 8370
202 Ga0105243_10061593 3300009148 Bacteria 3002
203 Ga0105243_10245814 3300009148 Bacteria 1595
204 Ga0105241_10375077 3300009174 Bacteria 1241
205 Ga0105242_10217568 3300009176 Bacteria 1705
206 Ga0105242_10276480 3300009176 Bacteria 1523
207 Ga0105248_10049948 3300009177 Bacteria 4690
208 Ga0105248_10258815 3300009177 Unclassified 1959
209 Ga0105248_10311044 3300009177 Bacteria 1774
210 Ga0105238_10174994 3300009551 Bacteria 2123
211 Ga0105249_10018182 3300009553 Bacteria 6248
212 Ga0099796_10000615 3300010159 Bacteria 6187
213 Ga0105239_10200687 3300010375 Bacteria 2234
214 Ga0105246_10076961 3300011119 Bacteria 2365
215 Ga0157347_1005083 3300012502 Bacteria 1247
216 Ga0157373_10054161 3300013100 Bacteria 2851
217 Ga0157371_10095083 3300013102 Bacteria 2112
218 Ga0157371_10103219 3300013102 Bacteria 2023
219 Ga0157370_10069039 3300013104 Bacteria 3339
220 Ga0157369_10225383 3300013105 Bacteria 1961
221 Ga0157374_10019302 3300013296 Bacteria 6032
222 Ga0157374_10185066 3300013296 Unclassified 2036
223 Ga0157378_10012649 3300013297 Bacteria 7385
224 Ga0157378_10088487 3300013297 Bacteria 2810
225 Ga0163162_10004924 3300013306 Bacteria 12876
226 Ga0163162_10043534 3300013306 Unclassified 4496
227 Ga0163162_10306712 3300013306 Bacteria 1720
228 Ga0163162_10527774 3300013306 Unclassified 1310
229 Ga0157372_10157194 3300013307 Bacteria 2626
230 Ga0157375_10005076 3300013308 Bacteria 11422
231 Ga0157375_10020023 3300013308 Bacteria 6103
232 Ga0157375_10058319 3300013308 Bacteria 3818
233 Ga0157375_10271601 3300013308 Bacteria 1858
234 Ga0163163_10095474 3300014325 Bacteria 2993
235 Ga0157380_10048578 3300014326 Bacteria 3342
236 Ga0157380_10086697 3300014326 Bacteria 2573
237 Ga0182008_10005597 3300014497 Bacteria 7121
238 Ga0182008_10013054 3300014497 Bacteria 4370
239 Ga0157379_10042185 3300014968 Bacteria 4073
240 Ga0157379_10139400 3300014968 Bacteria 2186
241 Ga0157376_10007773 3300014969 Bacteria 7685
242 Ga0157376_10050947 3300014969 Bacteria 3437
243 Ga0157376_10052692 3300014969 Bacteria 3384
244 Ga0157376_10105920 3300014969 Unclassified 2466
245 Ga0157376_10181673 3300014969 Bacteria 1923
246 Ga0157376_10377297 3300014969 Bacteria 1365
247 Ga0182007_10000617 3300015262 Bacteria 20740
248 Ga0182007_10003714 3300015262 Bacteria 7132
249 Ga0183362_10001 3300015683 Bacteria 2046624
250 Ga0163161_10000065 3300017792 Bacteria 108321
251 Ga0163161_10026628 3300017792 Bacteria 4096
252 Ga0163161_10030339 3300017792 Bacteria 3847
253 Ga0163161_10047330 3300017792 Bacteria 3106
254 Ga0163161_10343367 3300017792 Unclassified 1185
255 Ga0213872_10001596 3300021361 Bacteria 14405
256 Ga0209672_100961 3300025228 Bacteria 12819
257 Ga0209147_102289 3300025229 Bacteria 4993
258 Ga0209258_100022 3300025242 Bacteria 553584
259 Ga0207425_1000138 3300025245 Bacteria 65477
260 Ga0207425_1003117 3300025245 Bacteria 5463
261 Ga0209148_1000034 3300025254 Bacteria 553584
262 Ga0209129_1000023 3300025258 Bacteria 420646
263 Ga0209129_1002257 3300025258 Bacteria 9620
264 Ga0209129_1004158 3300025258 Bacteria 5845
265 Ga0209129_1007672 3300025258 Bacteria 3150
266 Ga0209565_1000053 3300025263 Bacteria 210249
267 Ga0209565_1000649 3300025263 Bacteria 22398
268 Ga0209565_1003299 3300025263 Bacteria 5292
269 Ga0209565_1014171 3300025263 Bacteria 1840
270 Ga0209673_1001445 3300025273 Bacteria 22547
271 Ga0209673_1001448 3300025273 Bacteria 22538
272 Ga0209130_1000222 3300025284 Bacteria 74607
273 Ga0209130_1001231 3300025284 Bacteria 17981
274 Ga0209130_1002576 3300025284 Bacteria 8828
275 Ga0209675_1000078 3300025291 Bacteria 156111
276 Ga0209675_1000091 3300025291 Bacteria 146390
277 Ga0209675_1001996 3300025291 Bacteria 10953
278 Ga0209675_1002241 3300025291 Bacteria 10106
279 Ga0209675_1002494 3300025291 Bacteria 9420
280 Ga0209675_1010439 3300025291 Bacteria 3169
281 Ga0209675_1011454 3300025291 Bacteria 2941
282 Ga0209676_1000005 3300025292 Bacteria 1076001
283 Ga0209676_1000121 3300025292 Bacteria 198920
284 Ga0209676_1001320 3300025292 Bacteria 25099
285 Ga0209676_1001396 3300025292 Bacteria 23358
286 Ga0209676_1008874 3300025292 Bacteria 4419
287 Ga0209676_1017867 3300025292 Bacteria 2492
288 Ga0209025_1000027 3300025294 Bacteria 505882
289 Ga0209025_1000038 3300025294 Bacteria 380508
290 Ga0209025_1000051 3300025294 Bacteria 330080
291 Ga0209025_1000085 3300025294 Bacteria 263782
292 Ga0209025_1000096 3300025294 Bacteria 239153
293 Ga0209025_1000157 3300025294 Bacteria 168790
294 Ga0209025_1000476 3300025294 Bacteria 77754
295 Ga0209025_1001087 3300025294 Bacteria 39361
296 Ga0209025_1001694 3300025294 Bacteria 26906
297 Ga0209025_1016183 3300025294 Bacteria 4426
298 Ga0209025_1023843 3300025294 Bacteria 3181
299 Ga0209025_1023882 3300025294 Bacteria 3178
300 Ga0209564_1000133 3300025295 Bacteria 189140
301 Ga0209564_1000170 3300025295 Bacteria 156293
302 Ga0209564_1000400 3300025295 Bacteria 77039
303 Ga0209564_1001022 3300025295 Bacteria 34533
304 Ga0209564_1001357 3300025295 Bacteria 25809
305 Ga0209758_1000064 3300025297 Bacteria 311812
306 Ga0209758_1000556 3300025297 Bacteria 59164
307 Ga0209758_1020079 3300025297 Bacteria 3181
308 Ga0209758_1020110 3300025297 Bacteria 3178
309 Ga0209758_1035488 3300025297 Bacteria 1965
310 Ga0209050_1000007 3300025298 Bacteria 1187891
311 Ga0209050_1002090 3300025298 Bacteria 18300
312 Ga0209256_1000038 3300025299 Bacteria 375225
313 Ga0209256_1000115 3300025299 Bacteria 173607
314 Ga0209256_1000400 3300025299 Bacteria 68737
315 Ga0209256_1005552 3300025299 Bacteria 7201
316 Ga0207426_1000001 3300025302 Bacteria 1341301
317 Ga0207426_1000090 3300025302 Bacteria 280662
318 Ga0209051_1000009 3300025303 Bacteria 706778
319 Ga0209051_1000092 3300025303 Bacteria 170056
320 Ga0209051_1000490 3300025303 Bacteria 51070
321 Ga0209051_1000944 3300025303 Bacteria 28691
322 Ga0209051_1004615 3300025303 Bacteria 8392
323 Ga0209051_1008125 3300025303 Bacteria 5608
324 Ga0209051_1012472 3300025303 Bacteria 4108
325 Ga0209257_1000011 3300025304 Bacteria 1112630
326 Ga0209257_1000508 3300025304 Bacteria 68156
327 Ga0209257_1014189 3300025304 Bacteria 3449
328 Ga0207697_10102400 3300025315 Unclassified 1221
329 Ga0207656_10001376 3300025321 Bacteria 8019
330 Ga0207656_10002176 3300025321 Bacteria 6555
331 Ga0207656_10025627 3300025321 Bacteria 2396
332 Ga0207655_1018003 3300025728 Bacteria 3777
333 Ga0207713_1027016 3300025735 Bacteria 2615
334 Ga0207713_1083263 3300025735 Bacteria 1144
335 Ga0207688_10018087 3300025901 Bacteria 3836
336 Ga0207643_10101752 3300025908 Bacteria 1685
337 Ga0207705_10011222 3300025909 Bacteria 6493
338 Ga0207705_10128615 3300025909 Bacteria 1884
339 Ga0207684_10070260 3300025910 Unclassified 2976
340 Ga0207684_10349691 3300025910 Bacteria 1272
341 Ga0207695_10088739 3300025913 Bacteria 3111
342 Ga0207671_10102403 3300025914 Bacteria 2170
343 Ga0207662_10048840 3300025918 Bacteria 2508
344 Ga0207662_10207325 3300025918 Bacteria 1271
345 Ga0207657_10059989 3300025919 Bacteria 3266
346 Ga0207649_10060535 3300025920 Bacteria 2380
347 Ga0207652_10097886 3300025921 Bacteria 2586
348 Ga0207681_10004690 3300025923 Bacteria 8412
349 Ga0207681_10104523 3300025923 Bacteria 2049
350 Ga0207694_10157198 3300025924 Bacteria 1835
351 Ga0207650_10001095 3300025925 Bacteria 20014
352 Ga0207650_10138185 3300025925 Bacteria 1913
353 Ga0207650_10259037 3300025925 Unclassified 1410
354 Ga0207659_10000875 3300025926 Bacteria 17884
355 Ga0207644_10000147 3300025931 Bacteria 50433
356 Ga0207644_10047172 3300025931 Bacteria 3072
357 Ga0207690_10031808 3300025932 Bacteria 3380
358 Ga0207706_10010532 3300025933 Bacteria 8448
359 Ga0207686_10138439 3300025934 Bacteria 1679
360 Ga0207709_10000785 3300025935 Bacteria 24867
361 Ga0207709_10001556 3300025935 Bacteria 15728
362 Ga0207670_10005808 3300025936 Bacteria 6812
363 Ga0207670_10206722 3300025936 Bacteria 1494
364 Ga0207669_10267641 3300025937 Bacteria 1282
365 Ga0207704_10103158 3300025938 Bacteria 1907
366 Ga0207691_10000123 3300025940 Bacteria 70472
367 Ga0207691_10007342 3300025940 Bacteria 10630
368 Ga0207691_10008538 3300025940 Bacteria 9838
369 Ga0207691_10020665 3300025940 Bacteria 6225
370 Ga0207691_10085090 3300025940 Bacteria 2838
371 Ga0207691_10248234 3300025940 Bacteria 1537
372 Ga0207711_10046360 3300025941 Bacteria 3714
373 Ga0207711_10109994 3300025941 Bacteria 2449
374 Ga0207689_10100992 3300025942 Unclassified 2369
375 Ga0207689_10118136 3300025942 Bacteria 2181
376 Ga0207689_10157411 3300025942 Bacteria 1873
377 Ga0207661_10068925 3300025944 Bacteria 2882
378 Ga0207661_10081039 3300025944 Unclassified 2680
379 Ga0207679_10026007 3300025945 Bacteria 4032
380 Ga0207679_10269642 3300025945 Unclassified 1455
381 Ga0207712_10009743 3300025961 Bacteria 6088
382 Ga0207668_10007850 3300025972 Bacteria 6346
383 Ga0207640_10024546 3300025981 Unclassified 3639
384 Ga0207640_10302892 3300025981 Bacteria 1265
385 Ga0207640_10421569 3300025981 Unclassified 1092
386 Ga0207677_10002235 3300026023 Bacteria 10167
387 Ga0207703_10077554 3300026035 Bacteria 2759
388 Ga0207703_10309919 3300026035 Bacteria 1442
389 Ga0207703_10402975 3300026035 Bacteria 1270
390 Ga0207639_10004693 3300026041 Bacteria 9197
391 Ga0207702_10475372 3300026078 Bacteria 1216
392 Ga0207641_10067354 3300026088 Bacteria 3067
393 Ga0207641_10101764 3300026088 Bacteria 2532
394 Ga0207648_10000853 3300026089 Bacteria 34345
395 Ga0207648_10124451 3300026089 Bacteria 2268
396 Ga0207648_10187049 3300026089 Bacteria 1834
397 Ga0207676_10009521 3300026095 Bacteria 6915
398 Ga0207676_10158841 3300026095 Bacteria 1956
399 Ga0207674_10162470 3300026116 Bacteria 2188
400 Ga0207675_100000415 3300026118 Bacteria 41041
401 Ga0207675_100369363 3300026118 Bacteria 1409
402 Ga0207683_10000317 3300026121 Bacteria 43905
403 Ga0207683_10082033 3300026121 Bacteria 2863
404 Ga0207683_10115737 3300026121 Bacteria 2403
405 Ga0207683_10213359 3300026121 Unclassified 1757
406 Ga0207698_10001729 3300026142 Bacteria 12735
407 Ga0207698_10009508 3300026142 Bacteria 6202
408 Ga0207698_10032159 3300026142 Bacteria 3797
409 Ga0209179_1001332 3300027512 Bacteria 2989
410 Ga0209179_1001419 3300027512 Bacteria 2925
411 Ga0209282_1000011 3300027666 Bacteria 217665
412 Ga0209282_1000078 3300027666 Bacteria 76811
413 Ga0209282_1000113 3300027666 Bacteria 52714
414 Ga0209588_1029369 3300027671 Bacteria 1754
415 Ga0209971_1005391 3300027682 Bacteria 3038
416 Ga0207428_10014340 3300027907 Bacteria 6893
417 Ga0268266_10158651 3300028379 Bacteria 2045
418 Ga0268266_10192689 3300028379 Bacteria 1862
419 Ga0268266_10302226 3300028379 Bacteria 1493
420 Ga0268266_10325305 3300028379 Bacteria 1440
421 Ga0268265_10549953 3300028380 Bacteria 1096
422 Ga0268264_10007630 3300028381 Bacteria 9017
423 Ga0268264_10015304 3300028381 Bacteria 6291
424 Ga0265318_10012091 3300028577 Bacteria 3686
425 Ga0307515_10000028 3300028794 Bacteria 368467
426 Ga0307515_10201912 3300028794 Bacteria 1861
427 Ga0307511_10000976 3300030521 Bacteria 30361
428 Ga0265330_10032538 3300031235 Bacteria 2336
429 Ga0265332_10003766 3300031238 Bacteria 7248
430 Ga0265329_10012356 3300031242 Bacteria 3070
431 Ga0265331_10039398 3300031250 Bacteria 2304
432 Ga0265327_10000465 3300031251 Bacteria 72062
433 Ga0265327_10022499 3300031251 Bacteria 3766
434 Ga0265316_10040384 3300031344 Bacteria 3740
435 Ga0307408_100013471 3300031548 Bacteria 5428
436 Ga0307408_100044752 3300031548 Bacteria 3156
437 Ga0307514_10001952 3300031649 Bacteria 22533
438 Ga0265314_10011575 3300031711 Bacteria 7268
439 Ga0265342_10005301 3300031712 Bacteria 9883
440 Ga0307410_10220145 3300031852 Bacteria 1460
441 Ga0307406_10000194 3300031901 Bacteria 36252
442 Ga0307412_10005778 3300031911 Bacteria 6957
443 Ga0307412_10015702 3300031911 Bacteria 4495
444 Ga0307412_10115904 3300031911 Bacteria 1921
445 Ga0307412_10144364 3300031911 Bacteria 1747
446 Ga0307412_10219676 3300031911 Bacteria 1456
447 Ga0307409_100139767 3300031995 Bacteria 2085
448 Ga0307416_100309661 3300032002 Bacteria 1575
449 Ga0307416_100796514 3300032002 Bacteria 1040
450 Ga0307414_10078323 3300032004 Bacteria 2409
451 Ga0307411_10044619 3300032005 Bacteria 2846
452 Ga0307411_10150192 3300032005 Bacteria 1730
453 Ga0307507_10029624 3300033179 Bacteria 5799
454 Ga0307507_10096976 3300033179 Bacteria 2490
455 Ga0373948_0015631 3300034817 Bacteria 1395
456 Ga0373940_0014482 3300035088 Bacteria 1924
457 Ga0373923_0052214 3300035111 Bacteria 1717
458 Ga0373932_0004013 3300035112 Bacteria 3505
459 Ga0373953_0032856 3300035117 Bacteria 2027
460 Ga0373954_0050054 3300035118 Bacteria 1960
461 Ga0373960_0045939 3300035121 Bacteria 1280
462 Ga0373943_0005457 3300035170 Bacteria 5722
463 Ga0373946_0040510 3300035171 Bacteria 1906
464 Ga0373955_0031741 3300035172 Bacteria 2768
465 Ga0373962_0015036 3300035242 Bacteria 1979
466 Ga0373924_0005756 3300035410 Bacteria 4405
467 Ga0373931_0002752 3300035691 Bacteria 7827
468 Ga0373931_0047510 3300035691 Bacteria 2272
469 Ga0373935_0054057 3300035692 Bacteria 2555
470 Ga0373933_0006656 3300035724 Bacteria 6294
471 Ga0373947_0022660 3300035725 Bacteria 3644
472 Ga0373947_0073539 3300035725 Bacteria 2101
473 Ga0373937_0002785 3300036401 Bacteria 14599
474 Ga0373925_0224588 3300037068 Bacteria 1500
475 Ga0395899_0001705 3300037312 Bacteria 18309
476 Ga0395899_0003707 3300037312 Bacteria 12084
477 Ga0395900_0001713 3300037418 Bacteria 25348
478 Ga0395900_0005201 3300037418 Bacteria 13656
479 Ga0395900_0029035 3300037418 Bacteria 5672
480 Ga0395898_0006230 3300037466 Bacteria 12778
481 Ga0395898_0011212 3300037466 Bacteria 9329
482 Ga0395898_0191534 3300037466 Bacteria 1954
483 Ga0395905_0060121 3300037471 Bacteria 3553
484 Ga0395905_0393399 3300037471 Bacteria 1280
485 Ga0395901_0004147 3300038443 Bacteria 14621
486 Ga0395901_0010742 3300038443 Bacteria 9284
487 Ga0395901_0022578 3300038443 Bacteria 6449
488 Ga0395901_0087117 3300038443 Bacteria 3265
489 Ga0436361_1065084 3300039447 Bacteria 19022
490 Ga0439436_0003275 3300041404 Bacteria 4911
491 Ga0439438_011801 3300041405 Bacteria 2704
492 Ga0451798_0667220 3300041458 Bacteria 1210
493 Ga0451807_1303413 3300041486 Bacteria 1557
494 Ga0439432_004127 3300042006 Bacteria 5308
495 Ga0439449_0000184 3300042007 Bacteria 21742
496 Ga0439449_0007495 3300042007 Bacteria 4146
497 Ga0439455_0019893 3300042012 Bacteria 1587
498 Ga0450907_019469 3300042146 Bacteria 1137
499 Ga0450908_003708 3300042184 Bacteria 2963
500 Ga0450909_001072 3300042185 Bacteria 3767
501 Ga0439434_0001880 3300042435 Bacteria 6104
502 Ga0450893_0003656 3300042532 Bacteria 2430
503 Ga0451577_0548946 3300042876 Bacteria 1049
504 Ga0466963_0031491 3300044694 Bacteria 3429
505 Ga0453684_0492139 3300044712 Bacteria 1359
506 Ga0466960_0077707 3300044901 Bacteria 1665
507 Ga0451576_0006369 3300045051 Bacteria 14494
508 Ga0451576_0028907 3300045051 Bacteria 5937
509 Ga0451576_0250681 3300045051 Bacteria 1850
510 Ga0451576_0314990 3300045051 Bacteria 1637
511 Ga0451576_0614576 3300045051 Bacteria 1142
512 Ga0466967_0034573 3300045976 Bacteria 4292
513 Ga0495592_0042728 3300046454 Bacteria 3394
514 Ga0495590_0021611 3300046457 Bacteria 2280
515 Ga0495638_0038991 3300046460 Bacteria 3018
516 Ga0495638_0067291 3300046460 Bacteria 2200
517 Ga0495605_0001934 3300046474 Bacteria 13169
518 Ga0495605_0003185 3300046474 Bacteria 9850
519 Ga0495605_0011006 3300046474 Bacteria 5053
520 Ga0495639_0002606 3300046475 Bacteria 7848
521 Ga0495664_0065888 3300046477 Bacteria 2160
522 Ga0495584_0016039 3300046491 Bacteria 3823
523 Ga0495584_0049005 3300046491 Bacteria 2129
524 Ga0495596_0000121 3300046500 Bacteria 53954
525 Ga0495596_0000568 3300046500 Bacteria 23065
526 Ga0495596_0000624 3300046500 Bacteria 22231
527 Ga0495607_0005823 3300046501 Bacteria 8766
528 Ga0495607_0021307 3300046501 Bacteria 4080
529 Ga0495610_0000387 3300046512 Bacteria 45513
530 Ga0495610_0001269 3300046512 Bacteria 22626
531 Ga0495610_0003249 3300046512 Bacteria 12843
532 Ga0495616_0004854 3300046513 Bacteria 8415
533 Ga0495616_0004925 3300046513 Bacteria 8343
534 Ga0495616_0005358 3300046513 Bacteria 7913
535 Ga0495616_0022482 3300046513 Bacteria 3406
536 Ga0495620_0009726 3300046515 Bacteria 5103
537 Ga0495663_0012540 3300046525 Bacteria 2361
538 Ga0495642_0033512 3300046528 Bacteria 2065
539 Ga0495652_0115235 3300046529 Bacteria 2154
540 Ga0495654_0031657 3300046530 Bacteria 2685
541 Ga0495587_0011304 3300046536 Bacteria 5658
542 Ga0495609_0001256 3300046538 Bacteria 17410
543 Ga0495609_0001279 3300046538 Bacteria 17171
544 Ga0495609_0002814 3300046538 Bacteria 10454
545 Ga0495621_0008890 3300046539 Bacteria 3028
546 Ga0495621_0035327 3300046539 Bacteria 1731
547 Ga0495597_0000116 3300046542 Bacteria 72210
548 Ga0495645_0002809 3300046543 Bacteria 11813
549 Ga0495645_0104857 3300046543 Bacteria 2007
550 Ga0495622_0085934 3300046557 Bacteria 1447
551 Ga0495667_0038499 3300046559 Bacteria 3184
552 Ga0495656_0000109 3300046615 Bacteria 32861
553 Ga0495668_0036686 3300046616 Bacteria 2746
554 Ga0495661_0003687 3300046665 Bacteria 11251
555 Ga0495588_0086032 3300046674 Bacteria 1644
556 Ga0495599_0036314 3300046678 Bacteria 3094
557 Ga0495658_0056819 3300046683 Bacteria 2233
558 Ga0495669_0032233 3300046684 Bacteria 2303
559 Ga0495669_0039820 3300046684 Bacteria 2082
560 Ga0495670_0022371 3300046691 Bacteria 3122
561 Ga0495670_0051539 3300046691 Bacteria 2060
562 Ga0495671_0000494 3300046692 Bacteria 30400
563 Ga0495671_0003887 3300046692 Bacteria 9075
564 Ga0495671_0004931 3300046692 Bacteria 7877
565 Ga0495649_0025646 3300046694 Bacteria 3283
566 Ga0495649_0026589 3300046694 Bacteria 3217
567 Ga0495600_0017664 3300046809 Bacteria 4539
568 Ga0495600_0051794 3300046809 Bacteria 2680
569 Ga0495600_0169662 3300046809 Bacteria 1409
570 Ga0495604_0203311 3300047317 Bacteria 1373
571 Ga0495636_0009262 3300047318 Bacteria 3877
572 Ga0495636_0039683 3300047318 Bacteria 1951
573 Ga0495672_0017538 3300047320 Bacteria 4787
574 Ga0495672_0062151 3300047320 Bacteria 2149
575 Ga0495676_0110862 3300047321 Bacteria 2013
576 Ga0495686_0116498 3300047472 Bacteria 1597
577 Ga0495614_0031760 3300048089 Bacteria 2273
578 Ga0495615_0002030 3300048090 Bacteria 3155
579 Ga0496100_0014235 3300048903 Bacteria 4613
580 Ga0496101_0004822 3300048904 Bacteria 8557
581 Ga0496101_0106158 3300048904 Bacteria 2109
582 Ga0496104_0193296 3300048907 Bacteria 1947
583 Ga0496105_0001248 3300048908 Bacteria 17765
584 Ga0496105_0127141 3300048908 Bacteria 2101
585 Ga0496107_0204234 3300048910 Bacteria 1469
586 Ga0496108_0085734 3300048911 Bacteria 2674
587 Ga0496108_0199476 3300048911 Bacteria 1736
588 Ga0496108_0199692 3300048911 Bacteria 1735
589 Ga0496109_0006848 3300048912 Bacteria 9615
590 Ga0496109_0060743 3300048912 Bacteria 3454
591 Ga0496109_0355070 3300048912 Bacteria 1385
592 Ga0496110_0019955 3300048913 Bacteria 5650
593 Ga0496110_0078584 3300048913 Bacteria 2937
594 Ga0496110_0106462 3300048913 Bacteria 2516
595 Ga0496111_0015901 3300048914 Bacteria 5175
596 Ga0496111_0179651 3300048914 Unclassified 1573
597 Ga0496111_0192173 3300048914 Bacteria 1518
598 Ga0496114_0043438 3300048917 Bacteria 3727
599 Ga0496116_0004217 3300048919 Bacteria 13819
600 Ga0496116_0008659 3300048919 Bacteria 8800
601 Ga0496116_0011913 3300048919 Bacteria 7148
602 Ga0496116_0014246 3300048919 Bacteria 6360
603 Ga0496116_0028519 3300048919 Bacteria 4041
604 Ga0496116_0030472 3300048919 Bacteria 3874
605 Ga0496117_0035438 3300048920 Bacteria 3745
606 Ga0496117_0037362 3300048920 Bacteria 3619
607 Ga0496118_0041873 3300048921 Bacteria 3620
608 Ga0496118_0056153 3300048921 Bacteria 2963
609 Ga0496121_0001338 3300048924 Bacteria 42197
610 Ga0496121_0007784 3300048924 Bacteria 12833
611 Ga0496121_0046495 3300048924 Bacteria 3714
612 Ga0496121_0051016 3300048924 Bacteria 3488
613 Ga0496121_0052904 3300048924 Bacteria 3405
614 Ga0496121_0118983 3300048924 Bacteria 1998
615 Ga0496122_0000383 3300048925 Bacteria 94797
616 Ga0496122_0000930 3300048925 Bacteria 53414
617 Ga0496122_0001583 3300048925 Bacteria 35761
618 Ga0496122_0009575 3300048925 Bacteria 10165
619 Ga0496122_0019704 3300048925 Bacteria 6147
620 Ga0496122_0101846 3300048925 Bacteria 1916
621 Ga0496123_0000249 3300048926 Bacteria 108969
622 Ga0496123_0000369 3300048926 Bacteria 84409
623 Ga0496123_0000967 3300048926 Bacteria 44394
624 Ga0496123_0001943 3300048926 Bacteria 26909
625 Ga0496123_0002298 3300048926 Bacteria 23994
626 Ga0496124_0024187 3300048927 Bacteria 5529
627 Ga0496124_0053851 3300048927 Bacteria 3408
628 Ga0496125_0001761 3300048928 Bacteria 30044
629 Ga0496125_0023627 3300048928 Bacteria 5669
630 Ga0496125_0056558 3300048928 Bacteria 3185
631 Ga0496126_0025267 3300048929 Bacteria 5718
632 Ga0496126_0069817 3300048929 Bacteria 3132
633 Ga0501033_0005170 3300049570 Bacteria 10374
634 Ga0501033_0058449 3300049570 Bacteria 2848
635 Ga0501034_0041075 3300049571 Bacteria 4680
636 Ga0501034_0161318 3300049571 Bacteria 2213
637 Ga0501034_0631930 3300049571 Bacteria 974
638 Ga0501037_0039939 3300049573 Bacteria 3454
639 Ga0501038_0147400 3300049574 Bacteria 1921
640 Ga0501039_0190641 3300049575 Bacteria 1612
641 Ga0501040_0050091 3300049576 Bacteria 2856
642 Ga0501041_0002800 3300049577 Bacteria 9963
643 Ga0501041_0028277 3300049577 Bacteria 3382
644 Ga0501042_0029825 3300049578 Bacteria 3848
645 Ga0501047_0026159 3300049581 Bacteria 5613
646 Ga0501048_0010243 3300049582 Bacteria 7009
647 Ga0501071_0117450 3300049587 Bacteria 1970
648 Ga0501072_0012735 3300049588 Bacteria 6431
649 Ga0501072_0141064 3300049588 Bacteria 1921
650 Ga0501074_0029127 3300049590 Bacteria 4000
651 Ga0501075_0002431 3300049591 Bacteria 12396
652 Ga0501075_0020736 3300049591 Bacteria 4783
653 Ga0501075_0043541 3300049591 Bacteria 3367
654 Ga0501076_0009377 3300049592 Bacteria 7227
655 Ga0501076_0012563 3300049592 Bacteria 6334
656 Ga0501076_0134672 3300049592 Bacteria 2005
657 Ga0501077_0147788 3300049593 Bacteria 1491
658 Ga0501079_0017990 3300049741 Bacteria 5396
659 Ga0501080_0014848 3300049742 Bacteria 7172
660 Ga0501081_0029233 3300049743 Bacteria 3724
661 Ga0501081_0116000 3300049743 Bacteria 1904
662 Ga0501083_0179249 3300049744 Bacteria 1384
663 Ga0501035_0013969 3300049822 Bacteria 7408
664 Ga0501044_0002878 3300049823 Bacteria 19586
665 Ga0501045_0003422 3300049824 Bacteria 10853
666 Ga0501045_0388915 3300049824 Bacteria 1038
667 nmdc:mga03683_13376_c1 3300050489 Bacteria 3019
668 nmdc:mga03n38_4600_c1 3300050490 Bacteria 4593
669 nmdc:mga0yw44_20945_c1 3300050492 Bacteria 3639
670 nmdc:mga0yw44_37002_c1 3300050492 Bacteria 2879
671 nmdc:mga0k408_19531_c1 3300050493 Bacteria 3788
672 nmdc:mga0k408_28320_c1 3300050493 Bacteria 3185
673 nmdc:mga06z11_55443_c1 3300050494 Bacteria 2046
674 nmdc:mga07m45_103017_c1 3300050496 Bacteria 1640
675 nmdc:mga07m45_14964_c1 3300050496 Bacteria 4141
676 nmdc:mga07m45_169966_c1 3300050496 Bacteria 1267
677 nmdc:mga07m45_17022_c1 3300050496 Bacteria 3898
678 nmdc:mga07m45_6982_c1 3300050496 Bacteria 5743
679 nmdc:mga0qj67_3607_c1 3300050509 Bacteria 11173
680 nmdc:mga08y16_10093_c1 3300050511 Bacteria 9914
681 nmdc:mga08y16_210911_c1 3300050511 Bacteria 2011
682 nmdc:mga0n895_96007_c1 3300050512 Unclassified 2969
683 nmdc:mga0rr50_327348_c1 3300050513 Bacteria 1286
684 nmdc:mga08x19_18905_c1 3300050514 Bacteria 4224
685 nmdc:mga0a205_31700_c1 3300050515 Bacteria 5066
686 Ga0495601_0006318 3300053077 Bacteria 6926
687 Ga0500610_0001394 3300053079 Bacteria 8204
688 Ga0500610_0005581 3300053079 Bacteria 5175
689 Ga0495619_0069933 3300053085 Bacteria 2347
690 Ga0500578_0025224 3300053086 Bacteria 3814
691 Ga0500646_0002708 3300053090 Bacteria 4576
692 Ga0500646_0008750 3300053090 Bacteria 2594
693 Ga0500651_0000038 3300053093 Bacteria 101707
694 Ga0500650_0035802 3300053098 Bacteria 2276
695 Ga0500571_000054 3300053110 Bacteria 35459
696 Ga0500593_000385 3300053117 Bacteria 17539
697 Ga0500607_013519 3300053121 Bacteria 4764
698 Ga0500608_003408 3300053122 Bacteria 5954
699 Ga0500626_019208 3300053128 Bacteria 3030
700 Ga0500655_000123 3300053133 Bacteria 19862
701 Ga0500658_0000237 3300053134 Bacteria 25766
702 Ga0500658_0000266 3300053134 Bacteria 23921
703 Ga0500559_0001462 3300053136 Bacteria 13377
704 Ga0500559_0008198 3300053136 Bacteria 4594
705 Ga0500559_0050126 3300053136 Bacteria 1841
706 Ga0500564_024230 3300053138 Bacteria 2785
707 Ga0500568_0005096 3300053139 Bacteria 6870
708 Ga0500573_0069348 3300053140 Bacteria 2012
709 Ga0500574_007801 3300053141 Bacteria 2242
710 Ga0500590_045762 3300053148 Bacteria 2239
711 Ga0500590_056422 3300053148 Bacteria 1984
712 Ga0500604_0001071 3300053151 Bacteria 7638
713 Ga0500616_0030328 3300053153 Bacteria 2970
714 Ga0500616_0073468 3300053153 Bacteria 1736
715 Ga0500619_000081 3300053154 Bacteria 26977
716 Ga0500619_000088 3300053154 Bacteria 25738
717 Ga0500627_0004346 3300053158 Bacteria 4536
718 Ga0500634_0015722 3300053161 Bacteria 4025
719 Ga0500634_0048318 3300053161 Bacteria 2296
720 Ga0500636_0136336 3300053177 Bacteria 1363
721 Ga0500645_005317 3300053730 Bacteria 4766
722 Ga0590075_012593 3300059424 Bacteria 2056
723 Ga0501082_0015431 3300060353 Bacteria 6574
724 Ga0501082_0074944 3300060353 Bacteria 2915
725 Ga0501082_0201645 3300060353 Bacteria 1731
726 Ga0530510_0002501 3300061734 Bacteria 12630
727 Ga0530510_0004066 3300061734 Bacteria 10096
728 Ga0530510_0011205 3300061734 Bacteria 6291

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0614576 Ga0451576_0614576_338_1120 248
2 3300045051 Ga0451576_0250681 Ga0451576_0250681_1029_1835 253
3 3300005340 Ga0070689_100025100 Ga0070689_1000251005 274
4 3300005356 Ga0070674_100335875 Ga0070674_1003358751 274
5 3300005364 Ga0070673_100038019 Ga0070673_1000380193 274
6 3300005365 Ga0070688_100083362 Ga0070688_1000833623 274
7 3300005543 Ga0070672_100213859 Ga0070672_1002138592 274
8 3300025901 Ga0207688_10018087 Ga0207688_100180873 274
9 3300025936 Ga0207670_10005808 Ga0207670_100058082 274
10 3300025937 Ga0207669_10267641 Ga0207669_102676412 274
11 3300025940 Ga0207691_10020665 Ga0207691_100206654 274
12 3300014969 Ga0157376_10105920 Ga0157376_101059203 275
13 3300026116 Ga0207674_10162470 Ga0207674_101624702 275
14 3300003215 JGI25153J46596_10002741 JGI25153J46596_100027417 277
15 3300003215 JGI25153J46596_10003269 JGI25153J46596_100032699 277
16 3300025297 Ga0209758_1000556 Ga0209758_100055636 277
17 3300046684 Ga0495669_0032233 Ga0495669_0032233_26_925 277
18 3300049743 Ga0501081_0029233 Ga0501081_0029233_1129_2004 277
19 3300048912 Ga0496109_0355070 Ga0496109_0355070_478_1359 279
20 3300049571 Ga0501034_0631930 Ga0501034_0631930_61_942 279
21 3300009174 Ga0105241_10375077 Ga0105241_103750772 280
22 3300014969 Ga0157376_10052692 Ga0157376_100526924 281
23 3300003775 Ga0055524_1000236 Ga0055524_100023632 283
24 3300003187 JGI25151J46595_10000360 JGI25151J46595_1000036039 284
25 3300003187 JGI25151J46595_10000362 JGI25151J46595_1000036210 284
26 3300003771 Ga0055526_1005204 Ga0055526_10052045 284
27 3300003784 Ga0055534_1000233 Ga0055534_100023329 284
28 3300025263 Ga0209565_1000053 Ga0209565_100005342 284
29 3300025291 Ga0209675_1000091 Ga0209675_100009142 284
30 3300025294 Ga0209025_1000085 Ga0209025_1000085148 284
31 3300025295 Ga0209564_1001022 Ga0209564_100102221 284
32 3300025297 Ga0209758_1035488 Ga0209758_10354883 284
33 3300025299 Ga0209256_1005552 Ga0209256_10055523 284
34 3300046542 Ga0495597_0000116 Ga0495597_0000116_36282_37202 284
35 3300048925 Ga0496122_0001583 Ga0496122_0001583_33896_34864 285
36 3300048926 Ga0496123_0001943 Ga0496123_0001943_25022_25990 285
37 3300046474 Ga0495605_0011006 Ga0495605_0011006_435_1421 286
38 3300046500 Ga0495596_0000568 Ga0495596_0000568_9109_10095 286
39 3300046501 Ga0495607_0021307 Ga0495607_0021307_2219_3205 286
40 3300046513 Ga0495616_0004925 Ga0495616_0004925_1559_2545 286
41 3300046694 Ga0495649_0025646 Ga0495649_0025646_1611_2597 286
42 3300047320 Ga0495672_0062151 Ga0495672_0062151_663_1649 286
43 3300048907 Ga0496104_0193296 Ga0496104_0193296_219_1235 286
44 3300048925 Ga0496122_0009575 Ga0496122_0009575_5942_6928 286
45 3300048926 Ga0496123_0002298 Ga0496123_0002298_16745_17731 286
46 3300048927 Ga0496124_0024187 Ga0496124_0024187_3128_4096 286
47 3300025926 Ga0207659_10000875 Ga0207659_100008754 287
48 3300025936 Ga0207670_10206722 Ga0207670_102067222 287
49 3300003187 JGI25151J46595_10003214 JGI25151J46595_100032145 288
50 3300006237 Ga0097621_100209049 Ga0097621_1002090492 288
51 3300025294 Ga0209025_1000038 Ga0209025_1000038297 288
52 3300042876 Ga0451577_0548946 Ga0451577_0548946_107_1033 288
53 3300053090 Ga0500646_0008750 Ga0500646_0008750_602_1570 288
54 3300005337 Ga0070682_100082607 Ga0070682_1000826072 289
55 3300005456 Ga0070678_100048291 Ga0070678_1000482912 289
56 3300026121 Ga0207683_10115737 Ga0207683_101157372 289
57 3300006028 Ga0070717_10360635 Ga0070717_103606352 291
58 3300009148 Ga0105243_10245814 Ga0105243_102458141 291
59 3300050494 nmdc:mga06z11_55443_c1 nmdc:mga06z11_55443_c1_792_1715 291
60 3300005545 Ga0070695_100198857 Ga0070695_1001988572 292
61 3300006852 Ga0075433_10063312 Ga0075433_100633124 293
62 3300031911 Ga0307412_10115904 Ga0307412_101159042 293
63 3300046460 Ga0495638_0067291 Ga0495638_0067291_628_1596 293
64 3300046491 Ga0495584_0016039 Ga0495584_0016039_1161_2126 293
65 3300046525 Ga0495663_0012540 Ga0495663_0012540_847_1770 293
66 3300046539 Ga0495621_0008890 Ga0495621_0008890_383_1306 293
67 3300046615 Ga0495656_0000109 Ga0495656_0000109_31215_32138 293
68 3300048090 Ga0495615_0002030 Ga0495615_0002030_2185_3108 293
69 3300049824 Ga0501045_0388915 Ga0501045_0388915_87_1016 293
70 3300005467 Ga0070706_100008752 Ga0070706_1000087528 294
71 3300005468 Ga0070707_100009514 Ga0070707_1000095145 294
72 3300025910 Ga0207684_10070260 Ga0207684_100702602 294
73 3300050512 nmdc:mga0n895_96007_c1 nmdc:mga0n895_96007_c1_1023_1955 294
74 3300053154 Ga0500619_000088 Ga0500619_000088_12358_13332 294
75 3300003784 Ga0055534_1010916 Ga0055534_10109162 295
76 3300025284 Ga0209130_1002576 Ga0209130_10025762 295
77 3300025291 Ga0209675_1010439 Ga0209675_10104392 295
78 3300025292 Ga0209676_1017867 Ga0209676_10178672 295
79 3300025303 Ga0209051_1012472 Ga0209051_10124723 295
80 3300035170 Ga0373943_0005457 Ga0373943_0005457_2901_3848 295
81 3300035171 Ga0373946_0040510 Ga0373946_0040510_695_1642 295
82 3300035692 Ga0373935_0054057 Ga0373935_0054057_1397_2344 295
83 3300035725 Ga0373947_0022660 Ga0373947_0022660_1278_2225 295
84 3300039447 Ga0436361_1065084 Ga0436361_1065084_7684_8631 295
85 3300005616 Ga0068852_100000171 Ga0068852_10000017126 296
86 3300005834 Ga0068851_10004408 Ga0068851_100044082 296
87 3300006237 Ga0097621_100036740 Ga0097621_1000367404 296
88 3300006358 Ga0068871_100052034 Ga0068871_1000520342 296
89 3300007076 Ga0075435_100010512 Ga0075435_1000105122 296
90 3300009177 Ga0105248_10049948 Ga0105248_100499483 296
91 3300025321 Ga0207656_10001376 Ga0207656_100013762 296
92 3300025913 Ga0207695_10088739 Ga0207695_100887392 296
93 3300025941 Ga0207711_10109994 Ga0207711_101099942 296
94 3300026142 Ga0207698_10001729 Ga0207698_100017297 296
95 3300048908 Ga0496105_0127141 Ga0496105_0127141_42_1013 296
96 3300049570 Ga0501033_0058449 Ga0501033_0058449_1483_2439 296
97 3300049577 Ga0501041_0002800 Ga0501041_0002800_1965_2921 296
98 3300049590 Ga0501074_0029127 Ga0501074_0029127_2218_3174 296
99 3300049591 Ga0501075_0002431 Ga0501075_0002431_4969_5925 296
100 3300049592 Ga0501076_0012563 Ga0501076_0012563_802_1758 296
101 3300049741 Ga0501079_0017990 Ga0501079_0017990_3062_4018 296
102 3300050514 nmdc:mga08x19_18905_c1 nmdc:mga08x19_18905_c1_207_1157 296
103 3300050515 nmdc:mga0a205_31700_c1 nmdc:mga0a205_31700_c1_3972_4922 296
104 3300061734 Ga0530510_0002501 Ga0530510_0002501_4969_5925 296
105 iso_pu_bacteria 2513020051 2513229949 296
106 3300005329 Ga0070683_100149766 Ga0070683_1001497663 297
107 3300005331 Ga0070670_100020391 Ga0070670_1000203916 297
108 3300005338 Ga0068868_100006062 Ga0068868_1000060629 297
109 3300005343 Ga0070687_100080326 Ga0070687_1000803262 297
110 3300005354 Ga0070675_100000914 Ga0070675_10000091419 297
111 3300005355 Ga0070671_100004642 Ga0070671_1000046427 297
112 3300005356 Ga0070674_100261913 Ga0070674_1002619131 297
113 3300005456 Ga0070678_100001277 Ga0070678_1000012779 297
114 3300005543 Ga0070672_100236720 Ga0070672_1002367201 297
115 3300005564 Ga0070664_100118953 Ga0070664_1001189532 297
116 3300005578 Ga0068854_100003877 Ga0068854_1000038779 297
117 3300005618 Ga0068864_100012735 Ga0068864_1000127353 297
118 3300006358 Ga0068871_100018406 Ga0068871_1000184062 297
119 3300006358 Ga0068871_100023560 Ga0068871_1000235602 297
120 3300013296 Ga0157374_10019302 Ga0157374_100193026 297
121 3300013297 Ga0157378_10088487 Ga0157378_100884872 297
122 3300013306 Ga0163162_10043534 Ga0163162_100435343 297
123 3300013308 Ga0157375_10020023 Ga0157375_100200234 297
124 3300014969 Ga0157376_10377297 Ga0157376_103772972 297
125 3300017792 Ga0163161_10343367 Ga0163161_103433672 297
126 3300025918 Ga0207662_10048840 Ga0207662_100488402 297
127 3300025925 Ga0207650_10001095 Ga0207650_100010952 297
128 3300025931 Ga0207644_10000147 Ga0207644_1000014735 297
129 3300025942 Ga0207689_10100992 Ga0207689_101009922 297
130 3300025944 Ga0207661_10068925 Ga0207661_100689252 297
131 3300025944 Ga0207661_10081039 Ga0207661_100810392 297
132 3300025981 Ga0207640_10302892 Ga0207640_103028922 297
133 3300026095 Ga0207676_10158841 Ga0207676_101588412 297
134 3300026121 Ga0207683_10000317 Ga0207683_1000031747 297
135 3300041458 Ga0451798_0667220 Ga0451798_0667220_18_965 297
136 3300041486 Ga0451807_1303413 Ga0451807_1303413_363_1310 297
137 3300046674 Ga0495588_0086032 Ga0495588_0086032_647_1633 297
138 3300048904 Ga0496101_0106158 Ga0496101_0106158_249_1193 297
139 3300048910 Ga0496107_0204234 Ga0496107_0204234_167_1111 297
140 3300048912 Ga0496109_0006848 Ga0496109_0006848_4526_5470 297
141 3300048913 Ga0496110_0019955 Ga0496110_0019955_253_1197 297
142 3300048914 Ga0496111_0179651 Ga0496111_0179651_78_1022 297
143 3300005295 Ga0065707_10092445 Ga0065707_100924453 298
144 3300005458 Ga0070681_10021386 Ga0070681_100213864 298
145 3300005544 Ga0070686_100067257 Ga0070686_1000672572 298
146 3300005544 Ga0070686_100166254 Ga0070686_1001662542 298
147 3300005548 Ga0070665_100211692 Ga0070665_1002116922 298
148 3300006237 Ga0097621_100011792 Ga0097621_1000117926 298
149 3300014497 Ga0182008_10005597 Ga0182008_100055973 298
150 3300015262 Ga0182007_10000617 Ga0182007_1000061711 298
151 3300028379 Ga0268266_10192689 Ga0268266_101926891 298
152 3300034817 Ga0373948_0015631 Ga0373948_0015631_130_1089 298
153 3300035088 Ga0373940_0014482 Ga0373940_0014482_25_984 298
154 3300035112 Ga0373932_0004013 Ga0373932_0004013_2103_3062 298
155 3300035121 Ga0373960_0045939 Ga0373960_0045939_154_1113 298
156 3300035242 Ga0373962_0015036 Ga0373962_0015036_308_1267 298
157 3300035691 Ga0373931_0002752 Ga0373931_0002752_2411_3370 298
158 3300035691 Ga0373931_0047510 Ga0373931_0047510_1139_2080 298
159 3300045051 Ga0451576_0028907 Ga0451576_0028907_27_986 298
160 3300053148 Ga0500590_056422 Ga0500590_056422_760_1731 298
161 3300007076 Ga0075435_100159174 Ga0075435_1001591741 299
162 3300009011 Ga0105251_10105976 Ga0105251_101059761 299
163 3300009094 Ga0111539_10235027 Ga0111539_102350272 299
164 3300010159 Ga0099796_10000615 Ga0099796_100006155 299
165 3300028380 Ga0268265_10549953 Ga0268265_105499531 299
166 3300046474 Ga0495605_0003185 Ga0495605_0003185_3894_4841 299
167 3300046500 Ga0495596_0000624 Ga0495596_0000624_10891_11838 299
168 3300046501 Ga0495607_0005823 Ga0495607_0005823_835_1782 299
169 3300046512 Ga0495610_0003249 Ga0495610_0003249_1012_1959 299
170 3300046513 Ga0495616_0004854 Ga0495616_0004854_5954_6901 299
171 3300046538 Ga0495609_0002814 Ga0495609_0002814_8378_9325 299
172 3300046692 Ga0495671_0003887 Ga0495671_0003887_1190_2137 299
173 3300048919 Ga0496116_0011913 Ga0496116_0011913_5522_6469 299
174 3300048924 Ga0496121_0007784 Ga0496121_0007784_10728_11675 299
175 3300048926 Ga0496123_0000967 Ga0496123_0000967_42534_43481 299
176 3300050513 nmdc:mga0rr50_327348_c1 nmdc:mga0rr50_327348_c1_231_1181 299
177 3300005327 Ga0070658_10019749 Ga0070658_100197492 300
178 3300005330 Ga0070690_100000575 Ga0070690_1000005754 300
179 3300005334 Ga0068869_100137325 Ga0068869_1001373252 300
180 3300005344 Ga0070661_100071842 Ga0070661_1000718423 300
181 3300005366 Ga0070659_100052983 Ga0070659_1000529833 300
182 3300005457 Ga0070662_100018544 Ga0070662_1000185442 300
183 3300005546 Ga0070696_100001426 Ga0070696_10000142619 300
184 3300005578 Ga0068854_100060076 Ga0068854_1000600763 300
185 3300006353 Ga0075370_10002278 Ga0075370_100022787 300
186 3300009036 Ga0105244_10001011 Ga0105244_1000101114 300
187 3300009148 Ga0105243_10007533 Ga0105243_100075333 300
188 3300010375 Ga0105239_10200687 Ga0105239_102006872 300
189 3300011119 Ga0105246_10076961 Ga0105246_100769612 300
190 3300015262 Ga0182007_10003714 Ga0182007_100037147 300
191 3300025728 Ga0207655_1018003 Ga0207655_10180034 300
192 3300025920 Ga0207649_10060535 Ga0207649_100605351 300
193 3300025932 Ga0207690_10031808 Ga0207690_100318082 300
194 3300025933 Ga0207706_10010532 Ga0207706_100105328 300
195 3300025935 Ga0207709_10001556 Ga0207709_1000155612 300
196 3300025942 Ga0207689_10118136 Ga0207689_101181362 300
197 3300027682 Ga0209971_1005391 Ga0209971_10053913 300
198 3300035111 Ga0373923_0052214 Ga0373923_0052214_192_1154 300
199 3300035117 Ga0373953_0032856 Ga0373953_0032856_105_1067 300
200 3300035118 Ga0373954_0050054 Ga0373954_0050054_837_1799 300
201 3300035172 Ga0373955_0031741 Ga0373955_0031741_380_1342 300
202 3300035410 Ga0373924_0005756 Ga0373924_0005756_925_1887 300
203 3300035724 Ga0373933_0006656 Ga0373933_0006656_4163_5125 300
204 3300035725 Ga0373947_0073539 Ga0373947_0073539_508_1482 300
205 3300036401 Ga0373937_0002785 Ga0373937_0002785_5120_6082 300
206 3300044712 Ga0453684_0492139 Ga0453684_0492139_269_1225 300
207 3300045051 Ga0451576_0006369 Ga0451576_0006369_5428_6384 300
208 3300046529 Ga0495652_0115235 Ga0495652_0115235_995_1957 300
209 3300047317 Ga0495604_0203311 Ga0495604_0203311_120_1082 300
210 3300048919 Ga0496116_0014246 Ga0496116_0014246_1813_2757 300
211 3300048924 Ga0496121_0046495 Ga0496121_0046495_1046_1990 300
212 3300048927 Ga0496124_0053851 Ga0496124_0053851_2193_3137 300
213 3300048928 Ga0496125_0023627 Ga0496125_0023627_1899_2843 300
214 3300049743 Ga0501081_0116000 Ga0501081_0116000_160_1131 300
215 3300050496 nmdc:mga07m45_14964_c1 nmdc:mga07m45_14964_c1_2507_3451 300
216 iso_pu_bacteria 2881101125 2881104697 300
217 3300003781 Ga0055536_1009558 Ga0055536_10095584 301
218 3300003792 Ga0055540_1010547 Ga0055540_10105472 301
219 3300006038 Ga0075365_10072295 Ga0075365_100722952 301
220 3300006042 Ga0075368_10022773 Ga0075368_100227732 301
221 3300006048 Ga0075363_100018174 Ga0075363_1000181743 301
222 3300006177 Ga0075362_10003439 Ga0075362_100034393 301
223 3300006178 Ga0075367_10179125 Ga0075367_101791251 301
224 3300006186 Ga0075369_10014473 Ga0075369_100144733 301
225 3300006353 Ga0075370_10057372 Ga0075370_100573721 301
226 3300032005 Ga0307411_10044619 Ga0307411_100446193 301
227 3300046512 Ga0495610_0001269 Ga0495610_0001269_5858_6835 301
228 3300046538 Ga0495609_0001256 Ga0495609_0001256_6043_7020 301
229 3300048919 Ga0496116_0028519 Ga0496116_0028519_229_1206 301
230 3300048924 Ga0496121_0051016 Ga0496121_0051016_1708_2685 301
231 3300049573 Ga0501037_0039939 Ga0501037_0039939_1027_1995 301
232 3300049576 Ga0501040_0050091 Ga0501040_0050091_405_1373 301
233 3300049577 Ga0501041_0028277 Ga0501041_0028277_619_1587 301
234 3300049578 Ga0501042_0029825 Ga0501042_0029825_1440_2408 301
235 3300049582 Ga0501048_0010243 Ga0501048_0010243_5414_6382 301
236 3300049588 Ga0501072_0141064 Ga0501072_0141064_941_1909 301
237 3300049591 Ga0501075_0020736 Ga0501075_0020736_1661_2629 301
238 3300049592 Ga0501076_0134672 Ga0501076_0134672_458_1426 301
239 3300049593 Ga0501077_0147788 Ga0501077_0147788_74_1042 301
240 3300049742 Ga0501080_0014848 Ga0501080_0014848_5368_6336 301
241 3300049744 Ga0501083_0179249 Ga0501083_0179249_43_1011 301
242 3300049824 Ga0501045_0003422 Ga0501045_0003422_1724_2692 301
243 3300050490 nmdc:mga03n38_4600_c1 nmdc:mga03n38_4600_c1_1881_2858 301
244 3300050492 nmdc:mga0yw44_20945_c1 nmdc:mga0yw44_20945_c1_980_1957 301
245 3300050493 nmdc:mga0k408_28320_c1 nmdc:mga0k408_28320_c1_641_1618 301
246 3300050496 nmdc:mga07m45_17022_c1 nmdc:mga07m45_17022_c1_473_1450 301
247 3300050509 nmdc:mga0qj67_3607_c1 nmdc:mga0qj67_3607_c1_292_1470 301
248 3300060353 Ga0501082_0015431 Ga0501082_0015431_1583_2551 301
249 3300061734 Ga0530510_0004066 Ga0530510_0004066_85_1053 301
250 iso_pu_bacteria 2643221683 2644468795 301
251 iso_pu_bacteria 2842733646 2842736530 301
252 iso_pu_bacteria 2881412998 2881414546 301
253 3300005327 Ga0070658_10009897 Ga0070658_100098975 302
254 3300005334 Ga0068869_100077556 Ga0068869_1000775563 302
255 3300005459 Ga0068867_100017628 Ga0068867_1000176281 302
256 3300005530 Ga0070679_100629100 Ga0070679_1006291001 302
257 3300005543 Ga0070672_100031956 Ga0070672_1000319563 302
258 3300005548 Ga0070665_100092556 Ga0070665_1000925563 302
259 3300005616 Ga0068852_100069343 Ga0068852_1000693432 302
260 3300005718 Ga0068866_10085982 Ga0068866_100859822 302
261 3300005842 Ga0068858_100044878 Ga0068858_1000448785 302
262 3300005843 Ga0068860_100006642 Ga0068860_10000664213 302
263 3300005844 Ga0068862_100009331 Ga0068862_1000093315 302
264 3300005844 Ga0068862_100095862 Ga0068862_1000958622 302
265 3300006186 Ga0075369_10127696 Ga0075369_101276962 302
266 3300006195 Ga0075366_10013463 Ga0075366_100134633 302
267 3300006195 Ga0075366_10018874 Ga0075366_100188744 302
268 3300006353 Ga0075370_10181533 Ga0075370_101815331 302
269 3300009093 Ga0105240_10155520 Ga0105240_101555203 302
270 3300009176 Ga0105242_10217568 Ga0105242_102175682 302
271 3300009553 Ga0105249_10018182 Ga0105249_100181823 302
272 3300013297 Ga0157378_10012649 Ga0157378_100126498 302
273 3300013308 Ga0157375_10058319 Ga0157375_100583193 302
274 3300014326 Ga0157380_10086697 Ga0157380_100866972 302
275 3300014968 Ga0157379_10042185 Ga0157379_100421852 302
276 3300014969 Ga0157376_10050947 Ga0157376_100509472 302
277 3300017792 Ga0163161_10026628 Ga0163161_100266284 302
278 3300017792 Ga0163161_10047330 Ga0163161_100473302 302
279 3300025909 Ga0207705_10011222 Ga0207705_100112223 302
280 3300025923 Ga0207681_10004690 Ga0207681_100046905 302
281 3300025938 Ga0207704_10103158 Ga0207704_101031583 302
282 3300025940 Ga0207691_10008538 Ga0207691_100085386 302
283 3300025942 Ga0207689_10157411 Ga0207689_101574112 302
284 3300025961 Ga0207712_10009743 Ga0207712_100097435 302
285 3300026035 Ga0207703_10077554 Ga0207703_100775543 302
286 3300026088 Ga0207641_10067354 Ga0207641_100673542 302
287 3300026089 Ga0207648_10000853 Ga0207648_100008537 302
288 3300026118 Ga0207675_100000415 Ga0207675_10000041540 302
289 3300028379 Ga0268266_10325305 Ga0268266_103253052 302
290 3300028381 Ga0268264_10007630 Ga0268264_100076308 302
291 3300028577 Ga0265318_10012091 Ga0265318_100120914 302
292 3300031235 Ga0265330_10032538 Ga0265330_100325382 302
293 3300031238 Ga0265332_10003766 Ga0265332_100037663 302
294 3300031242 Ga0265329_10012356 Ga0265329_100123562 302
295 3300031250 Ga0265331_10039398 Ga0265331_100393982 302
296 3300031344 Ga0265316_10040384 Ga0265316_100403842 302
297 3300031711 Ga0265314_10011575 Ga0265314_100115755 302
298 3300031712 Ga0265342_10005301 Ga0265342_100053017 302
299 3300032002 Ga0307416_100796514 Ga0307416_1007965141 302
300 3300033179 Ga0307507_10029624 Ga0307507_100296243 302
301 3300033179 Ga0307507_10096976 Ga0307507_100969762 302
302 3300042007 Ga0439449_0007495 Ga0439449_0007495_45_995 302
303 3300047318 Ga0495636_0009262 Ga0495636_0009262_2397_3350 302
304 3300048919 Ga0496116_0008659 Ga0496116_0008659_2950_3903 302
305 3300048925 Ga0496122_0000383 Ga0496122_0000383_57032_58015 302
306 3300048926 Ga0496123_0000249 Ga0496123_0000249_36697_37680 302
307 3300050493 nmdc:mga0k408_19531_c1 nmdc:mga0k408_19531_c1_1218_2183 302
308 3300053136 Ga0500559_0001462 Ga0500559_0001462_7871_8854 302
309 3300053136 Ga0500559_0050126 Ga0500559_0050126_176_1159 302
310 3300053140 Ga0500573_0069348 Ga0500573_0069348_420_1403 302
311 3300053153 Ga0500616_0073468 Ga0500616_0073468_187_1200 302
312 3300053177 Ga0500636_0136336 Ga0500636_0136336_103_1083 302
313 iso_pu_bacteria 2513237150 2513952555 302
314 iso_pu_bacteria 2513237150 2513957469 302
315 3300003187 JGI25151J46595_10003352 JGI25151J46595_100033523 303
316 3300003187 JGI25151J46595_10022894 JGI25151J46595_100228942 303
317 3300003659 JGI25404J52841_10003784 JGI25404J52841_100037842 303
318 3300003771 Ga0055526_1000288 Ga0055526_100028830 303
319 3300003781 Ga0055536_1000201 Ga0055536_10002013 303
320 3300003784 Ga0055534_1000191 Ga0055534_10001918 303
321 3300005295 Ga0065707_10084818 Ga0065707_100848184 303
322 3300005331 Ga0070670_100010321 Ga0070670_1000103214 303
323 3300005338 Ga0068868_100024878 Ga0068868_1000248783 303
324 3300005347 Ga0070668_100005959 Ga0070668_1000059592 303
325 3300005353 Ga0070669_100072924 Ga0070669_1000729242 303
326 3300005356 Ga0070674_100063629 Ga0070674_1000636293 303
327 3300005456 Ga0070678_100180341 Ga0070678_1001803413 303
328 3300005543 Ga0070672_100066885 Ga0070672_1000668853 303
329 3300005547 Ga0070693_100027532 Ga0070693_1000275323 303
330 3300005577 Ga0068857_100197071 Ga0068857_1001970712 303
331 3300005719 Ga0068861_100245834 Ga0068861_1002458342 303
332 3300005840 Ga0068870_10027639 Ga0068870_100276392 303
333 3300005841 Ga0068863_100025452 Ga0068863_1000254523 303
334 3300005843 Ga0068860_100017353 Ga0068860_1000173534 303
335 3300005983 Ga0081540_1000003 Ga0081540_10000039 303
336 3300006237 Ga0097621_100008234 Ga0097621_1000082342 303
337 3300006844 Ga0075428_100022170 Ga0075428_1000221706 303
338 3300007265 Ga0099794_10025206 Ga0099794_100252062 303
339 3300009094 Ga0111539_10002462 Ga0111539_100024629 303
340 3300009551 Ga0105238_10174994 Ga0105238_101749943 303
341 3300013308 Ga0157375_10005076 Ga0157375_100050764 303
342 3300014325 Ga0163163_10095474 Ga0163163_100954742 303
343 3300014969 Ga0157376_10007773 Ga0157376_100077737 303
344 3300021361 Ga0213872_10001596 Ga0213872_100015967 303
345 3300025291 Ga0209675_1000078 Ga0209675_1000078112 303
346 3300025292 Ga0209676_1000121 Ga0209676_100012172 303
347 3300025292 Ga0209676_1001320 Ga0209676_10013204 303
348 3300025294 Ga0209025_1000051 Ga0209025_1000051116 303
349 3300025294 Ga0209025_1001694 Ga0209025_100169423 303
350 3300025295 Ga0209564_1000133 Ga0209564_100013367 303
351 3300025303 Ga0209051_1000944 Ga0209051_10009445 303
352 3300025908 Ga0207643_10101752 Ga0207643_101017522 303
353 3300025923 Ga0207681_10104523 Ga0207681_101045232 303
354 3300025925 Ga0207650_10138185 Ga0207650_101381852 303
355 3300025935 Ga0207709_10000785 Ga0207709_100007853 303
356 3300025940 Ga0207691_10085090 Ga0207691_100850902 303
357 3300025972 Ga0207668_10007850 Ga0207668_100078504 303
358 3300026035 Ga0207703_10402975 Ga0207703_104029752 303
359 3300026088 Ga0207641_10101764 Ga0207641_101017643 303
360 3300026089 Ga0207648_10187049 Ga0207648_101870491 303
361 3300026095 Ga0207676_10009521 Ga0207676_100095215 303
362 3300026118 Ga0207675_100369363 Ga0207675_1003693632 303
363 3300026121 Ga0207683_10082033 Ga0207683_100820332 303
364 3300027512 Ga0209179_1001332 Ga0209179_10013322 303
365 3300027671 Ga0209588_1029369 Ga0209588_10293692 303
366 3300027907 Ga0207428_10014340 Ga0207428_100143404 303
367 3300028381 Ga0268264_10015304 Ga0268264_100153044 303
368 3300046477 Ga0495664_0065888 Ga0495664_0065888_743_1795 303
369 3300050511 nmdc:mga08y16_10093_c1 nmdc:mga08y16_10093_c1_5599_6567 303
370 3300053117 Ga0500593_000385 Ga0500593_000385_6139_7101 303
371 3300053153 Ga0500616_0030328 Ga0500616_0030328_873_1943 303
372 iso_pu_bacteria 2842733646 2842736050 303
373 iso_pu_bacteria 2842747753 2842749131 303
374 iso_pu_bacteria 2904541872 2904542348 303
375 iso_pu_bacteria 2929160207 2929167621 303
376 iso_pu_bacteria 644736347 644750637 303
377 3300003771 Ga0055526_1001419 Ga0055526_100141913 304
378 3300003775 Ga0055524_1015676 Ga0055524_10156762 304
379 3300005364 Ga0070673_100246948 Ga0070673_1002469482 304
380 3300005563 Ga0068855_100010517 Ga0068855_1000105174 304
381 3300007788 Ga0099795_10003770 Ga0099795_100037703 304
382 3300009093 Ga0105240_10006246 Ga0105240_1000624618 304
383 3300009177 Ga0105248_10311044 Ga0105248_103110442 304
384 3300013104 Ga0157370_10069039 Ga0157370_100690393 304
385 3300025294 Ga0209025_1001087 Ga0209025_100108710 304
386 3300025295 Ga0209564_1000170 Ga0209564_100017081 304
387 3300025299 Ga0209256_1000400 Ga0209256_100040029 304
388 3300025909 Ga0207705_10128615 Ga0207705_101286152 304
389 3300025919 Ga0207657_10059989 Ga0207657_100599893 304
390 3300025921 Ga0207652_10097886 Ga0207652_100978863 304
391 3300025941 Ga0207711_10046360 Ga0207711_100463603 304
392 3300027512 Ga0209179_1001419 Ga0209179_10014192 304
393 3300031852 Ga0307410_10220145 Ga0307410_102201452 304
394 3300031911 Ga0307412_10219676 Ga0307412_102196762 304
395 3300031995 Ga0307409_100139767 Ga0307409_1001397672 304
396 3300032002 Ga0307416_100309661 Ga0307416_1003096612 304
397 3300038443 Ga0395901_0087117 Ga0395901_0087117_1599_2570 304
398 3300046539 Ga0495621_0035327 Ga0495621_0035327_297_1262 304
399 3300046543 Ga0495645_0104857 Ga0495645_0104857_352_1356 304
400 3300047472 Ga0495686_0116498 Ga0495686_0116498_82_1050 304
401 3300053086 Ga0500578_0025224 Ga0500578_0025224_2063_3031 304
402 3300053730 Ga0500645_005317 Ga0500645_005317_80_1048 304
403 iso_pu_bacteria 2513237165 2514040297 304
404 iso_pu_bacteria 2643221609 2644058447 304
405 iso_pu_bacteria 2643221683 2644465266 304
406 3300003911 JGI25405J52794_10018190 JGI25405J52794_100181901 305
407 3300005329 Ga0070683_100496653 Ga0070683_1004966531 305
408 3300005331 Ga0070670_100138989 Ga0070670_1001389892 305
409 3300005338 Ga0068868_100172332 Ga0068868_1001723323 305
410 3300005344 Ga0070661_100183699 Ga0070661_1001836992 305
411 3300005354 Ga0070675_100257453 Ga0070675_1002574532 305
412 3300005364 Ga0070673_100441156 Ga0070673_1004411561 305
413 3300005440 Ga0070705_100178274 Ga0070705_1001782741 305
414 3300005456 Ga0070678_100281895 Ga0070678_1002818951 305
415 3300005458 Ga0070681_10109756 Ga0070681_101097562 305
416 3300005467 Ga0070706_100115470 Ga0070706_1001154702 305
417 3300005536 Ga0070697_100296300 Ga0070697_1002963001 305
418 3300005543 Ga0070672_100027831 Ga0070672_1000278312 305
419 3300005578 Ga0068854_100429708 Ga0068854_1004297081 305
420 3300005616 Ga0068852_100075529 Ga0068852_1000755293 305
421 3300005618 Ga0068864_100386951 Ga0068864_1003869511 305
422 3300005937 Ga0081455_10002647 Ga0081455_1000264716 305
423 3300006237 Ga0097621_100023333 Ga0097621_1000233334 305
424 3300006948 Ga0099826_10000031 Ga0099826_1000003144 305
425 3300009098 Ga0105245_10225345 Ga0105245_102253452 305
426 3300009176 Ga0105242_10276480 Ga0105242_102764802 305
427 3300009177 Ga0105248_10258815 Ga0105248_102588152 305
428 3300013296 Ga0157374_10185066 Ga0157374_101850662 305
429 3300013306 Ga0163162_10306712 Ga0163162_103067121 305
430 3300013306 Ga0163162_10527774 Ga0163162_105277741 305
431 3300013308 Ga0157375_10271601 Ga0157375_102716012 305
432 3300014326 Ga0157380_10048578 Ga0157380_100485783 305
433 3300014968 Ga0157379_10139400 Ga0157379_101394003 305
434 3300014969 Ga0157376_10181673 Ga0157376_101816732 305
435 3300025263 Ga0209565_1003299 Ga0209565_10032995 305
436 3300025291 Ga0209675_1001996 Ga0209675_10019967 305
437 3300025303 Ga0209051_1004615 Ga0209051_10046156 305
438 3300025315 Ga0207697_10102400 Ga0207697_101024001 305
439 3300025910 Ga0207684_10349691 Ga0207684_103496911 305
440 3300025918 Ga0207662_10207325 Ga0207662_102073252 305
441 3300025925 Ga0207650_10259037 Ga0207650_102590371 305
442 3300025931 Ga0207644_10047172 Ga0207644_100471723 305
443 3300025934 Ga0207686_10138439 Ga0207686_101384392 305
444 3300025940 Ga0207691_10007342 Ga0207691_100073424 305
445 3300025945 Ga0207679_10269642 Ga0207679_102696421 305
446 3300025981 Ga0207640_10421569 Ga0207640_104215691 305
447 3300026035 Ga0207703_10309919 Ga0207703_103099191 305
448 3300026121 Ga0207683_10213359 Ga0207683_102133592 305
449 3300027666 Ga0209282_1000011 Ga0209282_1000011161 305
450 3300045051 Ga0451576_0314990 Ga0451576_0314990_263_1237 305
451 3300046454 Ga0495592_0042728 Ga0495592_0042728_1621_2595 305
452 3300046536 Ga0495587_0011304 Ga0495587_0011304_528_1502 305
453 3300046543 Ga0495645_0002809 Ga0495645_0002809_4464_5438 305
454 3300046559 Ga0495667_0038499 Ga0495667_0038499_1771_2745 305
455 3300046678 Ga0495599_0036314 Ga0495599_0036314_155_1129 305
456 3300046694 Ga0495649_0026589 Ga0495649_0026589_1478_2533 305
457 3300046809 Ga0495600_0017664 Ga0495600_0017664_1232_2206 305
458 3300046809 Ga0495600_0169662 Ga0495600_0169662_24_992 305
459 3300048911 Ga0496108_0199692 Ga0496108_0199692_424_1404 305
460 3300048913 Ga0496110_0106462 Ga0496110_0106462_1306_2286 305
461 3300048914 Ga0496111_0015901 Ga0496111_0015901_255_1235 305
462 3300048914 Ga0496111_0192173 Ga0496111_0192173_506_1495 305
463 3300053077 Ga0495601_0006318 Ga0495601_0006318_2313_3287 305
464 3300053085 Ga0495619_0069933 Ga0495619_0069933_1011_1985 305
465 iso_pu_bacteria 2842775625 2842779442 305
466 3300005329 Ga0070683_100021732 Ga0070683_1000217324 306
467 3300005365 Ga0070688_100351196 Ga0070688_1003511961 306
468 3300005563 Ga0068855_100102443 Ga0068855_1001024433 306
469 3300005614 Ga0068856_100050075 Ga0068856_1000500754 306
470 3300005616 Ga0068852_100014091 Ga0068852_1000140913 306
471 3300005718 Ga0068866_10188643 Ga0068866_101886432 306
472 3300009094 Ga0111539_10056832 Ga0111539_100568322 306
473 3300013102 Ga0157371_10095083 Ga0157371_100950832 306
474 3300013105 Ga0157369_10225383 Ga0157369_102253832 306
475 3300013307 Ga0157372_10157194 Ga0157372_101571943 306
476 3300025914 Ga0207671_10102403 Ga0207671_101024032 306
477 3300026142 Ga0207698_10032159 Ga0207698_100321594 306
478 3300028379 Ga0268266_10158651 Ga0268266_101586512 306
479 3300030521 Ga0307511_10000976 Ga0307511_1000097621 306
480 3300037418 Ga0395900_0005201 Ga0395900_0005201_1269_2261 306
481 3300038443 Ga0395901_0010742 Ga0395901_0010742_4319_5311 306
482 3300048917 Ga0496114_0043438 Ga0496114_0043438_1842_2840 306
483 3300053090 Ga0500646_0002708 Ga0500646_0002708_3260_4273 306
484 3300053098 Ga0500650_0035802 Ga0500650_0035802_243_1256 306
485 3300053151 Ga0500604_0001071 Ga0500604_0001071_5816_6829 306
486 3300053154 Ga0500619_000081 Ga0500619_000081_13083_14054 306
487 iso_pu_bacteria 2855730933 2855735703 306
488 iso_pu_bacteria 2855767633 2855772641 306
489 3300005289 Ga0065704_10074045 Ga0065704_100740453 307
490 3300005338 Ga0068868_100362297 Ga0068868_1003622972 307
491 3300005354 Ga0070675_100012844 Ga0070675_1000128443 307
492 3300005457 Ga0070662_100317753 Ga0070662_1003177531 307
493 3300005548 Ga0070665_100165689 Ga0070665_1001656892 307
494 3300005616 Ga0068852_100294180 Ga0068852_1002941802 307
495 3300005983 Ga0081540_1010836 Ga0081540_10108364 307
496 3300006178 Ga0075367_10113943 Ga0075367_101139432 307
497 3300006195 Ga0075366_10010050 Ga0075366_100100504 307
498 3300009094 Ga0111539_10072650 Ga0111539_100726502 307
499 3300025940 Ga0207691_10248234 Ga0207691_102482342 307
500 3300026089 Ga0207648_10124451 Ga0207648_101244511 307
501 3300037068 Ga0373925_0224588 Ga0373925_0224588_175_1152 307
502 3300037471 Ga0395905_0393399 Ga0395905_0393399_238_1227 307
503 3300048911 Ga0496108_0085734 Ga0496108_0085734_622_1599 307
504 3300048925 Ga0496122_0019704 Ga0496122_0019704_4290_5270 307
505 3300048928 Ga0496125_0001761 Ga0496125_0001761_9863_10843 307
506 3300048929 Ga0496126_0025267 Ga0496126_0025267_590_1570 307
507 3300049574 Ga0501038_0147400 Ga0501038_0147400_691_1668 307
508 3300049587 Ga0501071_0117450 Ga0501071_0117450_968_1945 307
509 3300049588 Ga0501072_0012735 Ga0501072_0012735_3468_4541 307
510 3300049591 Ga0501075_0043541 Ga0501075_0043541_1552_2625 307
511 3300049592 Ga0501076_0009377 Ga0501076_0009377_961_2034 307
512 3300050511 nmdc:mga08y16_210911_c1 nmdc:mga08y16_210911_c1_318_1301 307
513 3300053148 Ga0500590_045762 Ga0500590_045762_354_1331 307
514 3300060353 Ga0501082_0074944 Ga0501082_0074944_248_1321 307
515 3300060353 Ga0501082_0201645 Ga0501082_0201645_390_1367 307
516 3300061734 Ga0530510_0011205 Ga0530510_0011205_1768_2841 307
517 iso_pu_bacteria 2838054893 2838056811 307
518 3300005335 Ga0070666_10069130 Ga0070666_100691303 308
519 3300005530 Ga0070679_100037763 Ga0070679_1000377631 308
520 3300005536 Ga0070697_100038873 Ga0070697_1000388732 308
521 3300005616 Ga0068852_100007385 Ga0068852_1000073856 308
522 3300005834 Ga0068851_10006790 Ga0068851_100067904 308
523 3300005841 Ga0068863_100055454 Ga0068863_1000554542 308
524 3300006871 Ga0075434_100346312 Ga0075434_1003463122 308
525 3300006948 Ga0099826_10000074 Ga0099826_1000007437 308
526 3300009011 Ga0105251_10015793 Ga0105251_100157932 308
527 3300025321 Ga0207656_10002176 Ga0207656_100021765 308
528 3300025735 Ga0207713_1027016 Ga0207713_10270162 308
529 3300025940 Ga0207691_10000123 Ga0207691_1000012345 308
530 3300025981 Ga0207640_10024546 Ga0207640_100245462 308
531 3300026023 Ga0207677_10002235 Ga0207677_100022359 308
532 3300026142 Ga0207698_10009508 Ga0207698_100095082 308
533 3300027666 Ga0209282_1000113 Ga0209282_100011310 308
534 3300031911 Ga0307412_10144364 Ga0307412_101443642 308
535 3300032004 Ga0307414_10078323 Ga0307414_100783232 308
536 3300042007 Ga0439449_0000184 Ga0439449_0000184_7773_8747 308
537 3300042532 Ga0450893_0003656 Ga0450893_0003656_389_1360 308
538 3300044694 Ga0466963_0031491 Ga0466963_0031491_163_1125 308
539 3300045976 Ga0466967_0034573 Ga0466967_0034573_1399_2361 308
540 3300046457 Ga0495590_0021611 Ga0495590_0021611_352_1497 308
541 3300046474 Ga0495605_0001934 Ga0495605_0001934_8636_9781 308
542 3300046491 Ga0495584_0049005 Ga0495584_0049005_844_1989 308
543 3300046500 Ga0495596_0000121 Ga0495596_0000121_6638_7633 308
544 3300046512 Ga0495610_0000387 Ga0495610_0000387_6571_7566 308
545 3300046513 Ga0495616_0005358 Ga0495616_0005358_6424_7569 308
546 3300046538 Ga0495609_0001279 Ga0495609_0001279_10446_11441 308
547 3300046665 Ga0495661_0003687 Ga0495661_0003687_654_1649 308
548 3300046691 Ga0495670_0051539 Ga0495670_0051539_181_1176 308
549 3300046692 Ga0495671_0000494 Ga0495671_0000494_6343_7488 308
550 3300047320 Ga0495672_0017538 Ga0495672_0017538_175_1170 308
551 3300048919 Ga0496116_0004217 Ga0496116_0004217_10020_11165 308
552 3300048924 Ga0496121_0001338 Ga0496121_0001338_5509_6654 308
553 3300048925 Ga0496122_0000930 Ga0496122_0000930_4234_5379 308
554 3300048926 Ga0496123_0000369 Ga0496123_0000369_6475_7620 308
555 3300048928 Ga0496125_0056558 Ga0496125_0056558_522_1667 308
556 3300048929 Ga0496126_0069817 Ga0496126_0069817_115_1110 308
557 3300059424 Ga0590075_012593 Ga0590075_012593_543_1514 308
558 3300005985 Ga0081539_10068990 Ga0081539_100689902 309
559 3300037312 Ga0395899_0003707 Ga0395899_0003707_8940_9905 309
560 3300037418 Ga0395900_0029035 Ga0395900_0029035_891_1856 309
561 3300037466 Ga0395898_0006230 Ga0395898_0006230_3731_4696 309
562 3300037466 Ga0395898_0191534 Ga0395898_0191534_305_1279 309
563 3300037471 Ga0395905_0060121 Ga0395905_0060121_1567_2541 309
564 3300038443 Ga0395901_0022578 Ga0395901_0022578_2095_3060 309
565 3300046684 Ga0495669_0039820 Ga0495669_0039820_29_1003 309
566 3300047318 Ga0495636_0039683 Ga0495636_0039683_547_1521 309
567 3300048924 Ga0496121_0052904 Ga0496121_0052904_2280_3284 309
568 3300049570 Ga0501033_0005170 Ga0501033_0005170_2397_3401 309
569 3300049571 Ga0501034_0041075 Ga0501034_0041075_1974_2978 309
570 3300049575 Ga0501039_0190641 Ga0501039_0190641_225_1229 309
571 3300049581 Ga0501047_0026159 Ga0501047_0026159_1903_2907 309
572 3300049822 Ga0501035_0013969 Ga0501035_0013969_4138_5142 309
573 3300049823 Ga0501044_0002878 Ga0501044_0002878_17427_18431 309
574 3300050492 nmdc:mga0yw44_37002_c1 nmdc:mga0yw44_37002_c1_725_1765 309
575 iso_pu_bacteria 2738543013 2739249236 309
576 iso_pu_bacteria 2834641062 2834644212 309
577 iso_pu_bacteria 2928115317 2928120274 309
578 iso_pu_bacteria 8003400568 8003401918 309
579 3300003187 JGI25151J46595_10000075 JGI25151J46595_1000007551 310
580 3300005834 Ga0068851_10046969 Ga0068851_100469691 310
581 3300006948 Ga0099826_10000004 Ga0099826_1000000441 310
582 3300025294 Ga0209025_1000027 Ga0209025_1000027291 310
583 3300025321 Ga0207656_10025627 Ga0207656_100256272 310
584 3300025735 Ga0207713_1083263 Ga0207713_10832631 310
585 3300025945 Ga0207679_10026007 Ga0207679_100260073 310
586 3300026078 Ga0207702_10475372 Ga0207702_104753721 310
587 3300027666 Ga0209282_1000078 Ga0209282_100007842 310
588 iso_pu_bacteria 2904541872 2904546169 310
589 iso_pu_bacteria 2929160207 2929163988 310
590 3300015683 Ga0183362_10001 Ga0183362_100011677 311
591 3300046528 Ga0495642_0033512 Ga0495642_0033512_541_1524 311
592 3300037312 Ga0395899_0001705 Ga0395899_0001705_9695_10678 312
593 3300037418 Ga0395900_0001713 Ga0395900_0001713_7507_8490 312
594 3300037466 Ga0395898_0011212 Ga0395898_0011212_715_1698 312
595 3300038443 Ga0395901_0004147 Ga0395901_0004147_7632_8615 312
596 iso_pu_bacteria 2904449895 2904455341 312
597 iso_pu_bacteria 2904456579 2904460509 312
598 iso_pu_bacteria 2929520902 2929524713 312
599 iso_pu_bacteria 2945972063 2945976823 312
600 3300049571 Ga0501034_0161318 Ga0501034_0161318_15_998 313
601 iso_pu_bacteria 2831265667 2831270587 313
602 iso_pu_bacteria 2899924645 2899925452 313
603 iso_pu_bacteria 2928051484 2928053642 313
604 iso_pu_bacteria 2928064002 2928067189 313
605 iso_pu_bacteria 2928084124 2928085134 313
606 iso_pu_bacteria 8003400568 8003405207 313
607 3300003187 JGI25151J46595_10011276 JGI25151J46595_100112763 314
608 3300012502 Ga0157347_1005083 Ga0157347_10050832 314
609 3300014497 Ga0182008_10013054 Ga0182008_100130544 314
610 3300017792 Ga0163161_10000065 Ga0163161_10000065109 314
611 3300025294 Ga0209025_1000096 Ga0209025_100009636 314
612 3300028794 Ga0307515_10201912 Ga0307515_102019122 314
613 3300031911 Ga0307412_10015702 Ga0307412_100157023 314
614 iso_pu_bacteria 2945909444 2945912662 314
615 iso_pu_bacteria 2945984333 2945985049 314
616 3300005364 Ga0070673_100336883 Ga0070673_1003368832 315
617 3300005367 Ga0070667_100015926 Ga0070667_1000159261 315
618 3300005543 Ga0070672_100090460 Ga0070672_1000904602 315
619 3300013306 Ga0163162_10004924 Ga0163162_1000492412 315
620 3300017792 Ga0163161_10030339 Ga0163161_100303393 315
621 3300025924 Ga0207694_10157198 Ga0207694_101571982 315
622 3300028379 Ga0268266_10302226 Ga0268266_103022262 315
623 3300031251 Ga0265327_10022499 Ga0265327_100224992 315
624 3300046475 Ga0495639_0002606 Ga0495639_0002606_4682_5677 315
625 3300046557 Ga0495622_0085934 Ga0495622_0085934_93_1088 315
626 3300046691 Ga0495670_0022371 Ga0495670_0022371_138_1133 315
627 3300048903 Ga0496100_0014235 Ga0496100_0014235_1776_2771 315
628 3300048904 Ga0496101_0004822 Ga0496101_0004822_1712_2707 315
629 3300048908 Ga0496105_0001248 Ga0496105_0001248_5022_6017 315
630 3300048911 Ga0496108_0199476 Ga0496108_0199476_263_1258 315
631 3300048912 Ga0496109_0060743 Ga0496109_0060743_645_1640 315
632 3300048913 Ga0496110_0078584 Ga0496110_0078584_911_1906 315
633 3300003187 JGI25151J46595_10001007 JGI25151J46595_100010073 316
634 3300003187 JGI25151J46595_10003059 JGI25151J46595_100030597 316
635 3300003578 Ga0006562J51391_1118556 Ga0006562J51391_11185564 316
636 3300003781 Ga0055536_1011408 Ga0055536_10114084 316
637 3300003792 Ga0055540_1002232 Ga0055540_10022329 316
638 3300003792 Ga0055540_1009260 Ga0055540_10092604 316
639 3300003794 Ga0055531_10006424 Ga0055531_100064244 316
640 3300005288 Ga0065714_10078094 Ga0065714_100780943 316
641 3300005354 Ga0070675_100133025 Ga0070675_1001330251 316
642 3300006353 Ga0075370_10003866 Ga0075370_100038666 316
643 3300006353 Ga0075370_10073892 Ga0075370_100738922 316
644 3300009148 Ga0105243_10061593 Ga0105243_100615932 316
645 3300013100 Ga0157373_10054161 Ga0157373_100541612 316
646 3300025258 Ga0209129_1004158 Ga0209129_10041584 316
647 3300025292 Ga0209676_1001396 Ga0209676_10013965 316
648 3300025294 Ga0209025_1000157 Ga0209025_1000157103 316
649 3300025298 Ga0209050_1002090 Ga0209050_10020902 316
650 3300025303 Ga0209051_1000092 Ga0209051_1000092140 316
651 3300025303 Ga0209051_1000490 Ga0209051_100049045 316
652 3300025304 Ga0209257_1000508 Ga0209257_100050855 316
653 3300028794 Ga0307515_10000028 Ga0307515_10000028176 316
654 3300031251 Ga0265327_10000465 Ga0265327_1000046557 316
655 3300031548 Ga0307408_100013471 Ga0307408_1000134713 316
656 3300031548 Ga0307408_100044752 Ga0307408_1000447524 316
657 3300031649 Ga0307514_10001952 Ga0307514_100019524 316
658 3300031901 Ga0307406_10000194 Ga0307406_1000019417 316
659 3300031911 Ga0307412_10005778 Ga0307412_100057784 316
660 3300032005 Ga0307411_10150192 Ga0307411_101501923 316
661 3300041404 Ga0439436_0003275 Ga0439436_0003275_250_1260 316
662 3300041405 Ga0439438_011801 Ga0439438_011801_710_1705 316
663 3300042006 Ga0439432_004127 Ga0439432_004127_1879_2874 316
664 3300042146 Ga0450907_019469 Ga0450907_019469_14_1009 316
665 3300042184 Ga0450908_003708 Ga0450908_003708_1006_2016 316
666 3300042185 Ga0450909_001072 Ga0450909_001072_950_1945 316
667 3300042435 Ga0439434_0001880 Ga0439434_0001880_3182_4192 316
668 3300044901 Ga0466960_0077707 Ga0466960_0077707_579_1580 316
669 3300046515 Ga0495620_0009726 Ga0495620_0009726_2528_3538 316
670 3300046616 Ga0495668_0036686 Ga0495668_0036686_317_1327 316
671 3300046692 Ga0495671_0004931 Ga0495671_0004931_6779_7789 316
672 3300046809 Ga0495600_0051794 Ga0495600_0051794_12_1091 316
673 3300050489 nmdc:mga03683_13376_c1 nmdc:mga03683_13376_c1_1619_2629 316
674 3300050496 nmdc:mga07m45_103017_c1 nmdc:mga07m45_103017_c1_44_1036 316
675 3300050496 nmdc:mga07m45_6982_c1 nmdc:mga07m45_6982_c1_4345_5355 316
676 3300053079 Ga0500610_0001394 Ga0500610_0001394_1299_2309 316
677 3300053079 Ga0500610_0005581 Ga0500610_0005581_766_1776 316
678 3300053121 Ga0500607_013519 Ga0500607_013519_1948_2958 316
679 3300053122 Ga0500608_003408 Ga0500608_003408_3257_4249 316
680 3300053158 Ga0500627_0004346 Ga0500627_0004346_2884_3894 316
681 3300053161 Ga0500634_0015722 Ga0500634_0015722_1357_2367 316
682 iso_pu_bacteria 2643221672 2644398459 316
683 3300002773 JGI25152J39213_1006739 JGI25152J39213_10067391 317
684 3300002774 JGI25150J39212_1004124 JGI25150J39212_10041242 317
685 3300002987 JGI25159J45721_1003238 JGI25159J45721_10032382 317
686 3300003187 JGI25151J46595_10023197 JGI25151J46595_100231973 317
687 3300003354 JGI25160J50197_1005351 JGI25160J50197_10053512 317
688 3300003374 JGI25161J50226_1001166 JGI25161J50226_10011664 317
689 3300003374 JGI25161J50226_1003857 JGI25161J50226_10038572 317
690 3300003761 Ga0055535_1001794 Ga0055535_10017947 317
691 3300003762 Ga0055542_1000004 Ga0055542_1000004303 317
692 3300003771 Ga0055526_1010824 Ga0055526_10108244 317
693 3300003773 Ga0055537_1004186 Ga0055537_10041864 317
694 3300003775 Ga0055524_1008320 Ga0055524_10083203 317
695 3300003781 Ga0055536_1010487 Ga0055536_10104874 317
696 3300003791 Ga0055530_10002962 Ga0055530_100029627 317
697 3300003794 Ga0055531_10015624 Ga0055531_100156244 317
698 3300004625 Ga0055543_1001238 Ga0055543_10012385 317
699 3300005262 Ga0065165_1003020 Ga0065165_10030208 317
700 3300005539 Ga0068853_100030557 Ga0068853_1000305572 317
701 3300013102 Ga0157371_10103219 Ga0157371_101032192 317
702 3300025228 Ga0209672_100961 Ga0209672_10096112 317
703 3300025229 Ga0209147_102289 Ga0209147_1022895 317
704 3300025242 Ga0209258_100022 Ga0209258_100022304 317
705 3300025245 Ga0207425_1000138 Ga0207425_10001385 317
706 3300025245 Ga0207425_1003117 Ga0207425_10031172 317
707 3300025254 Ga0209148_1000034 Ga0209148_1000034304 317
708 3300025258 Ga0209129_1000023 Ga0209129_1000023377 317
709 3300025258 Ga0209129_1002257 Ga0209129_10022579 317
710 3300025258 Ga0209129_1007672 Ga0209129_10076722 317
711 3300025263 Ga0209565_1000649 Ga0209565_10006499 317
712 3300025263 Ga0209565_1014171 Ga0209565_10141712 317
713 3300025273 Ga0209673_1001445 Ga0209673_100144514 317
714 3300025273 Ga0209673_1001448 Ga0209673_10014489 317
715 3300025284 Ga0209130_1000222 Ga0209130_100022258 317
716 3300025284 Ga0209130_1001231 Ga0209130_10012314 317
717 3300025291 Ga0209675_1002241 Ga0209675_10022413 317
718 3300025291 Ga0209675_1002494 Ga0209675_10024947 317
719 3300025291 Ga0209675_1011454 Ga0209675_10114542 317
720 3300025292 Ga0209676_1000005 Ga0209676_1000005420 317
721 3300025292 Ga0209676_1008874 Ga0209676_10088745 317
722 3300025294 Ga0209025_1000476 Ga0209025_100047618 317
723 3300025294 Ga0209025_1016183 Ga0209025_10161834 317
724 3300025294 Ga0209025_1023843 Ga0209025_10238433 317
725 3300025294 Ga0209025_1023882 Ga0209025_10238822 317
726 3300025295 Ga0209564_1000400 Ga0209564_100040014 317
727 3300025295 Ga0209564_1001357 Ga0209564_10013575 317
728 3300025297 Ga0209758_1000064 Ga0209758_1000064278 317
729 3300025297 Ga0209758_1020079 Ga0209758_10200793 317
730 3300025297 Ga0209758_1020110 Ga0209758_10201102 317
731 3300025298 Ga0209050_1000007 Ga0209050_1000007677 317
732 3300025299 Ga0209256_1000038 Ga0209256_1000038286 317
733 3300025299 Ga0209256_1000115 Ga0209256_100011519 317
734 3300025302 Ga0207426_1000001 Ga0207426_10000011285 317
735 3300025302 Ga0207426_1000090 Ga0207426_1000090237 317
736 3300025303 Ga0209051_1000009 Ga0209051_1000009420 317
737 3300025303 Ga0209051_1008125 Ga0209051_10081254 317
738 3300025304 Ga0209257_1000011 Ga0209257_1000011394 317
739 3300025304 Ga0209257_1014189 Ga0209257_10141894 317
740 3300026041 Ga0207639_10004693 Ga0207639_100046936 317
741 3300042012 Ga0439455_0019893 Ga0439455_0019893_259_1275 317
742 3300046460 Ga0495638_0038991 Ga0495638_0038991_943_1956 317
743 3300046513 Ga0495616_0022482 Ga0495616_0022482_1503_2498 317
744 3300046530 Ga0495654_0031657 Ga0495654_0031657_1523_2518 317
745 3300046683 Ga0495658_0056819 Ga0495658_0056819_1132_2127 317
746 3300047321 Ga0495676_0110862 Ga0495676_0110862_912_1907 317
747 3300048089 Ga0495614_0031760 Ga0495614_0031760_20_1015 317
748 3300048919 Ga0496116_0030472 Ga0496116_0030472_1113_2126 317
749 3300048920 Ga0496117_0035438 Ga0496117_0035438_1067_2080 317
750 3300048920 Ga0496117_0037362 Ga0496117_0037362_192_1208 317
751 3300048921 Ga0496118_0041873 Ga0496118_0041873_530_1546 317
752 3300048921 Ga0496118_0056153 Ga0496118_0056153_289_1284 317
753 3300048924 Ga0496121_0118983 Ga0496121_0118983_135_1130 317
754 3300048925 Ga0496122_0101846 Ga0496122_0101846_166_1161 317
755 3300050496 nmdc:mga07m45_169966_c1 nmdc:mga07m45_169966_c1_30_1025 317
756 3300053093 Ga0500651_0000038 Ga0500651_0000038_31586_32581 317
757 3300053110 Ga0500571_000054 Ga0500571_000054_19602_20597 317
758 3300053128 Ga0500626_019208 Ga0500626_019208_1890_2885 317
759 3300053133 Ga0500655_000123 Ga0500655_000123_17050_18045 317
760 3300053134 Ga0500658_0000237 Ga0500658_0000237_21201_22196 317
761 3300053134 Ga0500658_0000266 Ga0500658_0000266_15213_16208 317
762 3300053136 Ga0500559_0008198 Ga0500559_0008198_2040_3035 317
763 3300053138 Ga0500564_024230 Ga0500564_024230_145_1140 317
764 3300053139 Ga0500568_0005096 Ga0500568_0005096_476_1471 317
765 3300053141 Ga0500574_007801 Ga0500574_007801_613_1608 317
766 3300053161 Ga0500634_0048318 Ga0500634_0048318_528_1523 317
767 iso_pu_bacteria 2599185214 2599624723 317
768 iso_pu_bacteria 2599185226 2599672415 317
769 iso_pu_bacteria 2599185227 2599685003 317
770 iso_pu_bacteria 2599185229 2599694024 317
771 iso_pu_bacteria 2643221658 2644329405 317
772 iso_pu_bacteria 2818991446 2819596101 317
773 iso_pu_bacteria 2928070936 2928076151 317

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

104

377

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9398 37 315
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9328 36 313
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9216 36 315
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.9014 36 315
6hke-assembly1.cif.gz_A matc (rpa3494) from rhodopseudomonas palustris with bound malate 0.8927 36 307
ID Description Score Start End Superfamily
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9043 36 315 3.40.190.150
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.903 36 315 3.40.190.150
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.8878 36 315 3.40.190.150
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.8845 36 315 3.40.190.150
4x9tA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.8837 36 309 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A3G8H9M1-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9447 38 315
AF-A0A5C8CF86-F1-model_v4 deleted 0.9419 44 315
AF-A0A520EAY2-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9382 37 315
AF-A0A537DML3-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9382 42 315
AF-V8QW12-F1-model_v4 ABC transporter substrate-binding protein 0.9368 41 315

Feature Viewer

pLDDT pTM Quality
88.97 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map