F480201
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 773 | 441 | 1544 | 394 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2643221583|2643924190 |
| Length | 455 |
| Sequence | KFERNKPHCNIGTIGHVDHGKTTLTAAITITLAKSGGGKAMNYADIDAAPEEKARGITINTAHVEYETAARHYAHXIGHVDHGKTTLTAAITITLAKSGGGKAMNYADIDAAPEEKARGITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPALVVYMNKVDLVDDEELLELVEMEVRELLSSYDFPGDDIPITKGSAKVAIDGGNPTIGEESVLALMQTVDDYIPQPARPLDLPFLMPVEDVFSISGRGTVVTGRIEKGIVKVGEEVEIVGIRPVQKTTCTGVEMFRKLLDQGQAGDNVGVLLRGTKREDVERGQVLCKPGSITPHTKFVAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIIKLREGVEMIMPGDNAELDVELITPIAMDQGLRFAIREGGRTVGAGVVAKIVE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 10 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 57 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 58 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 59 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 60 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 65 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 71 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 93 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 94 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 95 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 98 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 154 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 159 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 160 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 161 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 162 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 163 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 164 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 166 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 167 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 170 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 172 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 173 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 174 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 175 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 176 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 177 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 179 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 180 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 181 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 182 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 183 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 185 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 186 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 187 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 189 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 190 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 191 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 192 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 193 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 194 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 196 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 197 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 201 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 202 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 203 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 205 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 206 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 207 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 209 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 211 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 212 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 213 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 214 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 215 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 216 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 217 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 218 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 219 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 220 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 221 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 222 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 223 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 224 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 225 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 226 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 227 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 228 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 229 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 230 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 231 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 232 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 233 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 234 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 235 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 236 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 237 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 238 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 299 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 300 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 301 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 302 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 303 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 304 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 307 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 308 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 309 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 310 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 311 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 312 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 313 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 314 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 315 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 316 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 317 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 318 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 319 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 320 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 321 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 347 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 348 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 355 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 356 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 357 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 362 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 365 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 368 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 369 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 370 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 371 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 372 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 373 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 374 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 375 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 376 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 377 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 378 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 379 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 380 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 381 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 382 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 383 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 384 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 385 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 386 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 387 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 388 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 389 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 409 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 410 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 411 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 412 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 413 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 414 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 415 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 416 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 417 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 418 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 419 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 420 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 421 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 422 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 423 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 424 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 425 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 426 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 427 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 428 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 429 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 430 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 431 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 432 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 433 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 434 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 435 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 436 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 437 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 438 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 439 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 440 | 646564506 | Arcobacter nitrofigilis DSM 7299 | Isolate | Unclassified |
| 441 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.65 |
| Metatranscriptomes | 4.66 |
| Isolates | 5.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.18 |
| Nodule | 0.91 |
| Rhizoplane | 7.37 |
| Rhizosphere | 75.03 |
| Stem | 0 |
| Stem Tuber | 0.13 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1002379 | 3300000546 | Bacteria | 2281 |
| 2 | JGI24746J21847_1000007 | 3300001977 | Bacteria | 20037 |
| 3 | JGI24740J21852_10004417 | 3300001979 | Bacteria | 6046 |
| 4 | JGI24748J21848_1000332 | 3300002074 | Bacteria | 5454 |
| 5 | JGI24034J26672_10000068 | 3300002239 | Bacteria | 28347 |
| 6 | JGI24742J22300_10000389 | 3300002244 | Bacteria | 6508 |
| 7 | JGI25165J46597_1000961 | 3300003214 | Bacteria | 19619 |
| 8 | JGI25153J46596_10019154 | 3300003215 | Bacteria | 2630 |
| 9 | JGI25407J50210_10000001 | 3300003373 | Bacteria | 28150 |
| 10 | Ga0055537_1003463 | 3300003773 | Bacteria | 4850 |
| 11 | Ga0055537_1005190 | 3300003773 | Bacteria | 3543 |
| 12 | Ga0055534_1011560 | 3300003784 | Bacteria | 1789 |
| 13 | Ga0055534_1015199 | 3300003784 | Bacteria | 1417 |
| 14 | Ga0055531_10005224 | 3300003794 | Bacteria | 7632 |
| 15 | Ga0058863_10019511 | 3300004799 | Bacteria | 1422 |
| 16 | Ga0058862_10006495 | 3300004803 | Bacteria | 1724 |
| 17 | Ga0058862_10084521 | 3300004803 | Bacteria | 2045 |
| 18 | Ga0070683_100002370 | 3300005329 | Bacteria | 14968 |
| 19 | Ga0070683_100293863 | 3300005329 | Bacteria | 1545 |
| 20 | Ga0070670_100003031 | 3300005331 | Bacteria | 13896 |
| 21 | Ga0070677_10000017 | 3300005333 | Bacteria | 52010 |
| 22 | Ga0070666_10059071 | 3300005335 | Bacteria | 2593 |
| 23 | Ga0070666_10079916 | 3300005335 | Bacteria | 2234 |
| 24 | Ga0070680_100083838 | 3300005336 | Bacteria | 2632 |
| 25 | Ga0070682_100000009 | 3300005337 | Bacteria | 291635 |
| 26 | Ga0068868_100003492 | 3300005338 | Bacteria | 10940 |
| 27 | Ga0068868_100112874 | 3300005338 | Bacteria | 2209 |
| 28 | Ga0070668_100041840 | 3300005347 | Bacteria | 3510 |
| 29 | Ga0070669_100109408 | 3300005353 | Bacteria | 2095 |
| 30 | Ga0070671_100001396 | 3300005355 | Bacteria | 18034 |
| 31 | Ga0070674_100000021 | 3300005356 | Bacteria | 87134 |
| 32 | Ga0070674_100000047 | 3300005356 | Bacteria | 52597 |
| 33 | Ga0070659_100000160 | 3300005366 | Bacteria | 51528 |
| 34 | Ga0070659_100041891 | 3300005366 | Bacteria | 3580 |
| 35 | Ga0070667_100033809 | 3300005367 | Bacteria | 4277 |
| 36 | Ga0070667_100129510 | 3300005367 | Bacteria | 2201 |
| 37 | Ga0070713_100061429 | 3300005436 | Bacteria | 3143 |
| 38 | Ga0070710_10000005 | 3300005437 | Bacteria | 238049 |
| 39 | Ga0070711_100001729 | 3300005439 | Bacteria | 12118 |
| 40 | Ga0070711_100124810 | 3300005439 | Bacteria | 1909 |
| 41 | Ga0070705_100004488 | 3300005440 | Bacteria | 6796 |
| 42 | Ga0070663_100079574 | 3300005455 | Bacteria | 2405 |
| 43 | Ga0070662_100000007 | 3300005457 | Bacteria | 168761 |
| 44 | Ga0070681_10035006 | 3300005458 | Bacteria | 5044 |
| 45 | Ga0070679_100067285 | 3300005530 | Bacteria | 3572 |
| 46 | Ga0070684_100016808 | 3300005535 | Bacteria | 5990 |
| 47 | Ga0070693_100001510 | 3300005547 | Bacteria | 10483 |
| 48 | Ga0070693_100103499 | 3300005547 | Bacteria | 1738 |
| 49 | Ga0070665_100000005 | 3300005548 | Bacteria | 734905 |
| 50 | Ga0070665_100000022 | 3300005548 | Bacteria | 379286 |
| 51 | Ga0070665_100044175 | 3300005548 | Bacteria | 4475 |
| 52 | Ga0070665_100049555 | 3300005548 | Bacteria | 4213 |
| 53 | Ga0070665_100052636 | 3300005548 | Bacteria | 4082 |
| 54 | Ga0070704_100012434 | 3300005549 | Bacteria | 5259 |
| 55 | Ga0068855_100099763 | 3300005563 | Bacteria | 3344 |
| 56 | Ga0068855_100390135 | 3300005563 | Bacteria | 1527 |
| 57 | Ga0070664_100173116 | 3300005564 | Bacteria | 1916 |
| 58 | Ga0068856_100069110 | 3300005614 | Bacteria | 3492 |
| 59 | Ga0068856_100328330 | 3300005614 | Bacteria | 1547 |
| 60 | Ga0068852_100007244 | 3300005616 | Bacteria | 8091 |
| 61 | Ga0068859_100009443 | 3300005617 | Bacteria | 9849 |
| 62 | Ga0068859_100009530 | 3300005617 | Bacteria | 9805 |
| 63 | Ga0068859_100044984 | 3300005617 | Bacteria | 4436 |
| 64 | Ga0068859_100165595 | 3300005617 | Bacteria | 2291 |
| 65 | Ga0068859_100217799 | 3300005617 | Bacteria | 1997 |
| 66 | Ga0068859_100314217 | 3300005617 | Bacteria | 1660 |
| 67 | Ga0068864_100016896 | 3300005618 | Bacteria | 6081 |
| 68 | Ga0068866_10000007 | 3300005718 | Bacteria | 121729 |
| 69 | Ga0068866_10000274 | 3300005718 | Bacteria | 24536 |
| 70 | Ga0068863_100008077 | 3300005841 | Bacteria | 10275 |
| 71 | Ga0068863_100195270 | 3300005841 | Bacteria | 1946 |
| 72 | Ga0068858_100000150 | 3300005842 | Bacteria | 73075 |
| 73 | Ga0068858_100117388 | 3300005842 | Bacteria | 2487 |
| 74 | Ga0068860_100039842 | 3300005843 | Bacteria | 4493 |
| 75 | Ga0068862_100062233 | 3300005844 | Bacteria | 3209 |
| 76 | Ga0068862_100066022 | 3300005844 | Bacteria | 3117 |
| 77 | Ga0068862_100071259 | 3300005844 | Bacteria | 3001 |
| 78 | Ga0081455_10035476 | 3300005937 | Bacteria | 4456 |
| 79 | Ga0081538_10004242 | 3300005981 | Bacteria | 13295 |
| 80 | Ga0081540_1037311 | 3300005983 | Bacteria | 2578 |
| 81 | Ga0081540_1073811 | 3300005983 | Bacteria | 1566 |
| 82 | Ga0081539_10003958 | 3300005985 | Bacteria | 17147 |
| 83 | Ga0070717_10000069 | 3300006028 | Bacteria | 86039 |
| 84 | Ga0070717_10024370 | 3300006028 | Bacteria | 4804 |
| 85 | Ga0070717_10157967 | 3300006028 | Bacteria | 1965 |
| 86 | Ga0070717_10161271 | 3300006028 | Bacteria | 1945 |
| 87 | Ga0075365_10054607 | 3300006038 | Bacteria | 2649 |
| 88 | Ga0075368_10005365 | 3300006042 | Bacteria | 4406 |
| 89 | Ga0075363_100093713 | 3300006048 | Bacteria | 1655 |
| 90 | Ga0075364_10143435 | 3300006051 | Bacteria | 1607 |
| 91 | Ga0075432_10000042 | 3300006058 | Bacteria | 24212 |
| 92 | Ga0070715_10000003 | 3300006163 | Bacteria | 345282 |
| 93 | Ga0070712_100000350 | 3300006175 | Bacteria | 26114 |
| 94 | Ga0097621_100216228 | 3300006237 | Bacteria | 1668 |
| 95 | Ga0075370_10111186 | 3300006353 | Bacteria | 1591 |
| 96 | Ga0075430_100036366 | 3300006846 | Bacteria | 4176 |
| 97 | Ga0075430_100205507 | 3300006846 | Bacteria | 1635 |
| 98 | Ga0075431_100154252 | 3300006847 | Bacteria | 2363 |
| 99 | Ga0075433_10001498 | 3300006852 | Bacteria | 17252 |
| 100 | Ga0068865_100007443 | 3300006881 | Bacteria | 6735 |
| 101 | Ga0097620_100009444 | 3300006931 | Bacteria | 9849 |
| 102 | Ga0097620_100009531 | 3300006931 | Bacteria | 9805 |
| 103 | Ga0097620_100044985 | 3300006931 | Bacteria | 4436 |
| 104 | Ga0097620_100165595 | 3300006931 | Bacteria | 2291 |
| 105 | Ga0097620_100217802 | 3300006931 | Bacteria | 1997 |
| 106 | Ga0097620_100314216 | 3300006931 | Bacteria | 1660 |
| 107 | Ga0079104_1011968 | 3300006946 | Bacteria | 2753 |
| 108 | Ga0105251_10074873 | 3300009011 | Bacteria | 1572 |
| 109 | Ga0105240_10006736 | 3300009093 | Bacteria | 16822 |
| 110 | Ga0105240_10011097 | 3300009093 | Bacteria | 12598 |
| 111 | Ga0105240_10122585 | 3300009093 | Bacteria | 3128 |
| 112 | Ga0105245_10000022 | 3300009098 | Bacteria | 181225 |
| 113 | Ga0105247_10000064 | 3300009101 | Bacteria | 123994 |
| 114 | Ga0105247_10029622 | 3300009101 | Bacteria | 3318 |
| 115 | Ga0105248_10088373 | 3300009177 | Bacteria | 3488 |
| 116 | Ga0105248_10090574 | 3300009177 | Bacteria | 3444 |
| 117 | Ga0105237_10000795 | 3300009545 | Bacteria | 43136 |
| 118 | Ga0105238_10000014 | 3300009551 | Bacteria | 241954 |
| 119 | Ga0105238_10269312 | 3300009551 | Bacteria | 1684 |
| 120 | Ga0105249_10018050 | 3300009553 | Bacteria | 6271 |
| 121 | Ga0157372_10091383 | 3300013307 | Bacteria | 3462 |
| 122 | Ga0157375_10000126 | 3300013308 | Bacteria | 75410 |
| 123 | Ga0157375_10008331 | 3300013308 | Bacteria | 9080 |
| 124 | Ga0157375_10173955 | 3300013308 | Bacteria | 2302 |
| 125 | Ga0163163_10098331 | 3300014325 | Bacteria | 2947 |
| 126 | Ga0163163_10181092 | 3300014325 | Bacteria | 2154 |
| 127 | Ga0157380_10000560 | 3300014326 | Bacteria | 22835 |
| 128 | Ga0157380_10038641 | 3300014326 | Bacteria | 3707 |
| 129 | Ga0182008_10007915 | 3300014497 | Bacteria | 5831 |
| 130 | Ga0182008_10027906 | 3300014497 | Bacteria | 2856 |
| 131 | Ga0157379_10026179 | 3300014968 | Bacteria | 5190 |
| 132 | Ga0157379_10061801 | 3300014968 | Bacteria | 3350 |
| 133 | Ga0182007_10032563 | 3300015262 | Bacteria | 1770 |
| 134 | Ga0163161_10000013 | 3300017792 | Bacteria | 258747 |
| 135 | Ga0197907_10106601 | 3300020069 | Bacteria | 2106 |
| 136 | Ga0206356_11626451 | 3300020070 | Bacteria | 3606 |
| 137 | Ga0206349_1658903 | 3300020075 | Bacteria | 2015 |
| 138 | Ga0206352_10123011 | 3300020078 | Bacteria | 1784 |
| 139 | Ga0206350_11565878 | 3300020080 | Bacteria | 2033 |
| 140 | Ga0213872_10018990 | 3300021361 | Bacteria | 3167 |
| 141 | Ga0213876_10001317 | 3300021384 | Bacteria | 15593 |
| 142 | Ga0213876_10016428 | 3300021384 | Bacteria | 3912 |
| 143 | Ga0213875_10000154 | 3300021388 | Bacteria | 72534 |
| 144 | Ga0224712_10028045 | 3300022467 | Bacteria | 2008 |
| 145 | Ga0224712_10029260 | 3300022467 | Bacteria | 1976 |
| 146 | Ga0207427_101449 | 3300025231 | Bacteria | 8554 |
| 147 | Ga0209026_1004620 | 3300025250 | Bacteria | 4012 |
| 148 | Ga0209026_1004741 | 3300025250 | Bacteria | 3916 |
| 149 | Ga0209233_1000293 | 3300025261 | Bacteria | 63470 |
| 150 | Ga0209233_1004407 | 3300025261 | Bacteria | 4791 |
| 151 | Ga0209233_1016401 | 3300025261 | Bacteria | 2041 |
| 152 | Ga0209455_1015467 | 3300025272 | Bacteria | 1675 |
| 153 | Ga0209675_1010141 | 3300025291 | Bacteria | 3246 |
| 154 | Ga0209676_1001296 | 3300025292 | Bacteria | 25682 |
| 155 | Ga0209758_1001435 | 3300025297 | Bacteria | 28157 |
| 156 | Ga0209758_1013790 | 3300025297 | Bacteria | 4369 |
| 157 | Ga0209050_1000161 | 3300025298 | Bacteria | 155713 |
| 158 | Ga0209050_1015450 | 3300025298 | Bacteria | 3206 |
| 159 | Ga0209051_1000877 | 3300025303 | Bacteria | 30359 |
| 160 | Ga0209257_1000252 | 3300025304 | Bacteria | 123718 |
| 161 | Ga0209257_1000409 | 3300025304 | Bacteria | 83301 |
| 162 | Ga0209257_1000552 | 3300025304 | Bacteria | 64315 |
| 163 | Ga0209257_1003348 | 3300025304 | Bacteria | 13870 |
| 164 | Ga0207697_10015765 | 3300025315 | Bacteria | 3118 |
| 165 | Ga0207697_10083476 | 3300025315 | Bacteria | 1348 |
| 166 | Ga0207682_10000008 | 3300025893 | Bacteria | 87020 |
| 167 | Ga0207692_10000003 | 3300025898 | Bacteria | 431531 |
| 168 | Ga0207642_10000008 | 3300025899 | Bacteria | 132651 |
| 169 | Ga0207642_10000979 | 3300025899 | Bacteria | 8909 |
| 170 | Ga0207710_10000220 | 3300025900 | Bacteria | 50023 |
| 171 | Ga0207710_10088046 | 3300025900 | Bacteria | 1450 |
| 172 | Ga0207647_10153064 | 3300025904 | Bacteria | 1347 |
| 173 | Ga0207685_10000003 | 3300025905 | Bacteria | 344527 |
| 174 | Ga0207645_10040174 | 3300025907 | Bacteria | 2996 |
| 175 | Ga0207705_10128982 | 3300025909 | Bacteria | 1881 |
| 176 | Ga0207707_10007402 | 3300025912 | Bacteria | 9561 |
| 177 | Ga0207707_10113656 | 3300025912 | Bacteria | 2366 |
| 178 | Ga0207707_10123548 | 3300025912 | Bacteria | 2263 |
| 179 | Ga0207695_10016319 | 3300025913 | Bacteria | 8695 |
| 180 | Ga0207695_10041220 | 3300025913 | Bacteria | 4942 |
| 181 | Ga0207695_10084973 | 3300025913 | Bacteria | 3194 |
| 182 | Ga0207695_10178435 | 3300025913 | Bacteria | 2046 |
| 183 | Ga0207695_10200353 | 3300025913 | Bacteria | 1911 |
| 184 | Ga0207695_10243997 | 3300025913 | Bacteria | 1697 |
| 185 | Ga0207671_10001074 | 3300025914 | Bacteria | 33173 |
| 186 | Ga0207671_10005921 | 3300025914 | Bacteria | 11087 |
| 187 | Ga0207693_10000138 | 3300025915 | Bacteria | 66126 |
| 188 | Ga0207663_10174851 | 3300025916 | Bacteria | 1528 |
| 189 | Ga0207660_10052069 | 3300025917 | Bacteria | 2913 |
| 190 | Ga0207660_10106414 | 3300025917 | Bacteria | 2103 |
| 191 | Ga0207657_10092245 | 3300025919 | Bacteria | 2525 |
| 192 | Ga0207657_10213381 | 3300025919 | Bacteria | 1548 |
| 193 | Ga0207652_10000242 | 3300025921 | Bacteria | 56966 |
| 194 | Ga0207652_10116411 | 3300025921 | Bacteria | 2374 |
| 195 | Ga0207681_10036263 | 3300025923 | Bacteria | 3252 |
| 196 | Ga0207694_10000008 | 3300025924 | Bacteria | 484902 |
| 197 | Ga0207694_10015447 | 3300025924 | Bacteria | 5758 |
| 198 | Ga0207687_10000039 | 3300025927 | Bacteria | 114303 |
| 199 | Ga0207687_10000132 | 3300025927 | Bacteria | 50024 |
| 200 | Ga0207700_10104123 | 3300025928 | Bacteria | 2270 |
| 201 | Ga0207664_10040931 | 3300025929 | Bacteria | 3607 |
| 202 | Ga0207664_10052171 | 3300025929 | Bacteria | 3233 |
| 203 | Ga0207664_10052775 | 3300025929 | Bacteria | 3216 |
| 204 | Ga0207644_10001581 | 3300025931 | Bacteria | 14708 |
| 205 | Ga0207690_10000165 | 3300025932 | Bacteria | 51537 |
| 206 | Ga0207690_10017348 | 3300025932 | Bacteria | 4393 |
| 207 | Ga0207690_10018062 | 3300025932 | Bacteria | 4320 |
| 208 | Ga0207706_10000018 | 3300025933 | Bacteria | 168729 |
| 209 | Ga0207706_10028676 | 3300025933 | Bacteria | 4969 |
| 210 | Ga0207686_10026568 | 3300025934 | Bacteria | 3379 |
| 211 | Ga0207669_10000032 | 3300025937 | Bacteria | 82757 |
| 212 | Ga0207711_10014493 | 3300025941 | Bacteria | 6551 |
| 213 | Ga0207711_10040773 | 3300025941 | Bacteria | 3951 |
| 214 | Ga0207689_10054979 | 3300025942 | Bacteria | 3277 |
| 215 | Ga0207661_10183741 | 3300025944 | Bacteria | 1828 |
| 216 | Ga0207667_10072768 | 3300025949 | Bacteria | 3572 |
| 217 | Ga0207667_10083431 | 3300025949 | Bacteria | 3309 |
| 218 | Ga0207712_10000067 | 3300025961 | Bacteria | 130079 |
| 219 | Ga0207712_10003883 | 3300025961 | Bacteria | 9443 |
| 220 | Ga0207712_10023398 | 3300025961 | Bacteria | 4076 |
| 221 | Ga0207712_10160793 | 3300025961 | Bacteria | 1745 |
| 222 | Ga0207668_10000053 | 3300025972 | Bacteria | 97131 |
| 223 | Ga0207668_10000363 | 3300025972 | Bacteria | 28976 |
| 224 | Ga0207668_10009658 | 3300025972 | Bacteria | 5792 |
| 225 | Ga0207668_10026971 | 3300025972 | Bacteria | 3737 |
| 226 | Ga0207668_10030190 | 3300025972 | Bacteria | 3560 |
| 227 | Ga0207668_10104670 | 3300025972 | Bacteria | 2110 |
| 228 | Ga0207668_10177067 | 3300025972 | Bacteria | 1678 |
| 229 | Ga0207677_10000046 | 3300026023 | Bacteria | 105382 |
| 230 | Ga0207703_10001133 | 3300026035 | Bacteria | 25156 |
| 231 | Ga0207703_10003008 | 3300026035 | Bacteria | 14283 |
| 232 | Ga0207703_10004569 | 3300026035 | Bacteria | 11349 |
| 233 | Ga0207703_10005760 | 3300026035 | Bacteria | 9928 |
| 234 | Ga0207703_10013988 | 3300026035 | Bacteria | 6256 |
| 235 | Ga0207639_10152110 | 3300026041 | Bacteria | 1939 |
| 236 | Ga0207639_10283391 | 3300026041 | Bacteria | 1458 |
| 237 | Ga0207708_10038392 | 3300026075 | Bacteria | 3648 |
| 238 | Ga0207702_10046770 | 3300026078 | Bacteria | 3644 |
| 239 | Ga0207702_10113611 | 3300026078 | Bacteria | 2412 |
| 240 | Ga0207641_10003614 | 3300026088 | Bacteria | 13647 |
| 241 | Ga0207641_10006154 | 3300026088 | Bacteria | 10154 |
| 242 | Ga0207641_10013745 | 3300026088 | Bacteria | 6640 |
| 243 | Ga0207641_10255831 | 3300026088 | Bacteria | 1637 |
| 244 | Ga0207648_10202363 | 3300026089 | Bacteria | 1761 |
| 245 | Ga0207648_10230801 | 3300026089 | Bacteria | 1646 |
| 246 | Ga0207676_10001597 | 3300026095 | Bacteria | 16695 |
| 247 | Ga0207674_10074477 | 3300026116 | Bacteria | 3407 |
| 248 | Ga0207675_100094820 | 3300026118 | Bacteria | 2807 |
| 249 | Ga0207675_100246744 | 3300026118 | Bacteria | 1727 |
| 250 | Ga0207683_10083220 | 3300026121 | Bacteria | 2843 |
| 251 | Ga0207683_10141203 | 3300026121 | Bacteria | 2170 |
| 252 | Ga0207698_10027561 | 3300026142 | Bacteria | 4035 |
| 253 | Ga0209970_1009394 | 3300027614 | Bacteria | 1597 |
| 254 | Ga0209813_10000406 | 3300027866 | Bacteria | 10561 |
| 255 | Ga0209813_10001907 | 3300027866 | Bacteria | 4705 |
| 256 | Ga0207428_10051901 | 3300027907 | Bacteria | 3276 |
| 257 | Ga0265355_1000561 | 3300028036 | Bacteria | 2014 |
| 258 | Ga0268266_10000012 | 3300028379 | Bacteria | 734912 |
| 259 | Ga0268266_10000029 | 3300028379 | Bacteria | 424015 |
| 260 | Ga0268266_10000311 | 3300028379 | Bacteria | 77262 |
| 261 | Ga0268266_10000321 | 3300028379 | Bacteria | 75565 |
| 262 | Ga0268266_10003345 | 3300028379 | Bacteria | 16054 |
| 263 | Ga0268266_10016661 | 3300028379 | Bacteria | 6279 |
| 264 | Ga0268266_10034769 | 3300028379 | Bacteria | 4287 |
| 265 | Ga0268266_10362777 | 3300028379 | Bacteria | 1363 |
| 266 | Ga0268265_10004022 | 3300028380 | Bacteria | 10354 |
| 267 | Ga0268265_10011012 | 3300028380 | Bacteria | 6108 |
| 268 | Ga0268264_10005167 | 3300028381 | Bacteria | 11062 |
| 269 | Ga0268264_10057405 | 3300028381 | Bacteria | 3256 |
| 270 | Ga0268264_10108360 | 3300028381 | Bacteria | 2428 |
| 271 | Ga0268264_10440456 | 3300028381 | Bacteria | 1260 |
| 272 | Ga0265337_1000032 | 3300028556 | Bacteria | 61342 |
| 273 | Ga0265337_1009999 | 3300028556 | Bacteria | 3348 |
| 274 | Ga0265326_10000040 | 3300028558 | Bacteria | 85624 |
| 275 | Ga0265326_10000082 | 3300028558 | Bacteria | 51208 |
| 276 | Ga0265319_1000006 | 3300028563 | Bacteria | 228868 |
| 277 | Ga0265319_1000357 | 3300028563 | Bacteria | 33082 |
| 278 | Ga0265319_1000863 | 3300028563 | Bacteria | 19261 |
| 279 | Ga0265319_1005558 | 3300028563 | Bacteria | 6010 |
| 280 | Ga0265334_10000050 | 3300028573 | Bacteria | 88877 |
| 281 | Ga0265318_10000275 | 3300028577 | Bacteria | 43186 |
| 282 | Ga0265318_10002149 | 3300028577 | Bacteria | 10711 |
| 283 | Ga0265318_10063568 | 3300028577 | Bacteria | 1374 |
| 284 | Ga0265322_10000012 | 3300028654 | Bacteria | 152373 |
| 285 | Ga0265336_10000043 | 3300028666 | Bacteria | 132135 |
| 286 | Ga0265336_10001438 | 3300028666 | Bacteria | 10856 |
| 287 | Ga0307517_10067581 | 3300028786 | Bacteria | 3269 |
| 288 | Ga0307517_10076016 | 3300028786 | Bacteria | 2938 |
| 289 | Ga0307515_10042841 | 3300028794 | Bacteria | 7062 |
| 290 | Ga0265338_10000142 | 3300028800 | Bacteria | 132135 |
| 291 | Ga0265338_10013959 | 3300028800 | Bacteria | 9009 |
| 292 | Ga0265338_10020173 | 3300028800 | Bacteria | 7026 |
| 293 | Ga0265338_10024739 | 3300028800 | Bacteria | 6122 |
| 294 | Ga0265338_10029298 | 3300028800 | Bacteria | 5459 |
| 295 | Ga0265338_10040390 | 3300028800 | Bacteria | 4383 |
| 296 | Ga0265338_10100462 | 3300028800 | Bacteria | 2359 |
| 297 | Ga0265338_10246384 | 3300028800 | Bacteria | 1320 |
| 298 | Ga0265324_10000620 | 3300029957 | Bacteria | 24187 |
| 299 | Ga0265324_10002295 | 3300029957 | Bacteria | 9946 |
| 300 | Ga0307511_10029704 | 3300030521 | Bacteria | 4926 |
| 301 | Ga0265766_1000600 | 3300030863 | Bacteria | 1602 |
| 302 | Ga0265330_10081402 | 3300031235 | Bacteria | 1395 |
| 303 | Ga0265328_10002011 | 3300031239 | Bacteria | 9212 |
| 304 | Ga0265320_10000001 | 3300031240 | Bacteria | 847191 |
| 305 | Ga0265320_10012505 | 3300031240 | Bacteria | 4935 |
| 306 | Ga0265320_10040194 | 3300031240 | Bacteria | 2334 |
| 307 | Ga0265325_10018226 | 3300031241 | Bacteria | 3892 |
| 308 | Ga0265325_10051778 | 3300031241 | Bacteria | 2110 |
| 309 | Ga0265329_10000919 | 3300031242 | Bacteria | 14805 |
| 310 | Ga0265340_10000006 | 3300031247 | Bacteria | 132135 |
| 311 | Ga0265340_10001769 | 3300031247 | Bacteria | 12330 |
| 312 | Ga0265340_10035745 | 3300031247 | Bacteria | 2466 |
| 313 | Ga0265331_10001467 | 3300031250 | Bacteria | 17360 |
| 314 | Ga0265327_10000003 | 3300031251 | Bacteria | 852750 |
| 315 | Ga0265327_10031343 | 3300031251 | Bacteria | 2988 |
| 316 | Ga0265327_10036074 | 3300031251 | Bacteria | 2723 |
| 317 | Ga0265316_10003472 | 3300031344 | Bacteria | 15930 |
| 318 | Ga0265316_10010215 | 3300031344 | Bacteria | 8571 |
| 319 | Ga0265316_10029887 | 3300031344 | Bacteria | 4474 |
| 320 | Ga0265316_10052032 | 3300031344 | Bacteria | 3214 |
| 321 | Ga0265316_10086271 | 3300031344 | Bacteria | 2400 |
| 322 | Ga0265316_10168291 | 3300031344 | Bacteria | 1636 |
| 323 | Ga0307513_10016219 | 3300031456 | Bacteria | 8997 |
| 324 | Ga0307513_10080274 | 3300031456 | Bacteria | 3366 |
| 325 | Ga0307513_10236790 | 3300031456 | Bacteria | 1634 |
| 326 | Ga0307408_100094204 | 3300031548 | Bacteria | 2267 |
| 327 | Ga0265313_10000031 | 3300031595 | Bacteria | 128981 |
| 328 | Ga0265313_10045234 | 3300031595 | Bacteria | 2144 |
| 329 | Ga0265313_10079460 | 3300031595 | Bacteria | 1493 |
| 330 | Ga0265314_10000178 | 3300031711 | Bacteria | 94070 |
| 331 | Ga0265314_10029221 | 3300031711 | Bacteria | 4100 |
| 332 | Ga0265342_10008958 | 3300031712 | Bacteria | 7108 |
| 333 | Ga0316578_10084977 | 3300031728 | Bacteria | 1886 |
| 334 | Ga0307516_10033588 | 3300031730 | Bacteria | 5163 |
| 335 | Ga0307405_10125927 | 3300031731 | Bacteria | 1761 |
| 336 | Ga0307410_10021164 | 3300031852 | Bacteria | 3996 |
| 337 | Ga0307410_10100030 | 3300031852 | Bacteria | 2076 |
| 338 | Ga0307410_10281831 | 3300031852 | Bacteria | 1304 |
| 339 | Ga0307406_10046283 | 3300031901 | Bacteria | 2736 |
| 340 | Ga0307406_10077001 | 3300031901 | Bacteria | 2205 |
| 341 | Ga0307412_10065817 | 3300031911 | Bacteria | 2454 |
| 342 | Ga0307409_100052255 | 3300031995 | Bacteria | 3131 |
| 343 | Ga0307414_10085018 | 3300032004 | Bacteria | 2329 |
| 344 | Ga0307415_100193066 | 3300032126 | Bacteria | 1608 |
| 345 | Ga0316593_10034316 | 3300032168 | Bacteria | 1664 |
| 346 | Ga0307507_10180226 | 3300033179 | Bacteria | 1512 |
| 347 | Ga0307510_10015365 | 3300033180 | Bacteria | 9050 |
| 348 | Ga0307510_10184849 | 3300033180 | Bacteria | 1641 |
| 349 | Ga0316587_1013100 | 3300033529 | Bacteria | 1355 |
| 350 | Ga0316596_1003203 | 3300033541 | Bacteria | 3566 |
| 351 | Ga0373923_0021631 | 3300035111 | Bacteria | 2513 |
| 352 | Ga0373936_0009150 | 3300035113 | Bacteria | 3733 |
| 353 | Ga0373955_0013248 | 3300035172 | Bacteria | 3982 |
| 354 | Ga0373955_0145740 | 3300035172 | Bacteria | 1391 |
| 355 | Ga0316574_0018664 | 3300035398 | Bacteria | 4081 |
| 356 | Ga0316574_0096095 | 3300035398 | Bacteria | 1893 |
| 357 | Ga0373935_0027604 | 3300035692 | Bacteria | 3510 |
| 358 | Ga0373927_0004885 | 3300035695 | Bacteria | 9316 |
| 359 | Ga0373933_0005630 | 3300035724 | Bacteria | 6826 |
| 360 | Ga0373933_0061472 | 3300035724 | Bacteria | 2266 |
| 361 | Ga0373947_0084463 | 3300035725 | Bacteria | 1970 |
| 362 | Ga0373937_0016661 | 3300036401 | Bacteria | 6529 |
| 363 | Ga0373937_0076699 | 3300036401 | Bacteria | 3087 |
| 364 | Ga0373937_0088030 | 3300036401 | Bacteria | 2875 |
| 365 | Ga0316582_0127044 | 3300036647 | Bacteria | 1710 |
| 366 | Ga0373925_0000023 | 3300037068 | Bacteria | 158881 |
| 367 | Ga0395899_0025038 | 3300037312 | Bacteria | 4506 |
| 368 | Ga0395899_0214213 | 3300037312 | Bacteria | 1337 |
| 369 | Ga0395900_0227298 | 3300037418 | Bacteria | 1878 |
| 370 | Ga0395900_0422772 | 3300037418 | Bacteria | 1293 |
| 371 | Ga0395898_0088428 | 3300037466 | Bacteria | 2982 |
| 372 | Ga0395898_0211604 | 3300037466 | Bacteria | 1849 |
| 373 | Ga0395898_0257402 | 3300037466 | Bacteria | 1664 |
| 374 | Ga0395905_0022710 | 3300037471 | Bacteria | 5931 |
| 375 | Ga0395905_0169582 | 3300037471 | Bacteria | 2050 |
| 376 | Ga0436364_0542964 | 3300037853 | Bacteria | 3053 |
| 377 | Ga0436364_0586950 | 3300037853 | Bacteria | 42624 |
| 378 | Ga0395901_0120715 | 3300038443 | Bacteria | 2754 |
| 379 | Ga0395901_0135008 | 3300038443 | Bacteria | 2593 |
| 380 | Ga0395901_0165610 | 3300038443 | Bacteria | 2321 |
| 381 | Ga0400486_00962 | 3300038742 | Bacteria | 3359 |
| 382 | Ga0436365_0319180 | 3300039437 | Bacteria | 20648 |
| 383 | Ga0436365_1318630 | 3300039437 | Bacteria | 2263 |
| 384 | Ga0436361_0413994 | 3300039447 | Bacteria | 12077 |
| 385 | Ga0436362_0179942 | 3300039453 | Bacteria | 1466 |
| 386 | Ga0439431_0013009 | 3300041997 | Bacteria | 1917 |
| 387 | Ga0439457_011885 | 3300042014 | Bacteria | 1968 |
| 388 | Ga0439434_0017551 | 3300042435 | Bacteria | 2141 |
| 389 | Ga0439435_0002970 | 3300042436 | Bacteria | 3454 |
| 390 | Ga0450901_001704 | 3300042533 | Bacteria | 2476 |
| 391 | Ga0451577_0347129 | 3300042876 | Bacteria | 1346 |
| 392 | Ga0466969_0001105 | 3300044656 | Bacteria | 14550 |
| 393 | Ga0466966_0003817 | 3300044684 | Bacteria | 9943 |
| 394 | Ga0466961_0000659 | 3300044693 | Bacteria | 21720 |
| 395 | Ga0466961_0058761 | 3300044693 | Bacteria | 2446 |
| 396 | Ga0466961_0071708 | 3300044693 | Bacteria | 2198 |
| 397 | Ga0466963_0000325 | 3300044694 | Bacteria | 21618 |
| 398 | Ga0466963_0087179 | 3300044694 | Bacteria | 2122 |
| 399 | Ga0466971_0037640 | 3300044719 | Bacteria | 2169 |
| 400 | Ga0466970_0042626 | 3300044765 | Bacteria | 2414 |
| 401 | Ga0466970_0050555 | 3300044765 | Bacteria | 2217 |
| 402 | Ga0466957_0016259 | 3300044842 | Bacteria | 4351 |
| 403 | Ga0466957_0162610 | 3300044842 | Bacteria | 1450 |
| 404 | Ga0466960_0001761 | 3300044901 | Bacteria | 7943 |
| 405 | Ga0466959_0022573 | 3300045049 | Bacteria | 4653 |
| 406 | Ga0466959_0078843 | 3300045049 | Bacteria | 2375 |
| 407 | Ga0451576_0000023 | 3300045051 | Bacteria | 477965 |
| 408 | Ga0451576_0000063 | 3300045051 | Bacteria | 278985 |
| 409 | Ga0451576_0027584 | 3300045051 | Bacteria | 6097 |
| 410 | Ga0451576_0039758 | 3300045051 | Bacteria | 4979 |
| 411 | Ga0466958_0047302 | 3300045836 | Bacteria | 2597 |
| 412 | Ga0466967_0023322 | 3300045976 | Bacteria | 5068 |
| 413 | Ga0495627_001425 | 3300046453 | Bacteria | 14069 |
| 414 | Ga0495592_0180516 | 3300046454 | Bacteria | 1438 |
| 415 | Ga0495603_0000323 | 3300046455 | Bacteria | 25798 |
| 416 | Ga0495603_0000641 | 3300046455 | Bacteria | 19699 |
| 417 | Ga0495603_0058507 | 3300046455 | Bacteria | 2279 |
| 418 | Ga0495590_0001017 | 3300046457 | Bacteria | 12347 |
| 419 | Ga0495638_0013903 | 3300046460 | Bacteria | 5459 |
| 420 | Ga0495641_0000400 | 3300046461 | Bacteria | 36235 |
| 421 | Ga0495641_0029068 | 3300046461 | Bacteria | 2667 |
| 422 | Ga0495641_0042340 | 3300046461 | Bacteria | 2111 |
| 423 | Ga0495653_0004713 | 3300046463 | Bacteria | 11039 |
| 424 | Ga0495653_0014903 | 3300046463 | Bacteria | 6341 |
| 425 | Ga0495653_0046609 | 3300046463 | Bacteria | 3356 |
| 426 | Ga0495653_0077384 | 3300046463 | Bacteria | 2470 |
| 427 | Ga0495650_0000121 | 3300046471 | Bacteria | 183055 |
| 428 | Ga0495582_0000006 | 3300046473 | Bacteria | 140434 |
| 429 | Ga0495662_0000236 | 3300046476 | Bacteria | 23206 |
| 430 | Ga0495664_0000007 | 3300046477 | Bacteria | 386710 |
| 431 | Ga0495607_0124900 | 3300046501 | Bacteria | 1346 |
| 432 | Ga0495583_0021508 | 3300046506 | Bacteria | 3317 |
| 433 | Ga0495608_0022894 | 3300046511 | Bacteria | 4286 |
| 434 | Ga0495610_0000924 | 3300046512 | Bacteria | 27260 |
| 435 | Ga0495618_0000035 | 3300046514 | Bacteria | 102739 |
| 436 | Ga0495618_0000037 | 3300046514 | Bacteria | 99735 |
| 437 | Ga0495620_0000668 | 3300046515 | Bacteria | 21158 |
| 438 | Ga0495620_0036764 | 3300046515 | Bacteria | 2187 |
| 439 | Ga0495630_0012465 | 3300046517 | Bacteria | 6173 |
| 440 | Ga0495630_0102334 | 3300046517 | Bacteria | 2167 |
| 441 | Ga0495637_0017338 | 3300046520 | Bacteria | 3357 |
| 442 | Ga0495648_0001203 | 3300046524 | Bacteria | 25919 |
| 443 | Ga0495642_0022905 | 3300046528 | Bacteria | 2463 |
| 444 | Ga0495652_0049476 | 3300046529 | Bacteria | 3598 |
| 445 | Ga0495640_0025030 | 3300046533 | Bacteria | 4335 |
| 446 | Ga0495621_0004561 | 3300046539 | Bacteria | 3909 |
| 447 | Ga0495597_0005196 | 3300046542 | Bacteria | 6928 |
| 448 | Ga0495645_0000033 | 3300046543 | Bacteria | 105930 |
| 449 | Ga0495645_0000159 | 3300046543 | Bacteria | 46648 |
| 450 | Ga0495645_0167715 | 3300046543 | Bacteria | 1513 |
| 451 | Ga0495633_0005367 | 3300046558 | Bacteria | 7861 |
| 452 | Ga0495667_0000067 | 3300046559 | Bacteria | 81751 |
| 453 | Ga0495667_0004534 | 3300046559 | Bacteria | 9376 |
| 454 | Ga0495656_0000412 | 3300046615 | Bacteria | 14129 |
| 455 | Ga0495656_0079938 | 3300046615 | Bacteria | 1473 |
| 456 | Ga0495668_0005284 | 3300046616 | Bacteria | 8830 |
| 457 | Ga0495611_0026790 | 3300046648 | Bacteria | 2516 |
| 458 | Ga0495625_0131776 | 3300046660 | Bacteria | 1693 |
| 459 | Ga0495635_0000006 | 3300046663 | Bacteria | 301820 |
| 460 | Ga0495588_0037138 | 3300046674 | Bacteria | 2474 |
| 461 | Ga0495657_0000027 | 3300046675 | Bacteria | 131421 |
| 462 | Ga0495657_0001760 | 3300046675 | Bacteria | 18520 |
| 463 | Ga0495657_0050118 | 3300046675 | Bacteria | 2808 |
| 464 | Ga0495599_0014944 | 3300046678 | Bacteria | 4811 |
| 465 | Ga0495623_0031396 | 3300046679 | Bacteria | 3415 |
| 466 | Ga0495647_0000010 | 3300046681 | Bacteria | 94696 |
| 467 | Ga0495658_0000094 | 3300046683 | Bacteria | 46061 |
| 468 | Ga0495658_0104120 | 3300046683 | Bacteria | 1698 |
| 469 | Ga0495669_0000371 | 3300046684 | Bacteria | 22866 |
| 470 | Ga0495669_0001857 | 3300046684 | Bacteria | 8658 |
| 471 | Ga0495613_0000947 | 3300046689 | Bacteria | 22179 |
| 472 | Ga0495613_0035802 | 3300046689 | Bacteria | 3682 |
| 473 | Ga0495624_0000767 | 3300046690 | Bacteria | 25280 |
| 474 | Ga0495670_0001585 | 3300046691 | Bacteria | 11108 |
| 475 | Ga0495671_0094827 | 3300046692 | Bacteria | 1460 |
| 476 | Ga0495649_0004615 | 3300046694 | Bacteria | 8960 |
| 477 | Ga0495600_0016896 | 3300046809 | Bacteria | 4639 |
| 478 | Ga0495600_0041791 | 3300046809 | Bacteria | 2988 |
| 479 | Ga0495600_0091954 | 3300046809 | Bacteria | 1979 |
| 480 | Ga0495660_0019866 | 3300046810 | Bacteria | 3854 |
| 481 | Ga0495604_0000218 | 3300047317 | Bacteria | 52385 |
| 482 | Ga0495604_0036561 | 3300047317 | Bacteria | 3871 |
| 483 | Ga0495672_0001458 | 3300047320 | Bacteria | 23198 |
| 484 | Ga0495676_0001315 | 3300047321 | Bacteria | 21280 |
| 485 | Ga0495680_0001684 | 3300047322 | Bacteria | 23470 |
| 486 | Ga0495680_0001951 | 3300047322 | Bacteria | 21721 |
| 487 | Ga0495680_0028739 | 3300047322 | Bacteria | 4557 |
| 488 | Ga0495687_020629 | 3300047443 | Bacteria | 3208 |
| 489 | Ga0495677_0011211 | 3300047445 | Bacteria | 3281 |
| 490 | Ga0495677_0021265 | 3300047445 | Bacteria | 2351 |
| 491 | Ga0495679_005798 | 3300047446 | Bacteria | 5435 |
| 492 | Ga0495673_0002746 | 3300047469 | Bacteria | 12052 |
| 493 | Ga0495673_0007304 | 3300047469 | Bacteria | 6373 |
| 494 | Ga0495681_0055771 | 3300047470 | Bacteria | 1841 |
| 495 | Ga0495684_0001725 | 3300047471 | Bacteria | 17594 |
| 496 | Ga0495684_0055386 | 3300047471 | Bacteria | 3024 |
| 497 | Ga0495593_0059744 | 3300047673 | Bacteria | 1997 |
| 498 | Ga0496100_0000004 | 3300048903 | Bacteria | 321778 |
| 499 | Ga0496101_0000007 | 3300048904 | Bacteria | 321778 |
| 500 | Ga0496101_0008458 | 3300048904 | Bacteria | 6723 |
| 501 | Ga0496101_0099463 | 3300048904 | Bacteria | 2174 |
| 502 | Ga0496101_0130560 | 3300048904 | Bacteria | 1908 |
| 503 | Ga0496102_0000002 | 3300048905 | Bacteria | 814588 |
| 504 | Ga0496103_0000017 | 3300048906 | Bacteria | 244768 |
| 505 | Ga0496104_0000001 | 3300048907 | Bacteria | 711867 |
| 506 | Ga0496104_0000008 | 3300048907 | Bacteria | 516976 |
| 507 | Ga0496104_0000307 | 3300048907 | Bacteria | 43626 |
| 508 | Ga0496104_0033810 | 3300048907 | Bacteria | 4765 |
| 509 | Ga0496104_0298145 | 3300048907 | Bacteria | 1524 |
| 510 | Ga0496105_0000003 | 3300048908 | Bacteria | 713251 |
| 511 | Ga0496105_0000070 | 3300048908 | Bacteria | 80117 |
| 512 | Ga0496105_0217838 | 3300048908 | Bacteria | 1554 |
| 513 | Ga0496106_0000004 | 3300048909 | Bacteria | 279896 |
| 514 | Ga0496106_0004033 | 3300048909 | Bacteria | 10970 |
| 515 | Ga0496106_0093786 | 3300048909 | Bacteria | 2320 |
| 516 | Ga0496106_0193822 | 3300048909 | Bacteria | 1616 |
| 517 | Ga0496107_0000001 | 3300048910 | Bacteria | 321778 |
| 518 | Ga0496107_0001409 | 3300048910 | Bacteria | 14833 |
| 519 | Ga0496107_0142562 | 3300048910 | Bacteria | 1771 |
| 520 | Ga0496107_0229461 | 3300048910 | Bacteria | 1381 |
| 521 | Ga0496108_0000004 | 3300048911 | Bacteria | 545055 |
| 522 | Ga0496108_0036957 | 3300048911 | Bacteria | 4065 |
| 523 | Ga0496108_0045232 | 3300048911 | Bacteria | 3676 |
| 524 | Ga0496108_0054744 | 3300048911 | Bacteria | 3348 |
| 525 | Ga0496108_0196490 | 3300048911 | Bacteria | 1749 |
| 526 | Ga0496109_0000036 | 3300048912 | Bacteria | 153972 |
| 527 | Ga0496109_0000550 | 3300048912 | Bacteria | 31748 |
| 528 | Ga0496109_0002231 | 3300048912 | Bacteria | 16078 |
| 529 | Ga0496109_0004801 | 3300048912 | Bacteria | 11284 |
| 530 | Ga0496109_0023777 | 3300048912 | Bacteria | 5439 |
| 531 | Ga0496109_0167197 | 3300048912 | Bacteria | 2062 |
| 532 | Ga0496110_0000152 | 3300048913 | Bacteria | 41561 |
| 533 | Ga0496110_0013101 | 3300048913 | Bacteria | 6844 |
| 534 | Ga0496110_0032992 | 3300048913 | Bacteria | 4476 |
| 535 | Ga0496110_0053927 | 3300048913 | Bacteria | 3536 |
| 536 | Ga0496110_0123328 | 3300048913 | Bacteria | 2336 |
| 537 | Ga0496111_0000123 | 3300048914 | Bacteria | 33765 |
| 538 | Ga0496111_0112895 | 3300048914 | Bacteria | 2002 |
| 539 | Ga0496112_0000002 | 3300048915 | Bacteria | 782039 |
| 540 | Ga0496112_0001057 | 3300048915 | Bacteria | 20325 |
| 541 | Ga0496112_0001810 | 3300048915 | Bacteria | 16828 |
| 542 | Ga0496112_0018998 | 3300048915 | Bacteria | 6477 |
| 543 | Ga0496112_0020121 | 3300048915 | Bacteria | 6318 |
| 544 | Ga0496113_0029106 | 3300048916 | Bacteria | 3984 |
| 545 | Ga0496113_0079171 | 3300048916 | Bacteria | 2515 |
| 546 | Ga0496114_0000097 | 3300048917 | Bacteria | 63410 |
| 547 | Ga0496114_0003529 | 3300048917 | Bacteria | 12000 |
| 548 | Ga0496115_0000005 | 3300048918 | Bacteria | 290756 |
| 549 | Ga0496115_0000151 | 3300048918 | Bacteria | 64493 |
| 550 | Ga0496115_0020265 | 3300048918 | Bacteria | 5128 |
| 551 | Ga0496115_0055983 | 3300048918 | Bacteria | 3169 |
| 552 | Ga0496115_0059763 | 3300048918 | Bacteria | 3070 |
| 553 | Ga0496115_0140761 | 3300048918 | Bacteria | 1990 |
| 554 | Ga0496115_0288564 | 3300048918 | Bacteria | 1346 |
| 555 | Ga0496116_0052644 | 3300048919 | Bacteria | 2695 |
| 556 | Ga0496117_0010944 | 3300048920 | Bacteria | 8176 |
| 557 | Ga0496118_0006934 | 3300048921 | Bacteria | 12251 |
| 558 | Ga0496119_0019080 | 3300048922 | Bacteria | 5070 |
| 559 | Ga0496121_0000485 | 3300048924 | Bacteria | 76992 |
| 560 | Ga0496121_0000946 | 3300048924 | Bacteria | 52586 |
| 561 | Ga0496121_0027878 | 3300048924 | Bacteria | 5274 |
| 562 | Ga0496123_0001481 | 3300048926 | Bacteria | 32597 |
| 563 | Ga0496124_0040664 | 3300048927 | Bacteria | 4020 |
| 564 | Ga0496125_0000815 | 3300048928 | Bacteria | 50702 |
| 565 | Ga0496125_0090667 | 3300048928 | Bacteria | 2293 |
| 566 | Ga0496125_0190625 | 3300048928 | Bacteria | 1354 |
| 567 | Ga0496126_0183070 | 3300048929 | Bacteria | 1778 |
| 568 | Ga0501311_002271 | 3300049527 | Bacteria | 1817 |
| 569 | Ga0501314_000335 | 3300049530 | Bacteria | 2808 |
| 570 | Ga0501031_0009868 | 3300049568 | Bacteria | 6215 |
| 571 | Ga0501031_0027816 | 3300049568 | Bacteria | 3686 |
| 572 | Ga0501032_0001419 | 3300049569 | Bacteria | 19025 |
| 573 | Ga0501032_0067379 | 3300049569 | Bacteria | 2391 |
| 574 | Ga0501033_0004084 | 3300049570 | Bacteria | 11779 |
| 575 | Ga0501033_0218198 | 3300049570 | Bacteria | 1358 |
| 576 | Ga0501034_0004173 | 3300049571 | Bacteria | 16144 |
| 577 | Ga0501034_0118404 | 3300049571 | Bacteria | 2635 |
| 578 | Ga0501034_0128649 | 3300049571 | Bacteria | 2516 |
| 579 | Ga0501034_0157828 | 3300049571 | Bacteria | 2241 |
| 580 | Ga0501034_0165468 | 3300049571 | Bacteria | 2180 |
| 581 | Ga0501034_0187645 | 3300049571 | Bacteria | 2030 |
| 582 | Ga0501034_0254468 | 3300049571 | Bacteria | 1700 |
| 583 | Ga0501036_0014888 | 3300049572 | Bacteria | 6489 |
| 584 | Ga0501036_0020928 | 3300049572 | Bacteria | 5493 |
| 585 | Ga0501036_0076823 | 3300049572 | Bacteria | 2825 |
| 586 | Ga0501036_0085139 | 3300049572 | Bacteria | 2672 |
| 587 | Ga0501037_0001774 | 3300049573 | Bacteria | 15668 |
| 588 | Ga0501038_0029168 | 3300049574 | Bacteria | 4892 |
| 589 | Ga0501038_0107566 | 3300049574 | Bacteria | 2313 |
| 590 | Ga0501039_0009138 | 3300049575 | Bacteria | 7550 |
| 591 | Ga0501039_0108356 | 3300049575 | Bacteria | 2171 |
| 592 | Ga0501040_0200740 | 3300049576 | Bacteria | 1416 |
| 593 | Ga0501040_0264088 | 3300049576 | Bacteria | 1228 |
| 594 | Ga0501042_0004502 | 3300049578 | Bacteria | 8892 |
| 595 | Ga0501042_0008906 | 3300049578 | Bacteria | 6657 |
| 596 | Ga0501042_0099949 | 3300049578 | Bacteria | 2085 |
| 597 | Ga0501042_0130740 | 3300049578 | Bacteria | 1809 |
| 598 | Ga0501042_0259000 | 3300049578 | Bacteria | 1256 |
| 599 | Ga0501043_0017287 | 3300049579 | Bacteria | 5657 |
| 600 | Ga0501043_0109183 | 3300049579 | Bacteria | 2173 |
| 601 | Ga0501046_0014582 | 3300049580 | Bacteria | 6623 |
| 602 | Ga0501046_0192802 | 3300049580 | Bacteria | 1519 |
| 603 | Ga0501047_0014422 | 3300049581 | Bacteria | 7514 |
| 604 | Ga0501047_0021902 | 3300049581 | Bacteria | 6136 |
| 605 | Ga0501047_0023718 | 3300049581 | Bacteria | 5890 |
| 606 | Ga0501047_0084394 | 3300049581 | Bacteria | 3052 |
| 607 | Ga0501047_0144623 | 3300049581 | Bacteria | 2255 |
| 608 | Ga0501047_0177307 | 3300049581 | Bacteria | 1998 |
| 609 | Ga0501047_0195623 | 3300049581 | Bacteria | 1884 |
| 610 | Ga0501048_0006374 | 3300049582 | Bacteria | 8968 |
| 611 | Ga0501048_0040346 | 3300049582 | Bacteria | 3346 |
| 612 | Ga0501048_0081658 | 3300049582 | Bacteria | 2280 |
| 613 | Ga0501067_0009878 | 3300049583 | Bacteria | 5284 |
| 614 | Ga0501067_0036584 | 3300049583 | Bacteria | 2725 |
| 615 | Ga0501067_0050205 | 3300049583 | Bacteria | 2312 |
| 616 | Ga0501068_0011636 | 3300049584 | Bacteria | 4971 |
| 617 | Ga0501068_0066433 | 3300049584 | Bacteria | 2196 |
| 618 | Ga0501069_0001887 | 3300049585 | Bacteria | 10466 |
| 619 | Ga0501069_0004122 | 3300049585 | Bacteria | 7502 |
| 620 | Ga0501070_0012789 | 3300049586 | Bacteria | 7074 |
| 621 | Ga0501070_0119182 | 3300049586 | Bacteria | 2181 |
| 622 | Ga0501070_0136837 | 3300049586 | Bacteria | 2022 |
| 623 | Ga0501071_0050472 | 3300049587 | Bacteria | 2997 |
| 624 | Ga0501071_0096370 | 3300049587 | Bacteria | 2177 |
| 625 | Ga0501071_0180049 | 3300049587 | Bacteria | 1583 |
| 626 | Ga0501071_0240661 | 3300049587 | Bacteria | 1364 |
| 627 | Ga0501072_0016795 | 3300049588 | Bacteria | 5621 |
| 628 | Ga0501072_0124884 | 3300049588 | Bacteria | 2050 |
| 629 | Ga0501072_0222472 | 3300049588 | Bacteria | 1504 |
| 630 | Ga0501073_0005503 | 3300049589 | Bacteria | 9487 |
| 631 | Ga0501073_0014497 | 3300049589 | Bacteria | 5727 |
| 632 | Ga0501073_0018783 | 3300049589 | Bacteria | 4997 |
| 633 | Ga0501073_0243105 | 3300049589 | Bacteria | 1243 |
| 634 | Ga0501074_0021775 | 3300049590 | Bacteria | 4653 |
| 635 | Ga0501074_0050003 | 3300049590 | Bacteria | 3017 |
| 636 | Ga0501074_0054280 | 3300049590 | Bacteria | 2890 |
| 637 | Ga0501075_0006663 | 3300049591 | Bacteria | 7962 |
| 638 | Ga0501238_000151 | 3300049671 | Bacteria | 10786 |
| 639 | Ga0501257_000588 | 3300049686 | Bacteria | 7187 |
| 640 | Ga0501080_0010572 | 3300049742 | Bacteria | 8449 |
| 641 | Ga0501080_0035304 | 3300049742 | Bacteria | 4666 |
| 642 | Ga0501081_0118209 | 3300049743 | Bacteria | 1886 |
| 643 | Ga0501083_0059882 | 3300049744 | Bacteria | 2546 |
| 644 | Ga0501083_0184562 | 3300049744 | Bacteria | 1361 |
| 645 | Ga0501035_0004680 | 3300049822 | Bacteria | 12986 |
| 646 | Ga0501035_0166314 | 3300049822 | Bacteria | 1907 |
| 647 | Ga0501044_0041168 | 3300049823 | Bacteria | 4810 |
| 648 | Ga0501044_0046900 | 3300049823 | Bacteria | 4471 |
| 649 | Ga0501044_0115439 | 3300049823 | Bacteria | 2690 |
| 650 | Ga0501044_0204239 | 3300049823 | Bacteria | 1933 |
| 651 | Ga0501045_0064286 | 3300049824 | Bacteria | 2693 |
| 652 | nmdc:mga03n38_29987_c1 | 3300050490 | Bacteria | 2283 |
| 653 | nmdc:mga03n38_57892_c1 | 3300050490 | Bacteria | 1754 |
| 654 | nmdc:mga06z11_11573_c1 | 3300050494 | Bacteria | 3810 |
| 655 | nmdc:mga04h51_2557_c1 | 3300050495 | Bacteria | 4330 |
| 656 | nmdc:mga0qj67_70565_c1 | 3300050509 | Bacteria | 2787 |
| 657 | nmdc:mga06r32_278056_c1 | 3300050510 | Bacteria | 1661 |
| 658 | nmdc:mga08y16_3153_c1 | 3300050511 | Bacteria | 17078 |
| 659 | nmdc:mga0a205_15_c2 | 3300050515 | Bacteria | 75060 |
| 660 | nmdc:mga0a205_253389_c1 | 3300050515 | Bacteria | 1639 |
| 661 | nmdc:mga0sz30_8411_c1 | 3300050516 | Bacteria | 3897 |
| 662 | Ga0495601_0061038 | 3300053077 | Bacteria | 2393 |
| 663 | Ga0495612_0000369 | 3300053078 | Bacteria | 18070 |
| 664 | Ga0495612_0002269 | 3300053078 | Bacteria | 7914 |
| 665 | Ga0500635_0000151 | 3300053080 | Bacteria | 38898 |
| 666 | Ga0495595_0002820 | 3300053084 | Bacteria | 6837 |
| 667 | Ga0495619_0000036 | 3300053085 | Bacteria | 125188 |
| 668 | Ga0495619_0005952 | 3300053085 | Bacteria | 7725 |
| 669 | Ga0495619_0077095 | 3300053085 | Bacteria | 2238 |
| 670 | Ga0500578_0002408 | 3300053086 | Bacteria | 15729 |
| 671 | Ga0500578_0071208 | 3300053086 | Bacteria | 2216 |
| 672 | Ga0500643_034824 | 3300053087 | Bacteria | 1514 |
| 673 | Ga0500644_0004248 | 3300053088 | Bacteria | 3579 |
| 674 | Ga0500566_0047254 | 3300053094 | Bacteria | 2471 |
| 675 | Ga0500641_0000563 | 3300053096 | Bacteria | 13434 |
| 676 | Ga0500641_0021040 | 3300053096 | Bacteria | 2481 |
| 677 | Ga0500555_003161 | 3300053103 | Bacteria | 4693 |
| 678 | Ga0500555_027784 | 3300053103 | Bacteria | 1613 |
| 679 | Ga0500556_0000849 | 3300053104 | Bacteria | 17422 |
| 680 | Ga0500556_0013092 | 3300053104 | Bacteria | 2498 |
| 681 | Ga0500562_004351 | 3300053108 | Bacteria | 3585 |
| 682 | Ga0500562_015604 | 3300053108 | Bacteria | 1949 |
| 683 | Ga0500569_001151 | 3300053109 | Bacteria | 4877 |
| 684 | Ga0500594_0000315 | 3300053118 | Bacteria | 10818 |
| 685 | Ga0500608_000165 | 3300053122 | Bacteria | 27378 |
| 686 | Ga0500608_000752 | 3300053122 | Bacteria | 11826 |
| 687 | Ga0500608_010288 | 3300053122 | Bacteria | 4010 |
| 688 | Ga0500614_001566 | 3300053123 | Bacteria | 5413 |
| 689 | Ga0500658_0082928 | 3300053134 | Bacteria | 1374 |
| 690 | Ga0500564_000306 | 3300053138 | Bacteria | 13745 |
| 691 | Ga0500568_0069987 | 3300053139 | Bacteria | 1344 |
| 692 | Ga0500616_0000008 | 3300053153 | Bacteria | 785239 |
| 693 | Ga0500616_0006301 | 3300053153 | Bacteria | 7797 |
| 694 | Ga0500616_0006551 | 3300053153 | Bacteria | 7601 |
| 695 | Ga0500622_0003641 | 3300053156 | Bacteria | 10132 |
| 696 | Ga0500622_0008207 | 3300053156 | Bacteria | 5864 |
| 697 | Ga0500622_0064052 | 3300053156 | Bacteria | 1870 |
| 698 | Ga0500624_001098 | 3300053157 | Bacteria | 5109 |
| 699 | Ga0500634_0000031 | 3300053161 | Bacteria | 75547 |
| 700 | Ga0500638_049699 | 3300053162 | Bacteria | 2028 |
| 701 | Ga0500639_067780 | 3300053163 | Bacteria | 1825 |
| 702 | Ga0500645_000199 | 3300053730 | Bacteria | 46484 |
| 703 | Ga0500645_003346 | 3300053730 | Bacteria | 6570 |
| 704 | Ga0501084_0030403 | 3300054114 | Bacteria | 4516 |
| 705 | Ga0501084_0116876 | 3300054114 | Bacteria | 2242 |
| 706 | Ga0587093_001189 | 3300059478 | Bacteria | 2125 |
| 707 | Ga0587070_001606 | 3300059491 | Bacteria | 2378 |
| 708 | Ga0587070_002325 | 3300059491 | Bacteria | 2139 |
| 709 | Ga0587070_004991 | 3300059491 | Bacteria | 1714 |
| 710 | Ga0587077_000881 | 3300059493 | Bacteria | 2953 |
| 711 | Ga0587080_001568 | 3300059503 | Bacteria | 2513 |
| 712 | Ga0587083_0002187 | 3300059505 | Bacteria | 2388 |
| 713 | Ga0587085_002368 | 3300059506 | Bacteria | 1911 |
| 714 | Ga0587088_002143 | 3300059508 | Bacteria | 2191 |
| 715 | Ga0587092_003651 | 3300059512 | Bacteria | 1769 |
| 716 | Ga0587094_001362 | 3300059513 | Bacteria | 2286 |
| 717 | Ga0587095_000405 | 3300059514 | Bacteria | 2180 |
| 718 | Ga0587099_001045 | 3300059622 | Bacteria | 1871 |
| 719 | Ga0587101_001895 | 3300059623 | Bacteria | 1898 |
| 720 | Ga0587117_000969 | 3300059627 | Bacteria | 2257 |
| 721 | Ga0587078_001097 | 3300059646 | Bacteria | 2308 |
| 722 | Ga0587102_000527 | 3300059649 | Bacteria | 2232 |
| 723 | Ga0587107_000363 | 3300059652 | Bacteria | 2842 |
| 724 | Ga0587071_003361 | 3300060344 | Bacteria | 2286 |
| 725 | Ga0587111_0003802 | 3300060346 | Bacteria | 2186 |
| 726 | Ga0501082_0004513 | 3300060353 | Bacteria | 12157 |
| 727 | Ga0501082_0039877 | 3300060353 | Bacteria | 4051 |
| 728 | Ga0501082_0468111 | 3300060353 | Bacteria | 1101 |
| 729 | 2643924190 | 2643221583 | Bacteria | 5218014 |
| 730 | 2511125119 | 2510917020 | Bacteria | 5657507 |
| 731 | 2585151781 | 2582581280 | Bacteria | 5994497 |
| 732 | 2585154534 | 2582581280 | Bacteria | 5994497 |
| 733 | 2585155436 | 2582581280 | Bacteria | 5994497 |
| 734 | 2585155676 | 2582581280 | Bacteria | 5994497 |
| 735 | 2643748407 | 2643221545 | Bacteria | 5083237 |
| 736 | 2643884694 | 2643221574 | Bacteria | 2789653 |
| 737 | 2643911578 | 2643221580 | Bacteria | 3816678 |
| 738 | 2643963622 | 2643221591 | Bacteria | 4397626 |
| 739 | 2644224135 | 2643221640 | Bacteria | 5258820 |
| 740 | 2644234918 | 2643221642 | Bacteria | 5357871 |
| 741 | 2644342236 | 2643221661 | Bacteria | 4267604 |
| 742 | 2644352463 | 2643221663 | Bacteria | 3425771 |
| 743 | 2644410370 | 2643221674 | Bacteria | 3919126 |
| 744 | 2644508361 | 2643221691 | Bacteria | 5093099 |
| 745 | 2671694510 | 2671180139 | Bacteria | 4196045 |
| 746 | 2671694524 | 2671180139 | Bacteria | 4196045 |
| 747 | 2739792092 | 2739367756 | Bacteria | 4553612 |
| 748 | 2841913362 | 2841911363 | Bacteria | 6173697 |
| 749 | 2841913377 | 2841911363 | Bacteria | 6173697 |
| 750 | 2841919109 | 2841917233 | Bacteria | 6173500 |
| 751 | 2841919124 | 2841917233 | Bacteria | 6173500 |
| 752 | 2843746970 | 2843744320 | Bacteria | 5659202 |
| 753 | 2843749243 | 2843744320 | Bacteria | 5659202 |
| 754 | 2849562782 | 2849560528 | Bacteria | 5393480 |
| 755 | 2849574447 | 2849573788 | Bacteria | 5421256 |
| 756 | 2851157042 | 2851153111 | Bacteria | 5542585 |
| 757 | 2857509622 | 2857504554 | Bacteria | 5369913 |
| 758 | 2885427568 | 2885427238 | Bacteria | 2291351 |
| 759 | 2891050816 | 2891048133 | Bacteria | 4447501 |
| 760 | 2891052030 | 2891048133 | Bacteria | 4447501 |
| 761 | 2898332255 | 2898329390 | Bacteria | 5168154 |
| 762 | 2928975614 | 2928972540 | Bacteria | 3058286 |
| 763 | 2932403060 | 2932401849 | Bacteria | 4262978 |
| 764 | 2939671411 | 2939669807 | Bacteria | 5028511 |
| 765 | 2941486882 | 2941485952 | Bacteria | 3591484 |
| 766 | 2941486929 | 2941485952 | Bacteria | 3591484 |
| 767 | 2977241637 | 2977240413 | Bacteria | 3191065 |
| 768 | 2977242317 | 2977240413 | Bacteria | 3191065 |
| 769 | 2997456927 | 2997451912 | Bacteria | 8492419 |
| 770 | 646814833 | 646564506 | Bacteria | 3192235 |
| 771 | 8057530443 | 8057529695 | Bacteria | 6306553 |
| 772 | 8057530466 | 8057529695 | Bacteria | 6306553 |
| 773 | LJNas_1002379 | |||
| 774 | JGI24746J21847_1000007 | |||
| 775 | JGI24740J21852_10004417 | |||
| 776 | JGI24748J21848_1000332 | |||
| 777 | JGI24034J26672_10000068 | |||
| 778 | JGI24742J22300_10000389 | |||
| 779 | JGI25165J46597_1000961 | |||
| 780 | JGI25153J46596_10019154 | |||
| 781 | JGI25407J50210_10000001 | |||
| 782 | Ga0055537_1003463 | |||
| 783 | Ga0055537_1005190 | |||
| 784 | Ga0055534_1011560 | |||
| 785 | Ga0055534_1015199 | |||
| 786 | Ga0055531_10005224 | |||
| 787 | Ga0058863_10019511 | |||
| 788 | Ga0058862_10006495 | |||
| 789 | Ga0058862_10084521 | |||
| 790 | Ga0070683_100002370 | |||
| 791 | Ga0070683_100293863 | |||
| 792 | Ga0070670_100003031 | |||
| 793 | Ga0070677_10000017 | |||
| 794 | Ga0070666_10059071 | |||
| 795 | Ga0070666_10079916 | |||
| 796 | Ga0070680_100083838 | |||
| 797 | Ga0070682_100000009 | |||
| 798 | Ga0068868_100003492 | |||
| 799 | Ga0068868_100112874 | |||
| 800 | Ga0070668_100041840 | |||
| 801 | Ga0070669_100109408 | |||
| 802 | Ga0070671_100001396 | |||
| 803 | Ga0070674_100000021 | |||
| 804 | Ga0070674_100000047 | |||
| 805 | Ga0070659_100000160 | |||
| 806 | Ga0070659_100041891 | |||
| 807 | Ga0070667_100033809 | |||
| 808 | Ga0070667_100129510 | |||
| 809 | Ga0070713_100061429 | |||
| 810 | Ga0070710_10000005 | |||
| 811 | Ga0070711_100001729 | |||
| 812 | Ga0070711_100124810 | |||
| 813 | Ga0070705_100004488 | |||
| 814 | Ga0070663_100079574 | |||
| 815 | Ga0070662_100000007 | |||
| 816 | Ga0070681_10035006 | |||
| 817 | Ga0070679_100067285 | |||
| 818 | Ga0070684_100016808 | |||
| 819 | Ga0070693_100001510 | |||
| 820 | Ga0070693_100103499 | |||
| 821 | Ga0070665_100000005 | |||
| 822 | Ga0070665_100000022 | |||
| 823 | Ga0070665_100044175 | |||
| 824 | Ga0070665_100049555 | |||
| 825 | Ga0070665_100052636 | |||
| 826 | Ga0070704_100012434 | |||
| 827 | Ga0068855_100099763 | |||
| 828 | Ga0068855_100390135 | |||
| 829 | Ga0070664_100173116 | |||
| 830 | Ga0068856_100069110 | |||
| 831 | Ga0068856_100328330 | |||
| 832 | Ga0068852_100007244 | |||
| 833 | Ga0068859_100009443 | |||
| 834 | Ga0068859_100009530 | |||
| 835 | Ga0068859_100044984 | |||
| 836 | Ga0068859_100165595 | |||
| 837 | Ga0068859_100217799 | |||
| 838 | Ga0068859_100314217 | |||
| 839 | Ga0068864_100016896 | |||
| 840 | Ga0068866_10000007 | |||
| 841 | Ga0068866_10000274 | |||
| 842 | Ga0068863_100008077 | |||
| 843 | Ga0068863_100195270 | |||
| 844 | Ga0068858_100000150 | |||
| 845 | Ga0068858_100117388 | |||
| 846 | Ga0068860_100039842 | |||
| 847 | Ga0068862_100062233 | |||
| 848 | Ga0068862_100066022 | |||
| 849 | Ga0068862_100071259 | |||
| 850 | Ga0081455_10035476 | |||
| 851 | Ga0081538_10004242 | |||
| 852 | Ga0081540_1037311 | |||
| 853 | Ga0081540_1073811 | |||
| 854 | Ga0081539_10003958 | |||
| 855 | Ga0070717_10000069 | |||
| 856 | Ga0070717_10024370 | |||
| 857 | Ga0070717_10157967 | |||
| 858 | Ga0070717_10161271 | |||
| 859 | Ga0075365_10054607 | |||
| 860 | Ga0075368_10005365 | |||
| 861 | Ga0075363_100093713 | |||
| 862 | Ga0075364_10143435 | |||
| 863 | Ga0075432_10000042 | |||
| 864 | Ga0070715_10000003 | |||
| 865 | Ga0070712_100000350 | |||
| 866 | Ga0097621_100216228 | |||
| 867 | Ga0075370_10111186 | |||
| 868 | Ga0075430_100036366 | |||
| 869 | Ga0075430_100205507 | |||
| 870 | Ga0075431_100154252 | |||
| 871 | Ga0075433_10001498 | |||
| 872 | Ga0068865_100007443 | |||
| 873 | Ga0097620_100009444 | |||
| 874 | Ga0097620_100009531 | |||
| 875 | Ga0097620_100044985 | |||
| 876 | Ga0097620_100165595 | |||
| 877 | Ga0097620_100217802 | |||
| 878 | Ga0097620_100314216 | |||
| 879 | Ga0079104_1011968 | |||
| 880 | Ga0105251_10074873 | |||
| 881 | Ga0105240_10006736 | |||
| 882 | Ga0105240_10011097 | |||
| 883 | Ga0105240_10122585 | |||
| 884 | Ga0105245_10000022 | |||
| 885 | Ga0105247_10000064 | |||
| 886 | Ga0105247_10029622 | |||
| 887 | Ga0105248_10088373 | |||
| 888 | Ga0105248_10090574 | |||
| 889 | Ga0105237_10000795 | |||
| 890 | Ga0105238_10000014 | |||
| 891 | Ga0105238_10269312 | |||
| 892 | Ga0105249_10018050 | |||
| 893 | Ga0157372_10091383 | |||
| 894 | Ga0157375_10000126 | |||
| 895 | Ga0157375_10008331 | |||
| 896 | Ga0157375_10173955 | |||
| 897 | Ga0163163_10098331 | |||
| 898 | Ga0163163_10181092 | |||
| 899 | Ga0157380_10000560 | |||
| 900 | Ga0157380_10038641 | |||
| 901 | Ga0182008_10007915 | |||
| 902 | Ga0182008_10027906 | |||
| 903 | Ga0157379_10026179 | |||
| 904 | Ga0157379_10061801 | |||
| 905 | Ga0182007_10032563 | |||
| 906 | Ga0163161_10000013 | |||
| 907 | Ga0197907_10106601 | |||
| 908 | Ga0206356_11626451 | |||
| 909 | Ga0206349_1658903 | |||
| 910 | Ga0206352_10123011 | |||
| 911 | Ga0206350_11565878 | |||
| 912 | Ga0213872_10018990 | |||
| 913 | Ga0213876_10001317 | |||
| 914 | Ga0213876_10016428 | |||
| 915 | Ga0213875_10000154 | |||
| 916 | Ga0224712_10028045 | |||
| 917 | Ga0224712_10029260 | |||
| 918 | Ga0207427_101449 | |||
| 919 | Ga0209026_1004620 | |||
| 920 | Ga0209026_1004741 | |||
| 921 | Ga0209233_1000293 | |||
| 922 | Ga0209233_1004407 | |||
| 923 | Ga0209233_1016401 | |||
| 924 | Ga0209455_1015467 | |||
| 925 | Ga0209675_1010141 | |||
| 926 | Ga0209676_1001296 | |||
| 927 | Ga0209758_1001435 | |||
| 928 | Ga0209758_1013790 | |||
| 929 | Ga0209050_1000161 | |||
| 930 | Ga0209050_1015450 | |||
| 931 | Ga0209051_1000877 | |||
| 932 | Ga0209257_1000252 | |||
| 933 | Ga0209257_1000409 | |||
| 934 | Ga0209257_1000552 | |||
| 935 | Ga0209257_1003348 | |||
| 936 | Ga0207697_10015765 | |||
| 937 | Ga0207697_10083476 | |||
| 938 | Ga0207682_10000008 | |||
| 939 | Ga0207692_10000003 | |||
| 940 | Ga0207642_10000008 | |||
| 941 | Ga0207642_10000979 | |||
| 942 | Ga0207710_10000220 | |||
| 943 | Ga0207710_10088046 | |||
| 944 | Ga0207647_10153064 | |||
| 945 | Ga0207685_10000003 | |||
| 946 | Ga0207645_10040174 | |||
| 947 | Ga0207705_10128982 | |||
| 948 | Ga0207707_10007402 | |||
| 949 | Ga0207707_10113656 | |||
| 950 | Ga0207707_10123548 | |||
| 951 | Ga0207695_10016319 | |||
| 952 | Ga0207695_10041220 | |||
| 953 | Ga0207695_10084973 | |||
| 954 | Ga0207695_10178435 | |||
| 955 | Ga0207695_10200353 | |||
| 956 | Ga0207695_10243997 | |||
| 957 | Ga0207671_10001074 | |||
| 958 | Ga0207671_10005921 | |||
| 959 | Ga0207693_10000138 | |||
| 960 | Ga0207663_10174851 | |||
| 961 | Ga0207660_10052069 | |||
| 962 | Ga0207660_10106414 | |||
| 963 | Ga0207657_10092245 | |||
| 964 | Ga0207657_10213381 | |||
| 965 | Ga0207652_10000242 | |||
| 966 | Ga0207652_10116411 | |||
| 967 | Ga0207681_10036263 | |||
| 968 | Ga0207694_10000008 | |||
| 969 | Ga0207694_10015447 | |||
| 970 | Ga0207687_10000039 | |||
| 971 | Ga0207687_10000132 | |||
| 972 | Ga0207700_10104123 | |||
| 973 | Ga0207664_10040931 | |||
| 974 | Ga0207664_10052171 | |||
| 975 | Ga0207664_10052775 | |||
| 976 | Ga0207644_10001581 | |||
| 977 | Ga0207690_10000165 | |||
| 978 | Ga0207690_10017348 | |||
| 979 | Ga0207690_10018062 | |||
| 980 | Ga0207706_10000018 | |||
| 981 | Ga0207706_10028676 | |||
| 982 | Ga0207686_10026568 | |||
| 983 | Ga0207669_10000032 | |||
| 984 | Ga0207711_10014493 | |||
| 985 | Ga0207711_10040773 | |||
| 986 | Ga0207689_10054979 | |||
| 987 | Ga0207661_10183741 | |||
| 988 | Ga0207667_10072768 | |||
| 989 | Ga0207667_10083431 | |||
| 990 | Ga0207712_10000067 | |||
| 991 | Ga0207712_10003883 | |||
| 992 | Ga0207712_10023398 | |||
| 993 | Ga0207712_10160793 | |||
| 994 | Ga0207668_10000053 | |||
| 995 | Ga0207668_10000363 | |||
| 996 | Ga0207668_10009658 | |||
| 997 | Ga0207668_10026971 | |||
| 998 | Ga0207668_10030190 | |||
| 999 | Ga0207668_10104670 | |||
| 1000 | Ga0207668_10177067 | |||
| 1001 | Ga0207677_10000046 | |||
| 1002 | Ga0207703_10001133 | |||
| 1003 | Ga0207703_10003008 | |||
| 1004 | Ga0207703_10004569 | |||
| 1005 | Ga0207703_10005760 | |||
| 1006 | Ga0207703_10013988 | |||
| 1007 | Ga0207639_10152110 | |||
| 1008 | Ga0207639_10283391 | |||
| 1009 | Ga0207708_10038392 | |||
| 1010 | Ga0207702_10046770 | |||
| 1011 | Ga0207702_10113611 | |||
| 1012 | Ga0207641_10003614 | |||
| 1013 | Ga0207641_10006154 | |||
| 1014 | Ga0207641_10013745 | |||
| 1015 | Ga0207641_10255831 | |||
| 1016 | Ga0207648_10202363 | |||
| 1017 | Ga0207648_10230801 | |||
| 1018 | Ga0207676_10001597 | |||
| 1019 | Ga0207674_10074477 | |||
| 1020 | Ga0207675_100094820 | |||
| 1021 | Ga0207675_100246744 | |||
| 1022 | Ga0207683_10083220 | |||
| 1023 | Ga0207683_10141203 | |||
| 1024 | Ga0207698_10027561 | |||
| 1025 | Ga0209970_1009394 | |||
| 1026 | Ga0209813_10000406 | |||
| 1027 | Ga0209813_10001907 | |||
| 1028 | Ga0207428_10051901 | |||
| 1029 | Ga0265355_1000561 | |||
| 1030 | Ga0268266_10000012 | |||
| 1031 | Ga0268266_10000029 | |||
| 1032 | Ga0268266_10000311 | |||
| 1033 | Ga0268266_10000321 | |||
| 1034 | Ga0268266_10003345 | |||
| 1035 | Ga0268266_10016661 | |||
| 1036 | Ga0268266_10034769 | |||
| 1037 | Ga0268266_10362777 | |||
| 1038 | Ga0268265_10004022 | |||
| 1039 | Ga0268265_10011012 | |||
| 1040 | Ga0268264_10005167 | |||
| 1041 | Ga0268264_10057405 | |||
| 1042 | Ga0268264_10108360 | |||
| 1043 | Ga0268264_10440456 | |||
| 1044 | Ga0265337_1000032 | |||
| 1045 | Ga0265337_1009999 | |||
| 1046 | Ga0265326_10000040 | |||
| 1047 | Ga0265326_10000082 | |||
| 1048 | Ga0265319_1000006 | |||
| 1049 | Ga0265319_1000357 | |||
| 1050 | Ga0265319_1000863 | |||
| 1051 | Ga0265319_1005558 | |||
| 1052 | Ga0265334_10000050 | |||
| 1053 | Ga0265318_10000275 | |||
| 1054 | Ga0265318_10002149 | |||
| 1055 | Ga0265318_10063568 | |||
| 1056 | Ga0265322_10000012 | |||
| 1057 | Ga0265336_10000043 | |||
| 1058 | Ga0265336_10001438 | |||
| 1059 | Ga0307517_10067581 | |||
| 1060 | Ga0307517_10076016 | |||
| 1061 | Ga0307515_10042841 | |||
| 1062 | Ga0265338_10000142 | |||
| 1063 | Ga0265338_10013959 | |||
| 1064 | Ga0265338_10020173 | |||
| 1065 | Ga0265338_10024739 | |||
| 1066 | Ga0265338_10029298 | |||
| 1067 | Ga0265338_10040390 | |||
| 1068 | Ga0265338_10100462 | |||
| 1069 | Ga0265338_10246384 | |||
| 1070 | Ga0265324_10000620 | |||
| 1071 | Ga0265324_10002295 | |||
| 1072 | Ga0307511_10029704 | |||
| 1073 | Ga0265766_1000600 | |||
| 1074 | Ga0265330_10081402 | |||
| 1075 | Ga0265328_10002011 | |||
| 1076 | Ga0265320_10000001 | |||
| 1077 | Ga0265320_10012505 | |||
| 1078 | Ga0265320_10040194 | |||
| 1079 | Ga0265325_10018226 | |||
| 1080 | Ga0265325_10051778 | |||
| 1081 | Ga0265329_10000919 | |||
| 1082 | Ga0265340_10000006 | |||
| 1083 | Ga0265340_10001769 | |||
| 1084 | Ga0265340_10035745 | |||
| 1085 | Ga0265331_10001467 | |||
| 1086 | Ga0265327_10000003 | |||
| 1087 | Ga0265327_10031343 | |||
| 1088 | Ga0265327_10036074 | |||
| 1089 | Ga0265316_10003472 | |||
| 1090 | Ga0265316_10010215 | |||
| 1091 | Ga0265316_10029887 | |||
| 1092 | Ga0265316_10052032 | |||
| 1093 | Ga0265316_10086271 | |||
| 1094 | Ga0265316_10168291 | |||
| 1095 | Ga0307513_10016219 | |||
| 1096 | Ga0307513_10080274 | |||
| 1097 | Ga0307513_10236790 | |||
| 1098 | Ga0307408_100094204 | |||
| 1099 | Ga0265313_10000031 | |||
| 1100 | Ga0265313_10045234 | |||
| 1101 | Ga0265313_10079460 | |||
| 1102 | Ga0265314_10000178 | |||
| 1103 | Ga0265314_10029221 | |||
| 1104 | Ga0265342_10008958 | |||
| 1105 | Ga0316578_10084977 | |||
| 1106 | Ga0307516_10033588 | |||
| 1107 | Ga0307405_10125927 | |||
| 1108 | Ga0307410_10021164 | |||
| 1109 | Ga0307410_10100030 | |||
| 1110 | Ga0307410_10281831 | |||
| 1111 | Ga0307406_10046283 | |||
| 1112 | Ga0307406_10077001 | |||
| 1113 | Ga0307412_10065817 | |||
| 1114 | Ga0307409_100052255 | |||
| 1115 | Ga0307414_10085018 | |||
| 1116 | Ga0307415_100193066 | |||
| 1117 | Ga0316593_10034316 | |||
| 1118 | Ga0307507_10180226 | |||
| 1119 | Ga0307510_10015365 | |||
| 1120 | Ga0307510_10184849 | |||
| 1121 | Ga0316587_1013100 | |||
| 1122 | Ga0316596_1003203 | |||
| 1123 | Ga0373923_0021631 | |||
| 1124 | Ga0373936_0009150 | |||
| 1125 | Ga0373955_0013248 | |||
| 1126 | Ga0373955_0145740 | |||
| 1127 | Ga0316574_0018664 | |||
| 1128 | Ga0316574_0096095 | |||
| 1129 | Ga0373935_0027604 | |||
| 1130 | Ga0373927_0004885 | |||
| 1131 | Ga0373933_0005630 | |||
| 1132 | Ga0373933_0061472 | |||
| 1133 | Ga0373947_0084463 | |||
| 1134 | Ga0373937_0016661 | |||
| 1135 | Ga0373937_0076699 | |||
| 1136 | Ga0373937_0088030 | |||
| 1137 | Ga0316582_0127044 | |||
| 1138 | Ga0373925_0000023 | |||
| 1139 | Ga0395899_0025038 | |||
| 1140 | Ga0395899_0214213 | |||
| 1141 | Ga0395900_0227298 | |||
| 1142 | Ga0395900_0422772 | |||
| 1143 | Ga0395898_0088428 | |||
| 1144 | Ga0395898_0211604 | |||
| 1145 | Ga0395898_0257402 | |||
| 1146 | Ga0395905_0022710 | |||
| 1147 | Ga0395905_0169582 | |||
| 1148 | Ga0436364_0542964 | |||
| 1149 | Ga0436364_0586950 | |||
| 1150 | Ga0395901_0120715 | |||
| 1151 | Ga0395901_0135008 | |||
| 1152 | Ga0395901_0165610 | |||
| 1153 | Ga0400486_00962 | |||
| 1154 | Ga0436365_0319180 | |||
| 1155 | Ga0436365_1318630 | |||
| 1156 | Ga0436361_0413994 | |||
| 1157 | Ga0436362_0179942 | |||
| 1158 | Ga0439431_0013009 | |||
| 1159 | Ga0439457_011885 | |||
| 1160 | Ga0439434_0017551 | |||
| 1161 | Ga0439435_0002970 | |||
| 1162 | Ga0450901_001704 | |||
| 1163 | Ga0451577_0347129 | |||
| 1164 | Ga0466969_0001105 | |||
| 1165 | Ga0466966_0003817 | |||
| 1166 | Ga0466961_0000659 | |||
| 1167 | Ga0466961_0058761 | |||
| 1168 | Ga0466961_0071708 | |||
| 1169 | Ga0466963_0000325 | |||
| 1170 | Ga0466963_0087179 | |||
| 1171 | Ga0466971_0037640 | |||
| 1172 | Ga0466970_0042626 | |||
| 1173 | Ga0466970_0050555 | |||
| 1174 | Ga0466957_0016259 | |||
| 1175 | Ga0466957_0162610 | |||
| 1176 | Ga0466960_0001761 | |||
| 1177 | Ga0466959_0022573 | |||
| 1178 | Ga0466959_0078843 | |||
| 1179 | Ga0451576_0000023 | |||
| 1180 | Ga0451576_0000063 | |||
| 1181 | Ga0451576_0027584 | |||
| 1182 | Ga0451576_0039758 | |||
| 1183 | Ga0466958_0047302 | |||
| 1184 | Ga0466967_0023322 | |||
| 1185 | Ga0495627_001425 | |||
| 1186 | Ga0495592_0180516 | |||
| 1187 | Ga0495603_0000323 | |||
| 1188 | Ga0495603_0000641 | |||
| 1189 | Ga0495603_0058507 | |||
| 1190 | Ga0495590_0001017 | |||
| 1191 | Ga0495638_0013903 | |||
| 1192 | Ga0495641_0000400 | |||
| 1193 | Ga0495641_0029068 | |||
| 1194 | Ga0495641_0042340 | |||
| 1195 | Ga0495653_0004713 | |||
| 1196 | Ga0495653_0014903 | |||
| 1197 | Ga0495653_0046609 | |||
| 1198 | Ga0495653_0077384 | |||
| 1199 | Ga0495650_0000121 | |||
| 1200 | Ga0495582_0000006 | |||
| 1201 | Ga0495662_0000236 | |||
| 1202 | Ga0495664_0000007 | |||
| 1203 | Ga0495607_0124900 | |||
| 1204 | Ga0495583_0021508 | |||
| 1205 | Ga0495608_0022894 | |||
| 1206 | Ga0495610_0000924 | |||
| 1207 | Ga0495618_0000035 | |||
| 1208 | Ga0495618_0000037 | |||
| 1209 | Ga0495620_0000668 | |||
| 1210 | Ga0495620_0036764 | |||
| 1211 | Ga0495630_0012465 | |||
| 1212 | Ga0495630_0102334 | |||
| 1213 | Ga0495637_0017338 | |||
| 1214 | Ga0495648_0001203 | |||
| 1215 | Ga0495642_0022905 | |||
| 1216 | Ga0495652_0049476 | |||
| 1217 | Ga0495640_0025030 | |||
| 1218 | Ga0495621_0004561 | |||
| 1219 | Ga0495597_0005196 | |||
| 1220 | Ga0495645_0000033 | |||
| 1221 | Ga0495645_0000159 | |||
| 1222 | Ga0495645_0167715 | |||
| 1223 | Ga0495633_0005367 | |||
| 1224 | Ga0495667_0000067 | |||
| 1225 | Ga0495667_0004534 | |||
| 1226 | Ga0495656_0000412 | |||
| 1227 | Ga0495656_0079938 | |||
| 1228 | Ga0495668_0005284 | |||
| 1229 | Ga0495611_0026790 | |||
| 1230 | Ga0495625_0131776 | |||
| 1231 | Ga0495635_0000006 | |||
| 1232 | Ga0495588_0037138 | |||
| 1233 | Ga0495657_0000027 | |||
| 1234 | Ga0495657_0001760 | |||
| 1235 | Ga0495657_0050118 | |||
| 1236 | Ga0495599_0014944 | |||
| 1237 | Ga0495623_0031396 | |||
| 1238 | Ga0495647_0000010 | |||
| 1239 | Ga0495658_0000094 | |||
| 1240 | Ga0495658_0104120 | |||
| 1241 | Ga0495669_0000371 | |||
| 1242 | Ga0495669_0001857 | |||
| 1243 | Ga0495613_0000947 | |||
| 1244 | Ga0495613_0035802 | |||
| 1245 | Ga0495624_0000767 | |||
| 1246 | Ga0495670_0001585 | |||
| 1247 | Ga0495671_0094827 | |||
| 1248 | Ga0495649_0004615 | |||
| 1249 | Ga0495600_0016896 | |||
| 1250 | Ga0495600_0041791 | |||
| 1251 | Ga0495600_0091954 | |||
| 1252 | Ga0495660_0019866 | |||
| 1253 | Ga0495604_0000218 | |||
| 1254 | Ga0495604_0036561 | |||
| 1255 | Ga0495672_0001458 | |||
| 1256 | Ga0495676_0001315 | |||
| 1257 | Ga0495680_0001684 | |||
| 1258 | Ga0495680_0001951 | |||
| 1259 | Ga0495680_0028739 | |||
| 1260 | Ga0495687_020629 | |||
| 1261 | Ga0495677_0011211 | |||
| 1262 | Ga0495677_0021265 | |||
| 1263 | Ga0495679_005798 | |||
| 1264 | Ga0495673_0002746 | |||
| 1265 | Ga0495673_0007304 | |||
| 1266 | Ga0495681_0055771 | |||
| 1267 | Ga0495684_0001725 | |||
| 1268 | Ga0495684_0055386 | |||
| 1269 | Ga0495593_0059744 | |||
| 1270 | Ga0496100_0000004 | |||
| 1271 | Ga0496101_0000007 | |||
| 1272 | Ga0496101_0008458 | |||
| 1273 | Ga0496101_0099463 | |||
| 1274 | Ga0496101_0130560 | |||
| 1275 | Ga0496102_0000002 | |||
| 1276 | Ga0496103_0000017 | |||
| 1277 | Ga0496104_0000001 | |||
| 1278 | Ga0496104_0000008 | |||
| 1279 | Ga0496104_0000307 | |||
| 1280 | Ga0496104_0033810 | |||
| 1281 | Ga0496104_0298145 | |||
| 1282 | Ga0496105_0000003 | |||
| 1283 | Ga0496105_0000070 | |||
| 1284 | Ga0496105_0217838 | |||
| 1285 | Ga0496106_0000004 | |||
| 1286 | Ga0496106_0004033 | |||
| 1287 | Ga0496106_0093786 | |||
| 1288 | Ga0496106_0193822 | |||
| 1289 | Ga0496107_0000001 | |||
| 1290 | Ga0496107_0001409 | |||
| 1291 | Ga0496107_0142562 | |||
| 1292 | Ga0496107_0229461 | |||
| 1293 | Ga0496108_0000004 | |||
| 1294 | Ga0496108_0036957 | |||
| 1295 | Ga0496108_0045232 | |||
| 1296 | Ga0496108_0054744 | |||
| 1297 | Ga0496108_0196490 | |||
| 1298 | Ga0496109_0000036 | |||
| 1299 | Ga0496109_0000550 | |||
| 1300 | Ga0496109_0002231 | |||
| 1301 | Ga0496109_0004801 | |||
| 1302 | Ga0496109_0023777 | |||
| 1303 | Ga0496109_0167197 | |||
| 1304 | Ga0496110_0000152 | |||
| 1305 | Ga0496110_0013101 | |||
| 1306 | Ga0496110_0032992 | |||
| 1307 | Ga0496110_0053927 | |||
| 1308 | Ga0496110_0123328 | |||
| 1309 | Ga0496111_0000123 | |||
| 1310 | Ga0496111_0112895 | |||
| 1311 | Ga0496112_0000002 | |||
| 1312 | Ga0496112_0001057 | |||
| 1313 | Ga0496112_0001810 | |||
| 1314 | Ga0496112_0018998 | |||
| 1315 | Ga0496112_0020121 | |||
| 1316 | Ga0496113_0029106 | |||
| 1317 | Ga0496113_0079171 | |||
| 1318 | Ga0496114_0000097 | |||
| 1319 | Ga0496114_0003529 | |||
| 1320 | Ga0496115_0000005 | |||
| 1321 | Ga0496115_0000151 | |||
| 1322 | Ga0496115_0020265 | |||
| 1323 | Ga0496115_0055983 | |||
| 1324 | Ga0496115_0059763 | |||
| 1325 | Ga0496115_0140761 | |||
| 1326 | Ga0496115_0288564 | |||
| 1327 | Ga0496116_0052644 | |||
| 1328 | Ga0496117_0010944 | |||
| 1329 | Ga0496118_0006934 | |||
| 1330 | Ga0496119_0019080 | |||
| 1331 | Ga0496121_0000485 | |||
| 1332 | Ga0496121_0000946 | |||
| 1333 | Ga0496121_0027878 | |||
| 1334 | Ga0496123_0001481 | |||
| 1335 | Ga0496124_0040664 | |||
| 1336 | Ga0496125_0000815 | |||
| 1337 | Ga0496125_0090667 | |||
| 1338 | Ga0496125_0190625 | |||
| 1339 | Ga0496126_0183070 | |||
| 1340 | Ga0501311_002271 | |||
| 1341 | Ga0501314_000335 | |||
| 1342 | Ga0501031_0009868 | |||
| 1343 | Ga0501031_0027816 | |||
| 1344 | Ga0501032_0001419 | |||
| 1345 | Ga0501032_0067379 | |||
| 1346 | Ga0501033_0004084 | |||
| 1347 | Ga0501033_0218198 | |||
| 1348 | Ga0501034_0004173 | |||
| 1349 | Ga0501034_0118404 | |||
| 1350 | Ga0501034_0128649 | |||
| 1351 | Ga0501034_0157828 | |||
| 1352 | Ga0501034_0165468 | |||
| 1353 | Ga0501034_0187645 | |||
| 1354 | Ga0501034_0254468 | |||
| 1355 | Ga0501036_0014888 | |||
| 1356 | Ga0501036_0020928 | |||
| 1357 | Ga0501036_0076823 | |||
| 1358 | Ga0501036_0085139 | |||
| 1359 | Ga0501037_0001774 | |||
| 1360 | Ga0501038_0029168 | |||
| 1361 | Ga0501038_0107566 | |||
| 1362 | Ga0501039_0009138 | |||
| 1363 | Ga0501039_0108356 | |||
| 1364 | Ga0501040_0200740 | |||
| 1365 | Ga0501040_0264088 | |||
| 1366 | Ga0501042_0004502 | |||
| 1367 | Ga0501042_0008906 | |||
| 1368 | Ga0501042_0099949 | |||
| 1369 | Ga0501042_0130740 | |||
| 1370 | Ga0501042_0259000 | |||
| 1371 | Ga0501043_0017287 | |||
| 1372 | Ga0501043_0109183 | |||
| 1373 | Ga0501046_0014582 | |||
| 1374 | Ga0501046_0192802 | |||
| 1375 | Ga0501047_0014422 | |||
| 1376 | Ga0501047_0021902 | |||
| 1377 | Ga0501047_0023718 | |||
| 1378 | Ga0501047_0084394 | |||
| 1379 | Ga0501047_0144623 | |||
| 1380 | Ga0501047_0177307 | |||
| 1381 | Ga0501047_0195623 | |||
| 1382 | Ga0501048_0006374 | |||
| 1383 | Ga0501048_0040346 | |||
| 1384 | Ga0501048_0081658 | |||
| 1385 | Ga0501067_0009878 | |||
| 1386 | Ga0501067_0036584 | |||
| 1387 | Ga0501067_0050205 | |||
| 1388 | Ga0501068_0011636 | |||
| 1389 | Ga0501068_0066433 | |||
| 1390 | Ga0501069_0001887 | |||
| 1391 | Ga0501069_0004122 | |||
| 1392 | Ga0501070_0012789 | |||
| 1393 | Ga0501070_0119182 | |||
| 1394 | Ga0501070_0136837 | |||
| 1395 | Ga0501071_0050472 | |||
| 1396 | Ga0501071_0096370 | |||
| 1397 | Ga0501071_0180049 | |||
| 1398 | Ga0501071_0240661 | |||
| 1399 | Ga0501072_0016795 | |||
| 1400 | Ga0501072_0124884 | |||
| 1401 | Ga0501072_0222472 | |||
| 1402 | Ga0501073_0005503 | |||
| 1403 | Ga0501073_0014497 | |||
| 1404 | Ga0501073_0018783 | |||
| 1405 | Ga0501073_0243105 | |||
| 1406 | Ga0501074_0021775 | |||
| 1407 | Ga0501074_0050003 | |||
| 1408 | Ga0501074_0054280 | |||
| 1409 | Ga0501075_0006663 | |||
| 1410 | Ga0501238_000151 | |||
| 1411 | Ga0501257_000588 | |||
| 1412 | Ga0501080_0010572 | |||
| 1413 | Ga0501080_0035304 | |||
| 1414 | Ga0501081_0118209 | |||
| 1415 | Ga0501083_0059882 | |||
| 1416 | Ga0501083_0184562 | |||
| 1417 | Ga0501035_0004680 | |||
| 1418 | Ga0501035_0166314 | |||
| 1419 | Ga0501044_0041168 | |||
| 1420 | Ga0501044_0046900 | |||
| 1421 | Ga0501044_0115439 | |||
| 1422 | Ga0501044_0204239 | |||
| 1423 | Ga0501045_0064286 | |||
| 1424 | nmdc:mga03n38_29987_c1 | |||
| 1425 | nmdc:mga03n38_57892_c1 | |||
| 1426 | nmdc:mga06z11_11573_c1 | |||
| 1427 | nmdc:mga04h51_2557_c1 | |||
| 1428 | nmdc:mga0qj67_70565_c1 | |||
| 1429 | nmdc:mga06r32_278056_c1 | |||
| 1430 | nmdc:mga08y16_3153_c1 | |||
| 1431 | nmdc:mga0a205_15_c2 | |||
| 1432 | nmdc:mga0a205_253389_c1 | |||
| 1433 | nmdc:mga0sz30_8411_c1 | |||
| 1434 | Ga0495601_0061038 | |||
| 1435 | Ga0495612_0000369 | |||
| 1436 | Ga0495612_0002269 | |||
| 1437 | Ga0500635_0000151 | |||
| 1438 | Ga0495595_0002820 | |||
| 1439 | Ga0495619_0000036 | |||
| 1440 | Ga0495619_0005952 | |||
| 1441 | Ga0495619_0077095 | |||
| 1442 | Ga0500578_0002408 | |||
| 1443 | Ga0500578_0071208 | |||
| 1444 | Ga0500643_034824 | |||
| 1445 | Ga0500644_0004248 | |||
| 1446 | Ga0500566_0047254 | |||
| 1447 | Ga0500641_0000563 | |||
| 1448 | Ga0500641_0021040 | |||
| 1449 | Ga0500555_003161 | |||
| 1450 | Ga0500555_027784 | |||
| 1451 | Ga0500556_0000849 | |||
| 1452 | Ga0500556_0013092 | |||
| 1453 | Ga0500562_004351 | |||
| 1454 | Ga0500562_015604 | |||
| 1455 | Ga0500569_001151 | |||
| 1456 | Ga0500594_0000315 | |||
| 1457 | Ga0500608_000165 | |||
| 1458 | Ga0500608_000752 | |||
| 1459 | Ga0500608_010288 | |||
| 1460 | Ga0500614_001566 | |||
| 1461 | Ga0500658_0082928 | |||
| 1462 | Ga0500564_000306 | |||
| 1463 | Ga0500568_0069987 | |||
| 1464 | Ga0500616_0000008 | |||
| 1465 | Ga0500616_0006301 | |||
| 1466 | Ga0500616_0006551 | |||
| 1467 | Ga0500622_0003641 | |||
| 1468 | Ga0500622_0008207 | |||
| 1469 | Ga0500622_0064052 | |||
| 1470 | Ga0500624_001098 | |||
| 1471 | Ga0500634_0000031 | |||
| 1472 | Ga0500638_049699 | |||
| 1473 | Ga0500639_067780 | |||
| 1474 | Ga0500645_000199 | |||
| 1475 | Ga0500645_003346 | |||
| 1476 | Ga0501084_0030403 | |||
| 1477 | Ga0501084_0116876 | |||
| 1478 | Ga0587093_001189 | |||
| 1479 | Ga0587070_001606 | |||
| 1480 | Ga0587070_002325 | |||
| 1481 | Ga0587070_004991 | |||
| 1482 | Ga0587077_000881 | |||
| 1483 | Ga0587080_001568 | |||
| 1484 | Ga0587083_0002187 | |||
| 1485 | Ga0587085_002368 | |||
| 1486 | Ga0587088_002143 | |||
| 1487 | Ga0587092_003651 | |||
| 1488 | Ga0587094_001362 | |||
| 1489 | Ga0587095_000405 | |||
| 1490 | Ga0587099_001045 | |||
| 1491 | Ga0587101_001895 | |||
| 1492 | Ga0587117_000969 | |||
| 1493 | Ga0587078_001097 | |||
| 1494 | Ga0587102_000527 | |||
| 1495 | Ga0587107_000363 | |||
| 1496 | Ga0587071_003361 | |||
| 1497 | Ga0587111_0003802 | |||
| 1498 | Ga0501082_0004513 | |||
| 1499 | Ga0501082_0039877 | |||
| 1500 | Ga0501082_0468111 | |||
| 1501 | 2643924190 | |||
| 1502 | 2511125119 | |||
| 1503 | 2585151781 | |||
| 1504 | 2585154534 | |||
| 1505 | 2585155436 | |||
| 1506 | 2585155676 | |||
| 1507 | 2643748407 | |||
| 1508 | 2643884694 | |||
| 1509 | 2643911578 | |||
| 1510 | 2643963622 | |||
| 1511 | 2644224135 | |||
| 1512 | 2644234918 | |||
| 1513 | 2644342236 | |||
| 1514 | 2644352463 | |||
| 1515 | 2644410370 | |||
| 1516 | 2644508361 | |||
| 1517 | 2671694510 | |||
| 1518 | 2671694524 | |||
| 1519 | 2739792092 | |||
| 1520 | 2841913362 | |||
| 1521 | 2841913377 | |||
| 1522 | 2841919109 | |||
| 1523 | 2841919124 | |||
| 1524 | 2843746970 | |||
| 1525 | 2843749243 | |||
| 1526 | 2849562782 | |||
| 1527 | 2849574447 | |||
| 1528 | 2851157042 | |||
| 1529 | 2857509622 | |||
| 1530 | 2885427568 | |||
| 1531 | 2891050816 | |||
| 1532 | 2891052030 | |||
| 1533 | 2898332255 | |||
| 1534 | 2928975614 | |||
| 1535 | 2932403060 | |||
| 1536 | 2939671411 | |||
| 1537 | 2941486882 | |||
| 1538 | 2941486929 | |||
| 1539 | 2977241637 | |||
| 1540 | 2977242317 | |||
| 1541 | 2997456927 | |||
| 1542 | 646814833 | |||
| 1543 | 8057530443 | |||
| 1544 | 8057530466 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5i4q-assembly1.cif.gz_C-2 | contact-dependent inhibition system from escherichia coli nc101 - ternary cdia/cdii/ef-tu complex (domains 2 and 3) | 0.9746 | 209 | 394 |
| 5i4q-assembly1.cif.gz_C-2 | contact-dependent inhibition system from escherichia coli nc101 - ternary cdia/cdii/ef-tu complex (domains 2 and 3) | 0.9695 | 209 | 394 |
| 6wd9-assembly1.cif.gz_8 | cryo-em of elongating ribosome with ef-tu*gtp elucidates trna proofreading (cognate structure iii-b) | 0.9608 | 10 | 393 |
| 6wd9-assembly1.cif.gz_8 | cryo-em of elongating ribosome with ef-tu*gtp elucidates trna proofreading (cognate structure iii-b) | 0.9581 | 10 | 393 |
| 6wd4-assembly1.cif.gz_8 | cryo-em of elongating ribosome with ef-tu*gtp elucidates trna proofreading (cognate structure ii-b2) | 0.9578 | 2 | 393 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B4FVB2_262_392_2.40.30.10 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors | 0.9875 | 206 | 334 | 2.40.30.10 |
| 2y12Z02 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors | 0.9875 | 206 | 296 | 2.40.30.10 |
| af_G5ECM6_248_343_2.40.30.10 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors | 0.983 | 206 | 297 | 2.40.30.10 |
| 5w7qA02 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors | 0.9822 | 206 | 300 | 2.40.30.10 |
| 4h9gA03 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors | 0.9817 | 300 | 393 | 2.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2P7P1A2-F1-model_v4 | deleted | 0.9998 | 214 | 297 |
|
| AF-A0A3S0V9N4-F1-model_v4 | Elongation factor Tu | 0.9992 | 288 | 394 |
GO:0003746
GO:0005525 |
| AF-A0A3D0F3T6-F1-model_v4 | Elongation factor Tu (EC 3.6.5.3) | 0.9992 | 302 | 394 |
GO:0003746
GO:0005525 GO:0005829 GO:0016787 |
| AF-A0A352F424-F1-model_v4 | Elongation factor Tu (EC 3.6.5.3) | 0.9989 | 302 | 394 |
GO:0003746
GO:0005525 GO:0005829 GO:0016787 |
| AF-A0A1V5ZE31-F1-model_v4 | Elongation factor Tu | 0.9984 | 312 | 394 |
GO:0003746
GO:0005525 |