F480202
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 773 | 430 | 1546 | 302 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2721755523|2722884340 |
| Length | 335 |
| Sequence | PRSRHGQPWALRGPARVAAAAGVAALALLAATAGAQEADTPDRTAASRAPATLSGTLAKVRASGSIALGYRQASVPFSYLNARNEPIGYSIELCKALVTSIEDAVNRSLAIRWVPVTADNRVDAVASGQVDLECGSTTSNLERQKRVAFSPIMFVAGTKVMVRQDAQIRSLRDLASKKVAVTAGTTNEKAMRDLDRKFHLGMQLQVVPDHSQGFAQVAGGQTDAFATDDVLLYGLIAENAGKADGNGGTGASQGARLQVVGDYLSYDPYAIMFRKDDPQLAQVVRSSFQALAEDGEIERQYRRWFLRRLPSGTSLDLPMSAQLQTLIETLAAQPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 5 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 6 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 12 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 26 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 28 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 86 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 87 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 88 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 98 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 99 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 115 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 128 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 132 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 200 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 202 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 203 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 207 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 208 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 209 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 210 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 211 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 212 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 213 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 214 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 215 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 216 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 217 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 218 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 219 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 220 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 221 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 222 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 223 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 224 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 225 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 226 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 227 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 229 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 230 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 234 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 235 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 238 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 239 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 242 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 243 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 244 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 245 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 246 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 247 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 248 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 249 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 250 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 251 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 252 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 253 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 254 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 255 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 256 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 257 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 258 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 259 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 260 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 261 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 329 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 330 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 331 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 332 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 333 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 334 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 336 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 337 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 338 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 339 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 340 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 341 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 342 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 343 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 344 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 345 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 346 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 347 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 348 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 349 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 352 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 353 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 354 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 355 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 356 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 357 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 358 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 359 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 360 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 365 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 366 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 367 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 368 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 369 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 370 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 371 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 372 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 373 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 374 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 375 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 376 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 377 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 378 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 379 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 380 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 381 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 382 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 383 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 384 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 385 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 386 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 387 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 388 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 389 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 390 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 391 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 392 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 393 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 394 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 395 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 396 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 397 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 398 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 399 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 400 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 401 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 402 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 403 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 404 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 405 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 406 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 407 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 408 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 409 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 410 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 411 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 412 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 413 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 414 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 415 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 416 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 417 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 418 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 419 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 420 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 421 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 422 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 423 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 424 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 425 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 426 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 427 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 428 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 429 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 430 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.66 |
| Metatranscriptomes | 0 |
| Isolates | 6.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 24.58 |
| Nodule | 0.91 |
| Rhizoplane | 5.56 |
| Rhizosphere | 60.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10055212 | 3300001979 | Bacteria | 1119 |
| 2 | JGI24739J22299_10028465 | 3300001989 | Bacteria | 1949 |
| 3 | JGI24739J22299_10040055 | 3300001989 | Bacteria | 1565 |
| 4 | JGI24735J21928_10000118 | 3300002067 | Bacteria | 29248 |
| 5 | JGI25152J39213_1007368 | 3300002773 | Bacteria | 2855 |
| 6 | JGI25150J39212_1003628 | 3300002774 | Bacteria | 3583 |
| 7 | JGI25159J45721_1012341 | 3300002987 | Bacteria | 2044 |
| 8 | JGI25159J45721_1014046 | 3300002987 | Bacteria | 1825 |
| 9 | JGI25151J46595_10014489 | 3300003187 | Bacteria | 3509 |
| 10 | JGI25151J46595_10020086 | 3300003187 | Bacteria | 2824 |
| 11 | JGI25151J46595_10022268 | 3300003187 | Bacteria | 2634 |
| 12 | JGI25151J46595_10034031 | 3300003187 | Bacteria | 1954 |
| 13 | JGI25153J46596_10017212 | 3300003215 | Bacteria | 2855 |
| 14 | JGI25153J46596_10023422 | 3300003215 | Bacteria | 2252 |
| 15 | rootL2_10009775 | 3300003322 | Bacteria | 20349 |
| 16 | rootL2_10055562 | 3300003322 | Bacteria | 1776 |
| 17 | JGI25160J50197_1000236 | 3300003354 | Bacteria | 42883 |
| 18 | JGI25160J50197_1022107 | 3300003354 | Bacteria | 1871 |
| 19 | JGI25160J50197_1022774 | 3300003354 | Bacteria | 1828 |
| 20 | JGI25161J50226_1006817 | 3300003374 | Bacteria | 2005 |
| 21 | JGI25161J50226_1006882 | 3300003374 | Bacteria | 1991 |
| 22 | Ga0055527_1000474 | 3300003760 | Bacteria | 15081 |
| 23 | Ga0055527_1002538 | 3300003760 | Bacteria | 3033 |
| 24 | Ga0055535_1001024 | 3300003761 | Bacteria | 17756 |
| 25 | Ga0055535_1004998 | 3300003761 | Bacteria | 3033 |
| 26 | Ga0055542_1001021 | 3300003762 | Bacteria | 17756 |
| 27 | Ga0055542_1005095 | 3300003762 | Bacteria | 3033 |
| 28 | Ga0055529_1000848 | 3300003763 | Bacteria | 17756 |
| 29 | Ga0055529_1004753 | 3300003763 | Bacteria | 2038 |
| 30 | Ga0055526_1024175 | 3300003771 | Bacteria | 1999 |
| 31 | Ga0055526_1024266 | 3300003771 | Bacteria | 1991 |
| 32 | Ga0055537_1000150 | 3300003773 | Bacteria | 52097 |
| 33 | Ga0055537_1010462 | 3300003773 | Bacteria | 1954 |
| 34 | Ga0055524_1023190 | 3300003775 | Bacteria | 2005 |
| 35 | Ga0055536_1015488 | 3300003781 | Bacteria | 2606 |
| 36 | Ga0055536_1017660 | 3300003781 | Bacteria | 2324 |
| 37 | Ga0055534_1000016 | 3300003784 | Bacteria | 144444 |
| 38 | Ga0055534_1011279 | 3300003784 | Bacteria | 1825 |
| 39 | Ga0055528_1000894 | 3300003790 | Bacteria | 20125 |
| 40 | Ga0055528_1010911 | 3300003790 | Bacteria | 3651 |
| 41 | Ga0055528_1022580 | 3300003790 | Bacteria | 1954 |
| 42 | Ga0055530_10002826 | 3300003791 | Bacteria | 10654 |
| 43 | Ga0055530_10005609 | 3300003791 | Bacteria | 5893 |
| 44 | Ga0055540_1010029 | 3300003792 | Bacteria | 3193 |
| 45 | Ga0055540_1012059 | 3300003792 | Bacteria | 2740 |
| 46 | Ga0055540_1012085 | 3300003792 | Bacteria | 2736 |
| 47 | Ga0055540_1012688 | 3300003792 | Bacteria | 2626 |
| 48 | Ga0055540_1019961 | 3300003792 | Bacteria | 1789 |
| 49 | Ga0055531_10015213 | 3300003794 | Bacteria | 3409 |
| 50 | Ga0055531_10020363 | 3300003794 | Bacteria | 2626 |
| 51 | Ga0055531_10028252 | 3300003794 | Bacteria | 1940 |
| 52 | Ga0058692_1004345 | 3300003856 | Bacteria | 4212 |
| 53 | Ga0055543_1005291 | 3300004625 | Bacteria | 3322 |
| 54 | Ga0055543_1006975 | 3300004625 | Bacteria | 2662 |
| 55 | Ga0065165_1003383 | 3300005262 | Bacteria | 11278 |
| 56 | Ga0065165_1013354 | 3300005262 | Bacteria | 3271 |
| 57 | Ga0065165_1020086 | 3300005262 | Bacteria | 2364 |
| 58 | Ga0065714_10003179 | 3300005288 | Bacteria | 12607 |
| 59 | Ga0065714_10094920 | 3300005288 | Bacteria | 1793 |
| 60 | Ga0065707_10088077 | 3300005295 | Bacteria | 4789 |
| 61 | Ga0070658_10122685 | 3300005327 | Bacteria | 2160 |
| 62 | Ga0070690_100000075 | 3300005330 | Bacteria | 48451 |
| 63 | Ga0070670_100020310 | 3300005331 | Bacteria | 5707 |
| 64 | Ga0070670_100105881 | 3300005331 | Bacteria | 2423 |
| 65 | Ga0070677_10010516 | 3300005333 | Bacteria | 3167 |
| 66 | Ga0068869_100000841 | 3300005334 | Bacteria | 17573 |
| 67 | Ga0068869_100255259 | 3300005334 | Bacteria | 1402 |
| 68 | Ga0070666_10382839 | 3300005335 | Bacteria | 1010 |
| 69 | Ga0070680_100001183 | 3300005336 | Bacteria | 18770 |
| 70 | Ga0070682_100002153 | 3300005337 | Bacteria | 10935 |
| 71 | Ga0068868_100000329 | 3300005338 | Bacteria | 31993 |
| 72 | Ga0068868_100151365 | 3300005338 | Bacteria | 1911 |
| 73 | Ga0070689_100000481 | 3300005340 | Bacteria | 23552 |
| 74 | Ga0070689_100155762 | 3300005340 | Bacteria | 1844 |
| 75 | Ga0070691_10000399 | 3300005341 | Bacteria | 15765 |
| 76 | Ga0070687_100000014 | 3300005343 | Bacteria | 57432 |
| 77 | Ga0070687_100111412 | 3300005343 | Bacteria | 1549 |
| 78 | Ga0070661_100028727 | 3300005344 | Bacteria | 4012 |
| 79 | Ga0070692_10000041 | 3300005345 | Bacteria | 24940 |
| 80 | Ga0070675_100009449 | 3300005354 | Bacteria | 7589 |
| 81 | Ga0070675_100196077 | 3300005354 | Bacteria | 1751 |
| 82 | Ga0070671_100228407 | 3300005355 | Bacteria | 1579 |
| 83 | Ga0070671_100276856 | 3300005355 | Bacteria | 1427 |
| 84 | Ga0070674_100006507 | 3300005356 | Bacteria | 6824 |
| 85 | Ga0070673_100028604 | 3300005364 | Bacteria | 4147 |
| 86 | Ga0070673_100438207 | 3300005364 | Bacteria | 1174 |
| 87 | Ga0070667_100241851 | 3300005367 | Bacteria | 1612 |
| 88 | Ga0070703_10001484 | 3300005406 | Bacteria | 7039 |
| 89 | Ga0070714_100602312 | 3300005435 | Bacteria | 1055 |
| 90 | Ga0070701_10000641 | 3300005438 | Bacteria | 12213 |
| 91 | Ga0070705_100000466 | 3300005440 | Bacteria | 23326 |
| 92 | Ga0070700_100001345 | 3300005441 | Bacteria | 12219 |
| 93 | Ga0070700_100202954 | 3300005441 | Bacteria | 1394 |
| 94 | Ga0070694_100000099 | 3300005444 | Bacteria | 41966 |
| 95 | Ga0070694_100048243 | 3300005444 | Bacteria | 2865 |
| 96 | Ga0070708_100040247 | 3300005445 | Bacteria | 4093 |
| 97 | Ga0070663_100110828 | 3300005455 | Bacteria | 2062 |
| 98 | Ga0070663_100137893 | 3300005455 | Bacteria | 1859 |
| 99 | Ga0070678_100161320 | 3300005456 | Bacteria | 1817 |
| 100 | Ga0070662_100139441 | 3300005457 | Bacteria | 1877 |
| 101 | Ga0070681_10004134 | 3300005458 | Bacteria | 13725 |
| 102 | Ga0068867_100000174 | 3300005459 | Bacteria | 41996 |
| 103 | Ga0068867_100001412 | 3300005459 | Bacteria | 16602 |
| 104 | Ga0068867_100051153 | 3300005459 | Bacteria | 3046 |
| 105 | Ga0068867_100142491 | 3300005459 | Bacteria | 1875 |
| 106 | Ga0068867_100161679 | 3300005459 | Bacteria | 1766 |
| 107 | Ga0070679_100008012 | 3300005530 | Bacteria | 9922 |
| 108 | Ga0070679_100427909 | 3300005530 | Bacteria | 1269 |
| 109 | Ga0070679_100452585 | 3300005530 | Bacteria | 1228 |
| 110 | Ga0068853_100009734 | 3300005539 | Bacteria | 7753 |
| 111 | Ga0068853_100169141 | 3300005539 | Bacteria | 1977 |
| 112 | Ga0068853_100182792 | 3300005539 | Bacteria | 1902 |
| 113 | Ga0068853_100231983 | 3300005539 | Bacteria | 1689 |
| 114 | Ga0068853_100382396 | 3300005539 | Bacteria | 1315 |
| 115 | Ga0070672_100054132 | 3300005543 | Bacteria | 3140 |
| 116 | Ga0070686_100000134 | 3300005544 | Bacteria | 51357 |
| 117 | Ga0070695_100000018 | 3300005545 | Bacteria | 63499 |
| 118 | Ga0070695_100020478 | 3300005545 | Bacteria | 4040 |
| 119 | Ga0070696_100000384 | 3300005546 | Bacteria | 27119 |
| 120 | Ga0070696_100295433 | 3300005546 | Bacteria | 1239 |
| 121 | Ga0070693_100000021 | 3300005547 | Bacteria | 59618 |
| 122 | Ga0070665_100090933 | 3300005548 | Bacteria | 3058 |
| 123 | Ga0070665_100152237 | 3300005548 | Bacteria | 2316 |
| 124 | Ga0070665_100368261 | 3300005548 | Bacteria | 1444 |
| 125 | Ga0070704_100000043 | 3300005549 | Bacteria | 42411 |
| 126 | Ga0068855_100001327 | 3300005563 | Bacteria | 30611 |
| 127 | Ga0068855_100009203 | 3300005563 | Bacteria | 11929 |
| 128 | Ga0068854_100353393 | 3300005578 | Bacteria | 1204 |
| 129 | Ga0070702_100000007 | 3300005615 | Bacteria | 65238 |
| 130 | Ga0070702_100108515 | 3300005615 | Bacteria | 1716 |
| 131 | Ga0068852_100003873 | 3300005616 | Bacteria | 10512 |
| 132 | Ga0068852_100160858 | 3300005616 | Bacteria | 2096 |
| 133 | Ga0068859_100003085 | 3300005617 | Bacteria | 16902 |
| 134 | Ga0068859_100005193 | 3300005617 | Bacteria | 13229 |
| 135 | Ga0068864_100024915 | 3300005618 | Bacteria | 5034 |
| 136 | Ga0068866_10000561 | 3300005718 | Bacteria | 16983 |
| 137 | Ga0068866_10002518 | 3300005718 | Bacteria | 7545 |
| 138 | Ga0068861_100000632 | 3300005719 | Bacteria | 20851 |
| 139 | Ga0068861_100001082 | 3300005719 | Bacteria | 16840 |
| 140 | Ga0068861_100062852 | 3300005719 | Bacteria | 2853 |
| 141 | Ga0068851_10003399 | 3300005834 | Bacteria | 7083 |
| 142 | Ga0068851_10048817 | 3300005834 | Bacteria | 2146 |
| 143 | Ga0068870_10035250 | 3300005840 | Bacteria | 2566 |
| 144 | Ga0068858_100000334 | 3300005842 | Bacteria | 49778 |
| 145 | Ga0068858_100341344 | 3300005842 | Bacteria | 1433 |
| 146 | Ga0068860_100001410 | 3300005843 | Bacteria | 26069 |
| 147 | Ga0068860_100009209 | 3300005843 | Bacteria | 9814 |
| 148 | Ga0068862_100000688 | 3300005844 | Bacteria | 34533 |
| 149 | Ga0068862_100033181 | 3300005844 | Bacteria | 4362 |
| 150 | Ga0068862_100035210 | 3300005844 | Bacteria | 4238 |
| 151 | Ga0068862_100173873 | 3300005844 | Bacteria | 1929 |
| 152 | Ga0081455_10000306 | 3300005937 | Bacteria | 64656 |
| 153 | Ga0081540_1000611 | 3300005983 | Bacteria | 34020 |
| 154 | Ga0075365_10028907 | 3300006038 | Bacteria | 3538 |
| 155 | Ga0075365_10033864 | 3300006038 | Bacteria | 3295 |
| 156 | Ga0075363_100052882 | 3300006048 | Bacteria | 2169 |
| 157 | Ga0075363_100053902 | 3300006048 | Bacteria | 2150 |
| 158 | Ga0075363_100167069 | 3300006048 | Bacteria | 1248 |
| 159 | Ga0075363_100226536 | 3300006048 | Bacteria | 1072 |
| 160 | Ga0075364_10028512 | 3300006051 | Bacteria | 3574 |
| 161 | Ga0075367_10015540 | 3300006178 | Bacteria | 4142 |
| 162 | Ga0075367_10042080 | 3300006178 | Bacteria | 2672 |
| 163 | Ga0075366_10000612 | 3300006195 | Bacteria | 16757 |
| 164 | Ga0075366_10002010 | 3300006195 | Bacteria | 10317 |
| 165 | Ga0075366_10002408 | 3300006195 | Bacteria | 9596 |
| 166 | Ga0075366_10003773 | 3300006195 | Bacteria | 8055 |
| 167 | Ga0075366_10012757 | 3300006195 | Bacteria | 4774 |
| 168 | Ga0075366_10027241 | 3300006195 | Bacteria | 3352 |
| 169 | Ga0075366_10028016 | 3300006195 | Bacteria | 3305 |
| 170 | Ga0075366_10063050 | 3300006195 | Bacteria | 2203 |
| 171 | Ga0097621_100000593 | 3300006237 | Bacteria | 25510 |
| 172 | Ga0097621_100065343 | 3300006237 | Bacteria | 2994 |
| 173 | Ga0075370_10000304 | 3300006353 | Bacteria | 17728 |
| 174 | Ga0075370_10004349 | 3300006353 | Bacteria | 6866 |
| 175 | Ga0075370_10033537 | 3300006353 | Bacteria | 2875 |
| 176 | Ga0075370_10050547 | 3300006353 | Bacteria | 2358 |
| 177 | Ga0075370_10075368 | 3300006353 | Bacteria | 1934 |
| 178 | Ga0075370_10104915 | 3300006353 | Bacteria | 1638 |
| 179 | Ga0068871_100000157 | 3300006358 | Bacteria | 44850 |
| 180 | Ga0068871_100472197 | 3300006358 | Bacteria | 1127 |
| 181 | Ga0068871_100625271 | 3300006358 | Bacteria | 981 |
| 182 | Ga0075428_100005860 | 3300006844 | Bacteria | 13651 |
| 183 | Ga0075428_100080905 | 3300006844 | Bacteria | 3546 |
| 184 | Ga0075431_100127398 | 3300006847 | Bacteria | 2627 |
| 185 | Ga0068865_100000296 | 3300006881 | Bacteria | 27405 |
| 186 | Ga0068865_100000553 | 3300006881 | Bacteria | 20780 |
| 187 | Ga0097620_100003085 | 3300006931 | Bacteria | 16902 |
| 188 | Ga0097620_100005193 | 3300006931 | Bacteria | 13229 |
| 189 | Ga0079104_1000004 | 3300006946 | Bacteria | 444549 |
| 190 | Ga0099826_10000101 | 3300006948 | Bacteria | 40408 |
| 191 | Ga0099826_10071922 | 3300006948 | Bacteria | 2192 |
| 192 | Ga0105251_10000652 | 3300009011 | Bacteria | 31993 |
| 193 | Ga0105244_10033478 | 3300009036 | Bacteria | 2708 |
| 194 | Ga0105250_10005698 | 3300009092 | Bacteria | 5559 |
| 195 | Ga0105250_10030250 | 3300009092 | Bacteria | 2177 |
| 196 | Ga0105240_10021677 | 3300009093 | Bacteria | 8542 |
| 197 | Ga0105240_10022829 | 3300009093 | Bacteria | 8290 |
| 198 | Ga0105240_10211209 | 3300009093 | Bacteria | 2268 |
| 199 | Ga0105240_10366625 | 3300009093 | Bacteria | 1630 |
| 200 | Ga0111539_10028937 | 3300009094 | Bacteria | 6756 |
| 201 | Ga0111539_10042602 | 3300009094 | Bacteria | 5449 |
| 202 | Ga0111539_10049002 | 3300009094 | Bacteria | 5041 |
| 203 | Ga0111539_10522649 | 3300009094 | Bacteria | 1383 |
| 204 | Ga0105245_10000405 | 3300009098 | Bacteria | 40004 |
| 205 | Ga0105243_10000466 | 3300009148 | Bacteria | 41868 |
| 206 | Ga0105243_10000719 | 3300009148 | Bacteria | 31784 |
| 207 | Ga0105243_10060016 | 3300009148 | Bacteria | 3037 |
| 208 | Ga0105243_10063896 | 3300009148 | Bacteria | 2952 |
| 209 | Ga0105243_10201690 | 3300009148 | Bacteria | 1745 |
| 210 | Ga0105241_10021114 | 3300009174 | Bacteria | 4814 |
| 211 | Ga0105242_10000191 | 3300009176 | Bacteria | 47337 |
| 212 | Ga0105242_10244772 | 3300009176 | Bacteria | 1614 |
| 213 | Ga0105242_10309329 | 3300009176 | Bacteria | 1445 |
| 214 | Ga0105248_10127252 | 3300009177 | Bacteria | 2874 |
| 215 | Ga0105248_10477111 | 3300009177 | Bacteria | 1406 |
| 216 | Ga0105237_10000678 | 3300009545 | Bacteria | 47128 |
| 217 | Ga0105237_10209704 | 3300009545 | Bacteria | 1948 |
| 218 | Ga0105238_10003760 | 3300009551 | Bacteria | 15075 |
| 219 | Ga0105238_10012462 | 3300009551 | Bacteria | 8575 |
| 220 | Ga0105249_10000555 | 3300009553 | Bacteria | 34420 |
| 221 | Ga0105249_10056979 | 3300009553 | Bacteria | 3578 |
| 222 | Ga0105239_10002757 | 3300010375 | Bacteria | 22054 |
| 223 | Ga0105239_10018903 | 3300010375 | Bacteria | 7613 |
| 224 | Ga0105246_10147351 | 3300011119 | Bacteria | 1778 |
| 225 | Ga0157322_1002519 | 3300012490 | Bacteria | 1040 |
| 226 | Ga0157373_10014339 | 3300013100 | Bacteria | 5809 |
| 227 | Ga0157373_10072985 | 3300013100 | Bacteria | 2422 |
| 228 | Ga0157371_10033489 | 3300013102 | Bacteria | 3691 |
| 229 | Ga0157371_10083264 | 3300013102 | Bacteria | 2265 |
| 230 | Ga0157370_10010321 | 3300013104 | Bacteria | 9852 |
| 231 | Ga0157370_10041067 | 3300013104 | Bacteria | 4465 |
| 232 | Ga0157370_10062545 | 3300013104 | Bacteria | 3529 |
| 233 | Ga0157369_10018665 | 3300013105 | Bacteria | 7775 |
| 234 | Ga0157369_10049404 | 3300013105 | Bacteria | 4560 |
| 235 | Ga0157378_10000196 | 3300013297 | Bacteria | 58849 |
| 236 | Ga0157378_10003317 | 3300013297 | Bacteria | 14316 |
| 237 | Ga0163162_10002473 | 3300013306 | Bacteria | 17455 |
| 238 | Ga0163162_10028904 | 3300013306 | Bacteria | 5487 |
| 239 | Ga0163162_10124882 | 3300013306 | Bacteria | 2679 |
| 240 | Ga0163162_10282771 | 3300013306 | Bacteria | 1791 |
| 241 | Ga0163162_10312725 | 3300013306 | Bacteria | 1703 |
| 242 | Ga0163162_10417876 | 3300013306 | Bacteria | 1473 |
| 243 | Ga0163162_10427937 | 3300013306 | Bacteria | 1456 |
| 244 | Ga0157372_10001008 | 3300013307 | Bacteria | 30796 |
| 245 | Ga0157375_10109862 | 3300013308 | Bacteria | 2854 |
| 246 | Ga0157375_10292063 | 3300013308 | Bacteria | 1793 |
| 247 | Ga0157375_10751390 | 3300013308 | Bacteria | 1126 |
| 248 | Ga0163163_10095631 | 3300014325 | Bacteria | 2990 |
| 249 | Ga0163163_10698720 | 3300014325 | Bacteria | 1078 |
| 250 | Ga0157380_10004926 | 3300014326 | Bacteria | 9308 |
| 251 | Ga0157380_10222744 | 3300014326 | Bacteria | 1689 |
| 252 | Ga0182008_10021576 | 3300014497 | Bacteria | 3306 |
| 253 | Ga0157379_10011748 | 3300014968 | Bacteria | 7646 |
| 254 | Ga0182006_1005908 | 3300015261 | Bacteria | 5760 |
| 255 | Ga0182006_1007662 | 3300015261 | Bacteria | 4932 |
| 256 | Ga0182007_10000853 | 3300015262 | Bacteria | 16919 |
| 257 | Ga0182007_10003308 | 3300015262 | Bacteria | 7639 |
| 258 | Ga0182007_10003412 | 3300015262 | Bacteria | 7488 |
| 259 | Ga0182007_10029230 | 3300015262 | Bacteria | 1888 |
| 260 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 261 | Ga0163161_10016046 | 3300017792 | Bacteria | 5228 |
| 262 | Ga0163161_10022442 | 3300017792 | Bacteria | 4445 |
| 263 | Ga0163161_10054961 | 3300017792 | Bacteria | 2890 |
| 264 | Ga0163161_10089849 | 3300017792 | Bacteria | 2272 |
| 265 | Ga0163161_10195599 | 3300017792 | Bacteria | 1556 |
| 266 | Ga0213875_10000216 | 3300021388 | Bacteria | 58475 |
| 267 | Ga0209436_111171 | 3300025208 | Bacteria | 1593 |
| 268 | Ga0209436_112461 | 3300025208 | Bacteria | 1441 |
| 269 | Ga0209672_100035 | 3300025228 | Bacteria | 303111 |
| 270 | Ga0209672_100040 | 3300025228 | Bacteria | 278858 |
| 271 | Ga0209672_100378 | 3300025228 | Bacteria | 27209 |
| 272 | Ga0209147_100041 | 3300025229 | Bacteria | 303111 |
| 273 | Ga0209147_100048 | 3300025229 | Bacteria | 278858 |
| 274 | Ga0209147_100696 | 3300025229 | Bacteria | 17227 |
| 275 | Ga0209258_100063 | 3300025242 | Bacteria | 303577 |
| 276 | Ga0209258_100070 | 3300025242 | Bacteria | 278858 |
| 277 | Ga0209258_100093 | 3300025242 | Bacteria | 223559 |
| 278 | Ga0207425_1001814 | 3300025245 | Bacteria | 8276 |
| 279 | Ga0207425_1007722 | 3300025245 | Bacteria | 2810 |
| 280 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 281 | Ga0209148_1000311 | 3300025254 | Bacteria | 69457 |
| 282 | Ga0209148_1000450 | 3300025254 | Bacteria | 45050 |
| 283 | Ga0209129_1000024 | 3300025258 | Bacteria | 417268 |
| 284 | Ga0209129_1004707 | 3300025258 | Bacteria | 5185 |
| 285 | Ga0209129_1021638 | 3300025258 | Bacteria | 1174 |
| 286 | Ga0209565_1000098 | 3300025263 | Bacteria | 132021 |
| 287 | Ga0209565_1000633 | 3300025263 | Bacteria | 22947 |
| 288 | Ga0209565_1005528 | 3300025263 | Bacteria | 3655 |
| 289 | Ga0209565_1007756 | 3300025263 | Bacteria | 2863 |
| 290 | Ga0209455_1000351 | 3300025272 | Bacteria | 43193 |
| 291 | Ga0209455_1000780 | 3300025272 | Bacteria | 17808 |
| 292 | Ga0209673_1000030 | 3300025273 | Bacteria | 351933 |
| 293 | Ga0209673_1000058 | 3300025273 | Bacteria | 269028 |
| 294 | Ga0209673_1001185 | 3300025273 | Bacteria | 28137 |
| 295 | Ga0209673_1002178 | 3300025273 | Bacteria | 14443 |
| 296 | Ga0209673_1028050 | 3300025273 | Bacteria | 1821 |
| 297 | Ga0209130_1000654 | 3300025284 | Bacteria | 31825 |
| 298 | Ga0209130_1001114 | 3300025284 | Bacteria | 19756 |
| 299 | Ga0209675_1000010 | 3300025291 | Bacteria | 541927 |
| 300 | Ga0209675_1000151 | 3300025291 | Bacteria | 91172 |
| 301 | Ga0209675_1000431 | 3300025291 | Bacteria | 33567 |
| 302 | Ga0209675_1002776 | 3300025291 | Bacteria | 8744 |
| 303 | Ga0209675_1023061 | 3300025291 | Bacteria | 1621 |
| 304 | Ga0209676_1000028 | 3300025292 | Bacteria | 559745 |
| 305 | Ga0209676_1000333 | 3300025292 | Bacteria | 90785 |
| 306 | Ga0209676_1002526 | 3300025292 | Bacteria | 12760 |
| 307 | Ga0209676_1005235 | 3300025292 | Bacteria | 6871 |
| 308 | Ga0209676_1014874 | 3300025292 | Bacteria | 2898 |
| 309 | Ga0209676_1037188 | 3300025292 | Bacteria | 1407 |
| 310 | Ga0209025_1000685 | 3300025294 | Bacteria | 58093 |
| 311 | Ga0209025_1001904 | 3300025294 | Bacteria | 24327 |
| 312 | Ga0209025_1008279 | 3300025294 | Bacteria | 7509 |
| 313 | Ga0209025_1008530 | 3300025294 | Bacteria | 7360 |
| 314 | Ga0209564_1000209 | 3300025295 | Bacteria | 133651 |
| 315 | Ga0209564_1002281 | 3300025295 | Bacteria | 15652 |
| 316 | Ga0209564_1006924 | 3300025295 | Bacteria | 5965 |
| 317 | Ga0209758_1000049 | 3300025297 | Bacteria | 345104 |
| 318 | Ga0209758_1005721 | 3300025297 | Bacteria | 9380 |
| 319 | Ga0209050_1000072 | 3300025298 | Bacteria | 293619 |
| 320 | Ga0209050_1000721 | 3300025298 | Bacteria | 48376 |
| 321 | Ga0209050_1000927 | 3300025298 | Bacteria | 38487 |
| 322 | Ga0209050_1037603 | 3300025298 | Bacteria | 1394 |
| 323 | Ga0209256_1000088 | 3300025299 | Bacteria | 217236 |
| 324 | Ga0209256_1004126 | 3300025299 | Bacteria | 9396 |
| 325 | Ga0207426_1000021 | 3300025302 | Bacteria | 556343 |
| 326 | Ga0207426_1000038 | 3300025302 | Bacteria | 441522 |
| 327 | Ga0207426_1000053 | 3300025302 | Bacteria | 384818 |
| 328 | Ga0207426_1003265 | 3300025302 | Bacteria | 9064 |
| 329 | Ga0209051_1000015 | 3300025303 | Bacteria | 546798 |
| 330 | Ga0209051_1000056 | 3300025303 | Bacteria | 271616 |
| 331 | Ga0209051_1000424 | 3300025303 | Bacteria | 57966 |
| 332 | Ga0209051_1000545 | 3300025303 | Bacteria | 46076 |
| 333 | Ga0209051_1000757 | 3300025303 | Bacteria | 34605 |
| 334 | Ga0209051_1021185 | 3300025303 | Bacteria | 2776 |
| 335 | Ga0209051_1023463 | 3300025303 | Bacteria | 2564 |
| 336 | Ga0209257_1003278 | 3300025304 | Bacteria | 14122 |
| 337 | Ga0209257_1003691 | 3300025304 | Bacteria | 12748 |
| 338 | Ga0209257_1004686 | 3300025304 | Bacteria | 10280 |
| 339 | Ga0207713_1005069 | 3300025735 | Bacteria | 8367 |
| 340 | Ga0207682_10001551 | 3300025893 | Bacteria | 10540 |
| 341 | Ga0207642_10001932 | 3300025899 | Bacteria | 6396 |
| 342 | Ga0207680_10189332 | 3300025903 | Bacteria | 1396 |
| 343 | Ga0207647_10005484 | 3300025904 | Bacteria | 9288 |
| 344 | Ga0207643_10045223 | 3300025908 | Bacteria | 2486 |
| 345 | Ga0207643_10206139 | 3300025908 | Bacteria | 1199 |
| 346 | Ga0207654_10042125 | 3300025911 | Bacteria | 2582 |
| 347 | Ga0207707_10047840 | 3300025912 | Bacteria | 3724 |
| 348 | Ga0207695_10022456 | 3300025913 | Bacteria | 7159 |
| 349 | Ga0207695_10159606 | 3300025913 | Bacteria | 2187 |
| 350 | Ga0207695_10260834 | 3300025913 | Bacteria | 1630 |
| 351 | Ga0207671_10002997 | 3300025914 | Bacteria | 17310 |
| 352 | Ga0207660_10000284 | 3300025917 | Bacteria | 33488 |
| 353 | Ga0207662_10000063 | 3300025918 | Bacteria | 46662 |
| 354 | Ga0207662_10087984 | 3300025918 | Bacteria | 1907 |
| 355 | Ga0207649_10012026 | 3300025920 | Bacteria | 4788 |
| 356 | Ga0207652_10090395 | 3300025921 | Bacteria | 2690 |
| 357 | Ga0207681_10318310 | 3300025923 | Bacteria | 1236 |
| 358 | Ga0207694_10006188 | 3300025924 | Bacteria | 9139 |
| 359 | Ga0207694_10007970 | 3300025924 | Bacteria | 8007 |
| 360 | Ga0207694_10082026 | 3300025924 | Bacteria | 2534 |
| 361 | Ga0207650_10000877 | 3300025925 | Bacteria | 22751 |
| 362 | Ga0207659_10165588 | 3300025926 | Bacteria | 1740 |
| 363 | Ga0207687_10005404 | 3300025927 | Bacteria | 8446 |
| 364 | Ga0207644_10157439 | 3300025931 | Bacteria | 1763 |
| 365 | Ga0207706_10034754 | 3300025933 | Bacteria | 4484 |
| 366 | Ga0207706_10149924 | 3300025933 | Bacteria | 2051 |
| 367 | Ga0207686_10000623 | 3300025934 | Bacteria | 22054 |
| 368 | Ga0207686_10027163 | 3300025934 | Bacteria | 3349 |
| 369 | Ga0207686_10085311 | 3300025934 | Bacteria | 2071 |
| 370 | Ga0207686_10177720 | 3300025934 | Bacteria | 1507 |
| 371 | Ga0207686_10419549 | 3300025934 | Bacteria | 1023 |
| 372 | Ga0207709_10000019 | 3300025935 | Bacteria | 402225 |
| 373 | Ga0207709_10000958 | 3300025935 | Bacteria | 21596 |
| 374 | Ga0207709_10001025 | 3300025935 | Bacteria | 20674 |
| 375 | Ga0207709_10003409 | 3300025935 | Bacteria | 9494 |
| 376 | Ga0207670_10001140 | 3300025936 | Bacteria | 14016 |
| 377 | Ga0207670_10078891 | 3300025936 | Bacteria | 2297 |
| 378 | Ga0207670_10168924 | 3300025936 | Bacteria | 1638 |
| 379 | Ga0207669_10038190 | 3300025937 | Bacteria | 2762 |
| 380 | Ga0207704_10004232 | 3300025938 | Bacteria | 6560 |
| 381 | Ga0207691_10088070 | 3300025940 | Bacteria | 2784 |
| 382 | Ga0207691_10186589 | 3300025940 | Bacteria | 1810 |
| 383 | Ga0207711_10047691 | 3300025941 | Bacteria | 3664 |
| 384 | Ga0207689_10000214 | 3300025942 | Bacteria | 51325 |
| 385 | Ga0207689_10112010 | 3300025942 | Bacteria | 2243 |
| 386 | Ga0207689_10263351 | 3300025942 | Bacteria | 1426 |
| 387 | Ga0207667_10024635 | 3300025949 | Bacteria | 6603 |
| 388 | Ga0207667_10038913 | 3300025949 | Bacteria | 5072 |
| 389 | Ga0207651_10042034 | 3300025960 | Bacteria | 3038 |
| 390 | Ga0207651_10242270 | 3300025960 | Bacteria | 1470 |
| 391 | Ga0207712_10000849 | 3300025961 | Bacteria | 22242 |
| 392 | Ga0207712_10212381 | 3300025961 | Bacteria | 1542 |
| 393 | Ga0207640_10000972 | 3300025981 | Bacteria | 15897 |
| 394 | Ga0207658_10240123 | 3300025986 | Bacteria | 1534 |
| 395 | Ga0207677_10010717 | 3300026023 | Bacteria | 5196 |
| 396 | Ga0207677_10359633 | 3300026023 | Bacteria | 1222 |
| 397 | Ga0207703_10007007 | 3300026035 | Bacteria | 8969 |
| 398 | Ga0207639_10018508 | 3300026041 | Bacteria | 4951 |
| 399 | Ga0207639_10294033 | 3300026041 | Bacteria | 1433 |
| 400 | Ga0207678_10155630 | 3300026067 | Bacteria | 1951 |
| 401 | Ga0207678_10164182 | 3300026067 | Bacteria | 1896 |
| 402 | Ga0207708_10000117 | 3300026075 | Bacteria | 60989 |
| 403 | Ga0207708_10144778 | 3300026075 | Bacteria | 1867 |
| 404 | Ga0207641_10118767 | 3300026088 | Bacteria | 2356 |
| 405 | Ga0207648_10000293 | 3300026089 | Bacteria | 54504 |
| 406 | Ga0207648_10006211 | 3300026089 | Bacteria | 11905 |
| 407 | Ga0207648_10007082 | 3300026089 | Bacteria | 11068 |
| 408 | Ga0207648_10254656 | 3300026089 | Bacteria | 1565 |
| 409 | Ga0207676_10088988 | 3300026095 | Bacteria | 2529 |
| 410 | Ga0207674_10277622 | 3300026116 | Bacteria | 1623 |
| 411 | Ga0207675_100000218 | 3300026118 | Bacteria | 53850 |
| 412 | Ga0207675_100000819 | 3300026118 | Bacteria | 30952 |
| 413 | Ga0207675_100029740 | 3300026118 | Bacteria | 5087 |
| 414 | Ga0207675_100168829 | 3300026118 | Bacteria | 2090 |
| 415 | Ga0207683_10001266 | 3300026121 | Bacteria | 22940 |
| 416 | Ga0207683_10035360 | 3300026121 | Bacteria | 4344 |
| 417 | Ga0207683_10161133 | 3300026121 | Bacteria | 2028 |
| 418 | Ga0207698_10021889 | 3300026142 | Bacteria | 4430 |
| 419 | Ga0207698_10066310 | 3300026142 | Bacteria | 2841 |
| 420 | Ga0207698_10207444 | 3300026142 | Bacteria | 1760 |
| 421 | Ga0207698_10524408 | 3300026142 | Bacteria | 1157 |
| 422 | Ga0209281_1000005 | 3300027111 | Bacteria | 1242284 |
| 423 | Ga0209371_1000314 | 3300027312 | Bacteria | 53375 |
| 424 | Ga0209282_1001024 | 3300027666 | Bacteria | 14706 |
| 425 | Ga0207428_10022002 | 3300027907 | Bacteria | 5386 |
| 426 | Ga0268266_10018918 | 3300028379 | Bacteria | 5868 |
| 427 | Ga0268265_10009365 | 3300028380 | Bacteria | 6618 |
| 428 | Ga0268265_10019397 | 3300028380 | Bacteria | 4726 |
| 429 | Ga0268264_10000609 | 3300028381 | Bacteria | 42936 |
| 430 | Ga0268264_10006549 | 3300028381 | Bacteria | 9805 |
| 431 | Ga0307515_10000048 | 3300028794 | Bacteria | 288111 |
| 432 | Ga0268256_1000257 | 3300030500 | Bacteria | 56293 |
| 433 | Ga0316177_1185315 | 3300030731 | Bacteria | 3297 |
| 434 | Ga0314311_1019256 | 3300030733 | Bacteria | 3793 |
| 435 | Ga0316183_1181937 | 3300030742 | Bacteria | 5794 |
| 436 | Ga0316181_1066331 | 3300030744 | Bacteria | 1533 |
| 437 | Ga0265327_10000789 | 3300031251 | Bacteria | 48791 |
| 438 | Ga0265316_10093317 | 3300031344 | Bacteria | 2294 |
| 439 | Ga0307513_10009173 | 3300031456 | Bacteria | 12529 |
| 440 | Ga0307513_10110737 | 3300031456 | Bacteria | 2740 |
| 441 | Ga0307408_100050351 | 3300031548 | Bacteria | 2995 |
| 442 | Ga0307408_100291685 | 3300031548 | Bacteria | 1362 |
| 443 | Ga0307508_10022524 | 3300031616 | Bacteria | 5725 |
| 444 | Ga0307514_10004647 | 3300031649 | Bacteria | 12588 |
| 445 | Ga0307405_10019514 | 3300031731 | Bacteria | 3767 |
| 446 | Ga0307405_10101129 | 3300031731 | Bacteria | 1933 |
| 447 | Ga0307405_10155693 | 3300031731 | Bacteria | 1612 |
| 448 | Ga0307405_10357117 | 3300031731 | Bacteria | 1129 |
| 449 | Ga0307410_10122477 | 3300031852 | Bacteria | 1899 |
| 450 | Ga0307410_10124172 | 3300031852 | Bacteria | 1887 |
| 451 | Ga0307406_10005016 | 3300031901 | Bacteria | 7215 |
| 452 | Ga0307406_10130177 | 3300031901 | Bacteria | 1765 |
| 453 | Ga0307416_100178484 | 3300032002 | Bacteria | 1987 |
| 454 | Ga0307414_10054630 | 3300032004 | Bacteria | 2792 |
| 455 | Ga0307411_10026116 | 3300032005 | Bacteria | 3511 |
| 456 | Ga0307411_10418991 | 3300032005 | Bacteria | 1112 |
| 457 | Ga0373926_0008550 | 3300035083 | Bacteria | 3409 |
| 458 | Ga0373944_0025474 | 3300035089 | Bacteria | 1741 |
| 459 | Ga0373944_0073049 | 3300035089 | Bacteria | 1121 |
| 460 | Ga0373936_0013787 | 3300035113 | Bacteria | 3085 |
| 461 | Ga0373936_0024056 | 3300035113 | Bacteria | 2376 |
| 462 | Ga0373945_0002475 | 3300035116 | Bacteria | 5793 |
| 463 | Ga0373957_0064958 | 3300035120 | Bacteria | 1419 |
| 464 | Ga0373943_0002249 | 3300035170 | Bacteria | 8772 |
| 465 | Ga0373943_0036350 | 3300035170 | Bacteria | 2358 |
| 466 | Ga0373946_0014865 | 3300035171 | Bacteria | 2941 |
| 467 | Ga0373955_0007263 | 3300035172 | Bacteria | 5086 |
| 468 | Ga0373942_0122722 | 3300035207 | Bacteria | 813 |
| 469 | Ga0373961_0032273 | 3300035241 | Bacteria | 1468 |
| 470 | Ga0373924_0006212 | 3300035410 | Bacteria | 4272 |
| 471 | Ga0373924_0045161 | 3300035410 | Bacteria | 1812 |
| 472 | Ga0373931_0001350 | 3300035691 | Bacteria | 10502 |
| 473 | Ga0373935_0041207 | 3300035692 | Bacteria | 2900 |
| 474 | Ga0373935_0104694 | 3300035692 | Bacteria | 1870 |
| 475 | Ga0373927_0096889 | 3300035695 | Bacteria | 1917 |
| 476 | Ga0373947_0051400 | 3300035725 | Bacteria | 2479 |
| 477 | Ga0373947_0088908 | 3300035725 | Bacteria | 1923 |
| 478 | Ga0373937_0003903 | 3300036401 | Bacteria | 12612 |
| 479 | Ga0373925_0020270 | 3300037068 | Bacteria | 4838 |
| 480 | Ga0395900_0020164 | 3300037418 | Bacteria | 6802 |
| 481 | Ga0395898_0564306 | 3300037466 | Bacteria | 1081 |
| 482 | Ga0395905_0000143 | 3300037471 | Bacteria | 119088 |
| 483 | Ga0436364_0093683 | 3300037853 | Bacteria | 2162 |
| 484 | Ga0436364_0949154 | 3300037853 | Bacteria | 21318 |
| 485 | Ga0395901_0027907 | 3300038443 | Bacteria | 5805 |
| 486 | Ga0436365_0910371 | 3300039437 | Bacteria | 1177 |
| 487 | Ga0439466_0032648 | 3300041411 | Bacteria | 1773 |
| 488 | Ga0439465_0034032 | 3300041413 | Bacteria | 1630 |
| 489 | Ga0451807_0797333 | 3300041486 | Bacteria | 1828 |
| 490 | Ga0439445_0022254 | 3300042004 | Bacteria | 1598 |
| 491 | Ga0439454_013298 | 3300042011 | Bacteria | 1127 |
| 492 | Ga0450911_000121 | 3300042115 | Bacteria | 31301 |
| 493 | Ga0450910_006925 | 3300042147 | Bacteria | 1571 |
| 494 | Ga0439446_0034131 | 3300042156 | Bacteria | 1480 |
| 495 | Ga0466969_0048521 | 3300044656 | Bacteria | 2099 |
| 496 | Ga0466965_0077550 | 3300044683 | Bacteria | 1678 |
| 497 | Ga0466966_0081171 | 3300044684 | Bacteria | 2019 |
| 498 | Ga0466961_0007552 | 3300044693 | Bacteria | 6921 |
| 499 | Ga0466960_0093023 | 3300044901 | Bacteria | 1540 |
| 500 | Ga0451576_0164603 | 3300045051 | Bacteria | 2314 |
| 501 | Ga0451576_0528201 | 3300045051 | Bacteria | 1240 |
| 502 | Ga0495603_0010042 | 3300046455 | Bacteria | 5727 |
| 503 | Ga0495590_0005072 | 3300046457 | Bacteria | 5251 |
| 504 | Ga0495629_0001862 | 3300046459 | Bacteria | 16500 |
| 505 | Ga0495629_0003276 | 3300046459 | Bacteria | 12252 |
| 506 | Ga0495651_0231285 | 3300046462 | Bacteria | 1273 |
| 507 | Ga0495653_0001825 | 3300046463 | Bacteria | 16782 |
| 508 | Ga0495650_0009826 | 3300046471 | Bacteria | 5402 |
| 509 | Ga0495580_0009565 | 3300046472 | Bacteria | 7615 |
| 510 | Ga0495580_0092192 | 3300046472 | Bacteria | 2108 |
| 511 | Ga0495582_0029835 | 3300046473 | Bacteria | 2994 |
| 512 | Ga0495582_0096432 | 3300046473 | Bacteria | 1653 |
| 513 | Ga0495605_0040379 | 3300046474 | Bacteria | 2331 |
| 514 | Ga0495639_0067193 | 3300046475 | Bacteria | 1651 |
| 515 | Ga0495639_0112842 | 3300046475 | Bacteria | 1291 |
| 516 | Ga0495664_0078697 | 3300046477 | Bacteria | 1975 |
| 517 | Ga0495584_0043651 | 3300046491 | Bacteria | 2263 |
| 518 | Ga0495596_0081033 | 3300046500 | Bacteria | 1260 |
| 519 | Ga0495607_0174456 | 3300046501 | Bacteria | 1083 |
| 520 | Ga0495583_0003388 | 3300046506 | Bacteria | 12206 |
| 521 | Ga0495606_0002910 | 3300046507 | Bacteria | 18924 |
| 522 | Ga0495606_0065786 | 3300046507 | Bacteria | 2302 |
| 523 | Ga0495616_0008804 | 3300046513 | Bacteria | 5944 |
| 524 | Ga0495620_0010769 | 3300046515 | Bacteria | 4809 |
| 525 | Ga0495620_0015706 | 3300046515 | Bacteria | 3814 |
| 526 | Ga0495628_0014353 | 3300046516 | Bacteria | 6640 |
| 527 | Ga0495630_0092996 | 3300046517 | Bacteria | 2279 |
| 528 | Ga0495630_0154977 | 3300046517 | Bacteria | 1744 |
| 529 | Ga0495631_0004715 | 3300046518 | Bacteria | 7206 |
| 530 | Ga0495648_0022103 | 3300046524 | Bacteria | 4388 |
| 531 | Ga0495666_0021882 | 3300046526 | Bacteria | 3165 |
| 532 | Ga0495642_0001048 | 3300046528 | Bacteria | 12850 |
| 533 | Ga0495642_0044563 | 3300046528 | Bacteria | 1811 |
| 534 | Ga0495642_0089135 | 3300046528 | Bacteria | 1305 |
| 535 | Ga0495652_0032596 | 3300046529 | Bacteria | 4555 |
| 536 | Ga0495654_0032632 | 3300046530 | Bacteria | 2639 |
| 537 | Ga0495654_0053084 | 3300046530 | Bacteria | 1971 |
| 538 | Ga0495665_0007068 | 3300046531 | Bacteria | 6057 |
| 539 | Ga0495665_0068089 | 3300046531 | Bacteria | 1877 |
| 540 | Ga0495586_0013899 | 3300046535 | Bacteria | 4272 |
| 541 | Ga0495586_0031911 | 3300046535 | Bacteria | 2824 |
| 542 | Ga0495609_0059027 | 3300046538 | Bacteria | 1696 |
| 543 | Ga0495621_0034393 | 3300046539 | Bacteria | 1751 |
| 544 | Ga0495597_0002220 | 3300046542 | Bacteria | 12714 |
| 545 | Ga0495645_0000267 | 3300046543 | Bacteria | 38642 |
| 546 | Ga0495645_0011058 | 3300046543 | Bacteria | 6343 |
| 547 | Ga0495622_0094936 | 3300046557 | Bacteria | 1369 |
| 548 | Ga0495667_0028052 | 3300046559 | Bacteria | 3791 |
| 549 | Ga0495667_0194740 | 3300046559 | Bacteria | 1298 |
| 550 | Ga0495656_0000646 | 3300046615 | Bacteria | 11165 |
| 551 | Ga0495625_0000950 | 3300046660 | Bacteria | 38751 |
| 552 | Ga0495625_0152705 | 3300046660 | Bacteria | 1551 |
| 553 | Ga0495635_0014095 | 3300046663 | Bacteria | 5594 |
| 554 | Ga0495661_0047151 | 3300046665 | Bacteria | 2625 |
| 555 | Ga0495661_0136270 | 3300046665 | Bacteria | 1340 |
| 556 | Ga0495588_0041992 | 3300046674 | Bacteria | 2337 |
| 557 | Ga0495623_0003659 | 3300046679 | Bacteria | 10157 |
| 558 | Ga0495623_0194717 | 3300046679 | Bacteria | 1169 |
| 559 | Ga0495646_0005877 | 3300046680 | Bacteria | 7779 |
| 560 | Ga0495646_0070380 | 3300046680 | Bacteria | 2061 |
| 561 | Ga0495647_0017673 | 3300046681 | Bacteria | 2526 |
| 562 | Ga0495658_0061416 | 3300046683 | Bacteria | 2158 |
| 563 | Ga0495658_0157973 | 3300046683 | Bacteria | 1396 |
| 564 | Ga0495669_0001642 | 3300046684 | Bacteria | 9200 |
| 565 | Ga0495669_0018189 | 3300046684 | Bacteria | 3020 |
| 566 | Ga0495669_0141329 | 3300046684 | Bacteria | 1137 |
| 567 | Ga0495613_0010203 | 3300046689 | Bacteria | 6978 |
| 568 | Ga0495624_0033774 | 3300046690 | Bacteria | 3312 |
| 569 | Ga0495670_0080427 | 3300046691 | Bacteria | 1660 |
| 570 | Ga0495671_0005567 | 3300046692 | Bacteria | 7360 |
| 571 | Ga0495649_0010601 | 3300046694 | Bacteria | 5431 |
| 572 | Ga0495649_0061486 | 3300046694 | Bacteria | 2019 |
| 573 | Ga0495649_0086426 | 3300046694 | Bacteria | 1674 |
| 574 | Ga0495589_0004109 | 3300046794 | Bacteria | 7791 |
| 575 | Ga0495589_0009291 | 3300046794 | Bacteria | 5113 |
| 576 | Ga0495589_0033787 | 3300046794 | Bacteria | 2568 |
| 577 | Ga0495589_0057640 | 3300046794 | Bacteria | 1910 |
| 578 | Ga0495600_0139997 | 3300046809 | Bacteria | 1570 |
| 579 | Ga0495600_0168793 | 3300046809 | Bacteria | 1413 |
| 580 | Ga0495660_0107095 | 3300046810 | Bacteria | 1431 |
| 581 | Ga0495581_0077415 | 3300047315 | Bacteria | 1924 |
| 582 | Ga0495581_0096401 | 3300047315 | Bacteria | 1717 |
| 583 | Ga0495674_0029512 | 3300047319 | Bacteria | 4993 |
| 584 | Ga0495674_0072476 | 3300047319 | Bacteria | 2971 |
| 585 | Ga0495672_0045150 | 3300047320 | Bacteria | 2639 |
| 586 | Ga0495676_0071720 | 3300047321 | Bacteria | 2662 |
| 587 | Ga0495680_0005821 | 3300047322 | Bacteria | 11538 |
| 588 | Ga0495683_0002721 | 3300047323 | Bacteria | 10537 |
| 589 | Ga0495683_0087906 | 3300047323 | Bacteria | 1509 |
| 590 | Ga0495687_013714 | 3300047443 | Bacteria | 4210 |
| 591 | Ga0495687_016923 | 3300047443 | Bacteria | 3653 |
| 592 | Ga0495687_037893 | 3300047443 | Bacteria | 2144 |
| 593 | Ga0495675_0040988 | 3300047444 | Bacteria | 2951 |
| 594 | Ga0495675_0113718 | 3300047444 | Bacteria | 1688 |
| 595 | Ga0495681_0037485 | 3300047470 | Bacteria | 2387 |
| 596 | Ga0495593_0008842 | 3300047673 | Bacteria | 5845 |
| 597 | Ga0495593_0061066 | 3300047673 | Bacteria | 1972 |
| 598 | Ga0495593_0129545 | 3300047673 | Bacteria | 1281 |
| 599 | Ga0495602_0054300 | 3300048088 | Bacteria | 3538 |
| 600 | Ga0495614_0081426 | 3300048089 | Bacteria | 1402 |
| 601 | Ga0495626_0037680 | 3300048091 | Bacteria | 2296 |
| 602 | Ga0495626_0066559 | 3300048091 | Bacteria | 1629 |
| 603 | Ga0496100_0000588 | 3300048903 | Bacteria | 17165 |
| 604 | Ga0496100_0072467 | 3300048903 | Bacteria | 2302 |
| 605 | Ga0496100_0198895 | 3300048903 | Bacteria | 1459 |
| 606 | Ga0496101_0000441 | 3300048904 | Bacteria | 26552 |
| 607 | Ga0496101_0003078 | 3300048904 | Bacteria | 10311 |
| 608 | Ga0496101_0021260 | 3300048904 | Bacteria | 4457 |
| 609 | Ga0496101_0029055 | 3300048904 | Bacteria | 3865 |
| 610 | Ga0496101_0080802 | 3300048904 | Bacteria | 2402 |
| 611 | Ga0496101_0298499 | 3300048904 | Bacteria | 1261 |
| 612 | Ga0496102_0001021 | 3300048905 | Bacteria | 26096 |
| 613 | Ga0496102_0029784 | 3300048905 | Bacteria | 4884 |
| 614 | Ga0496102_0039923 | 3300048905 | Bacteria | 4243 |
| 615 | Ga0496103_0002188 | 3300048906 | Bacteria | 12407 |
| 616 | Ga0496103_0020307 | 3300048906 | Bacteria | 3990 |
| 617 | Ga0496103_0217298 | 3300048906 | Bacteria | 1229 |
| 618 | Ga0496104_0035535 | 3300048907 | Bacteria | 4652 |
| 619 | Ga0496104_0036114 | 3300048907 | Bacteria | 4617 |
| 620 | Ga0496104_0052227 | 3300048907 | Bacteria | 3860 |
| 621 | Ga0496104_0070305 | 3300048907 | Bacteria | 3327 |
| 622 | Ga0496105_0004053 | 3300048908 | Bacteria | 10967 |
| 623 | Ga0496105_0151423 | 3300048908 | Bacteria | 1906 |
| 624 | Ga0496106_0014372 | 3300048909 | Bacteria | 5849 |
| 625 | Ga0496106_0090127 | 3300048909 | Bacteria | 2366 |
| 626 | Ga0496107_0028871 | 3300048910 | Bacteria | 3944 |
| 627 | Ga0496107_0350196 | 3300048910 | Bacteria | 1099 |
| 628 | Ga0496109_0133660 | 3300048912 | Bacteria | 2317 |
| 629 | Ga0496109_0542091 | 3300048912 | Bacteria | 1098 |
| 630 | Ga0496110_0015898 | 3300048913 | Bacteria | 6275 |
| 631 | Ga0496110_0052040 | 3300048913 | Bacteria | 3599 |
| 632 | Ga0496110_0056966 | 3300048913 | Bacteria | 3439 |
| 633 | Ga0496110_0080316 | 3300048913 | Bacteria | 2905 |
| 634 | Ga0496111_0012891 | 3300048914 | Bacteria | 5672 |
| 635 | Ga0496111_0017568 | 3300048914 | Bacteria | 4945 |
| 636 | Ga0496112_0017573 | 3300048915 | Bacteria | 6723 |
| 637 | Ga0496112_0287886 | 3300048915 | Bacteria | 1589 |
| 638 | Ga0496113_0005804 | 3300048916 | Bacteria | 7745 |
| 639 | Ga0496113_0006028 | 3300048916 | Bacteria | 7634 |
| 640 | Ga0496114_0081997 | 3300048917 | Bacteria | 2725 |
| 641 | Ga0496114_0123552 | 3300048917 | Bacteria | 2228 |
| 642 | Ga0496117_0002412 | 3300048920 | Bacteria | 23744 |
| 643 | Ga0496117_0015225 | 3300048920 | Bacteria | 6575 |
| 644 | Ga0496117_0041471 | 3300048920 | Bacteria | 3372 |
| 645 | Ga0496117_0058083 | 3300048920 | Bacteria | 2681 |
| 646 | Ga0496118_0003264 | 3300048921 | Bacteria | 20662 |
| 647 | Ga0496118_0007454 | 3300048921 | Bacteria | 11588 |
| 648 | Ga0496120_0102737 | 3300048923 | Bacteria | 1507 |
| 649 | Ga0496121_0001535 | 3300048924 | Bacteria | 38642 |
| 650 | Ga0496121_0004607 | 3300048924 | Bacteria | 18369 |
| 651 | Ga0496121_0005075 | 3300048924 | Bacteria | 17179 |
| 652 | Ga0496121_0013189 | 3300048924 | Bacteria | 8907 |
| 653 | Ga0496121_0029050 | 3300048924 | Bacteria | 5127 |
| 654 | Ga0496121_0062280 | 3300048924 | Bacteria | 3056 |
| 655 | Ga0496122_0015406 | 3300048925 | Bacteria | 7312 |
| 656 | Ga0496122_0129383 | 3300048925 | Bacteria | 1608 |
| 657 | Ga0496122_0140468 | 3300048925 | Bacteria | 1512 |
| 658 | Ga0496122_0175141 | 3300048925 | Bacteria | 1287 |
| 659 | Ga0496123_0006720 | 3300048926 | Bacteria | 11069 |
| 660 | Ga0496124_0037502 | 3300048927 | Bacteria | 4215 |
| 661 | Ga0496124_0056547 | 3300048927 | Bacteria | 3308 |
| 662 | Ga0496124_0250646 | 3300048927 | Bacteria | 1310 |
| 663 | Ga0496125_0007748 | 3300048928 | Bacteria | 11366 |
| 664 | Ga0496125_0021863 | 3300048928 | Bacteria | 5953 |
| 665 | Ga0496125_0086876 | 3300048928 | Bacteria | 2363 |
| 666 | Ga0496125_0140353 | 3300048928 | Bacteria | 1681 |
| 667 | Ga0496125_0175578 | 3300048928 | Bacteria | 1434 |
| 668 | Ga0496126_0194457 | 3300048929 | Bacteria | 1716 |
| 669 | Ga0496126_0334635 | 3300048929 | Bacteria | 1242 |
| 670 | Ga0495682_0020288 | 3300049460 | Bacteria | 2495 |
| 671 | Ga0495682_0067669 | 3300049460 | Bacteria | 1287 |
| 672 | Ga0501067_0056711 | 3300049583 | Bacteria | 2170 |
| 673 | Ga0501249_006316 | 3300049679 | Bacteria | 2438 |
| 674 | Ga0501225_0014791 | 3300049705 | Bacteria | 2176 |
| 675 | Ga0501262_000611 | 3300049759 | Bacteria | 4194 |
| 676 | nmdc:mga03683_75008_c1 | 3300050489 | Bacteria | 1452 |
| 677 | nmdc:mga03n38_109414_c1 | 3300050490 | Bacteria | 1344 |
| 678 | nmdc:mga03n38_18792_c1 | 3300050490 | Bacteria | 2734 |
| 679 | nmdc:mga00v17_230093_c1 | 3300050491 | Bacteria | 1201 |
| 680 | nmdc:mga00v17_8095_c1 | 3300050491 | Bacteria | 3123 |
| 681 | nmdc:mga0yw44_70737_c1 | 3300050492 | Bacteria | 2164 |
| 682 | nmdc:mga0k408_10844_c1 | 3300050493 | Bacteria | 4942 |
| 683 | nmdc:mga0k408_137917_c1 | 3300050493 | Bacteria | 1450 |
| 684 | nmdc:mga0k408_2586_c1 | 3300050493 | Bacteria | 9608 |
| 685 | nmdc:mga0k408_2741_c1 | 3300050493 | Bacteria | 9364 |
| 686 | nmdc:mga0k408_27979_c1 | 3300050493 | Bacteria | 3204 |
| 687 | nmdc:mga0k408_423_c1 | 3300050493 | Bacteria | 23086 |
| 688 | nmdc:mga0k408_53260_c1 | 3300050493 | Bacteria | 2345 |
| 689 | nmdc:mga0k408_56752_c1 | 3300050493 | Bacteria | 2273 |
| 690 | nmdc:mga0k408_5696_c2 | 3300050493 | Bacteria | 5089 |
| 691 | nmdc:mga07m45_280779_c1 | 3300050496 | Bacteria | 969 |
| 692 | nmdc:mga07m45_31422_c1 | 3300050496 | Bacteria | 2943 |
| 693 | nmdc:mga07m45_38151_c1 | 3300050496 | Bacteria | 2681 |
| 694 | nmdc:mga07m45_44961_c1 | 3300050496 | Bacteria | 2479 |
| 695 | nmdc:mga07m45_4636_c1 | 3300050496 | Bacteria | 6743 |
| 696 | nmdc:mga07m45_53556_c1 | 3300050496 | Bacteria | 2280 |
| 697 | nmdc:mga07m45_8146_c2 | 3300050496 | Bacteria | 4195 |
| 698 | nmdc:mga09592_6513_c1 | 3300050508 | Bacteria | 9516 |
| 699 | nmdc:mga06r32_209111_c1 | 3300050510 | Bacteria | 1939 |
| 700 | nmdc:mga08y16_205949_c1 | 3300050511 | Bacteria | 2038 |
| 701 | nmdc:mga08y16_25553_c1 | 3300050511 | Bacteria | 6230 |
| 702 | nmdc:mga0a205_299725_c1 | 3300050515 | Bacteria | 1480 |
| 703 | nmdc:mga0sz30_81541_c1 | 3300050516 | Bacteria | 1400 |
| 704 | Ga0500610_0017353 | 3300053079 | Bacteria | 3456 |
| 705 | Ga0500651_0000347 | 3300053093 | Bacteria | 26028 |
| 706 | Ga0500572_035712 | 3300053111 | Bacteria | 1415 |
| 707 | Ga0500593_001062 | 3300053117 | Bacteria | 9919 |
| 708 | Ga0500594_0001635 | 3300053118 | Bacteria | 4874 |
| 709 | Ga0500607_029808 | 3300053121 | Bacteria | 3012 |
| 710 | Ga0500618_025387 | 3300053125 | Bacteria | 1421 |
| 711 | Ga0500626_021140 | 3300053128 | Bacteria | 2899 |
| 712 | Ga0500658_0002780 | 3300053134 | Bacteria | 6714 |
| 713 | Ga0500658_0013278 | 3300053134 | Bacteria | 3042 |
| 714 | Ga0500559_0022801 | 3300053136 | Bacteria | 2655 |
| 715 | Ga0500559_0103377 | 3300053136 | Bacteria | 1314 |
| 716 | Ga0500559_0143023 | 3300053136 | Bacteria | 1120 |
| 717 | Ga0500564_074863 | 3300053138 | Bacteria | 1523 |
| 718 | Ga0500568_0011721 | 3300053139 | Bacteria | 4052 |
| 719 | Ga0500577_0074078 | 3300053142 | Bacteria | 1342 |
| 720 | Ga0500616_0004050 | 3300053153 | Bacteria | 10655 |
| 721 | Ga0500616_0066404 | 3300053153 | Bacteria | 1852 |
| 722 | Ga0500627_0045518 | 3300053158 | Bacteria | 1899 |
| 723 | Ga0500636_0085584 | 3300053177 | Bacteria | 1811 |
| 724 | Ga0500565_000833 | 3300053734 | Bacteria | 1863 |
| 725 | 2722884340 | 2721755523 | Bacteria | 6430384 |
| 726 | 2513230084 | 2513020051 | Bacteria | 6053213 |
| 727 | 2514049699 | 2513237166 | Bacteria | 10373764 |
| 728 | 2563060565 | 2562617112 | Bacteria | 10918404 |
| 729 | 2599620566 | 2599185214 | Bacteria | 8209958 |
| 730 | 2599673865 | 2599185226 | Bacteria | 8233575 |
| 731 | 2599678818 | 2599185227 | Bacteria | 8246414 |
| 732 | 2599690077 | 2599185229 | Bacteria | 8216126 |
| 733 | 2644162170 | 2643221628 | Bacteria | 5745828 |
| 734 | 2644324293 | 2643221658 | Bacteria | 6064537 |
| 735 | 2644396134 | 2643221672 | Bacteria | 6322190 |
| 736 | 2644464954 | 2643221683 | Bacteria | 5749203 |
| 737 | 2713475742 | 2711768613 | Bacteria | 11048459 |
| 738 | 2738720460 | 2738541277 | Bacteria | 7458140 |
| 739 | 2739250123 | 2738543013 | Bacteria | 5618633 |
| 740 | 2739279659 | 2738543019 | Bacteria | 7459457 |
| 741 | 2831271543 | 2831265667 | Bacteria | 7184833 |
| 742 | 2838055445 | 2838054893 | Bacteria | 7451788 |
| 743 | 2839139445 | 2839138175 | Bacteria | 6549354 |
| 744 | 2842680593 | 2842677519 | Bacteria | 5615038 |
| 745 | 2863422760 | 2863421361 | Bacteria | 7300805 |
| 746 | 2885201023 | 2885198086 | Bacteria | 7212419 |
| 747 | 2885214194 | 2885211737 | Bacteria | 7212420 |
| 748 | 2899927511 | 2899924645 | Bacteria | 7487985 |
| 749 | 2904450762 | 2904449895 | Bacteria | 6927402 |
| 750 | 2904459738 | 2904456579 | Bacteria | 6819253 |
| 751 | 2904547984 | 2904541872 | Bacteria | 8915136 |
| 752 | 2904566627 | 2904564687 | Bacteria | 7609577 |
| 753 | 2904573672 | 2904571731 | Bacteria | 7608790 |
| 754 | 2904624979 | 2904615490 | Bacteria | 10047340 |
| 755 | 2919462708 | 2919462493 | Bacteria | 5817112 |
| 756 | 2928042577 | 2928037797 | Bacteria | 7273642 |
| 757 | 2928048996 | 2928044640 | Bacteria | 7271509 |
| 758 | 2928051546 | 2928051484 | Bacteria | 7773759 |
| 759 | 2928068757 | 2928064002 | Bacteria | 7419480 |
| 760 | 2928073245 | 2928070936 | Bacteria | 8062541 |
| 761 | 2928087006 | 2928084124 | Bacteria | 7159212 |
| 762 | 2928162201 | 2928157003 | Bacteria | 7522202 |
| 763 | 2928166364 | 2928163908 | Bacteria | 7561269 |
| 764 | 2928539492 | 2928536128 | Bacteria | 7657547 |
| 765 | 2929161621 | 2929160207 | Bacteria | 9075316 |
| 766 | 2929521480 | 2929520902 | Bacteria | 6765052 |
| 767 | 2945913937 | 2945909444 | Bacteria | 7065066 |
| 768 | 2945973539 | 2945972063 | Bacteria | 6086495 |
| 769 | 2945990665 | 2945984333 | Bacteria | 7358892 |
| 770 | 2981995535 | 2981990288 | Bacteria | 7590678 |
| 771 | 642420722 | 641736154 | Bacteria | 7689995 |
| 772 | 8020940343 | 8020938398 | Bacteria | 7472757 |
| 773 | 8020955278 | 8020953355 | Bacteria | 7439080 |
| 774 | JGI24740J21852_10055212 | |||
| 775 | JGI24739J22299_10028465 | |||
| 776 | JGI24739J22299_10040055 | |||
| 777 | JGI24735J21928_10000118 | |||
| 778 | JGI25152J39213_1007368 | |||
| 779 | JGI25150J39212_1003628 | |||
| 780 | JGI25159J45721_1012341 | |||
| 781 | JGI25159J45721_1014046 | |||
| 782 | JGI25151J46595_10014489 | |||
| 783 | JGI25151J46595_10020086 | |||
| 784 | JGI25151J46595_10022268 | |||
| 785 | JGI25151J46595_10034031 | |||
| 786 | JGI25153J46596_10017212 | |||
| 787 | JGI25153J46596_10023422 | |||
| 788 | rootL2_10009775 | |||
| 789 | rootL2_10055562 | |||
| 790 | JGI25160J50197_1000236 | |||
| 791 | JGI25160J50197_1022107 | |||
| 792 | JGI25160J50197_1022774 | |||
| 793 | JGI25161J50226_1006817 | |||
| 794 | JGI25161J50226_1006882 | |||
| 795 | Ga0055527_1000474 | |||
| 796 | Ga0055527_1002538 | |||
| 797 | Ga0055535_1001024 | |||
| 798 | Ga0055535_1004998 | |||
| 799 | Ga0055542_1001021 | |||
| 800 | Ga0055542_1005095 | |||
| 801 | Ga0055529_1000848 | |||
| 802 | Ga0055529_1004753 | |||
| 803 | Ga0055526_1024175 | |||
| 804 | Ga0055526_1024266 | |||
| 805 | Ga0055537_1000150 | |||
| 806 | Ga0055537_1010462 | |||
| 807 | Ga0055524_1023190 | |||
| 808 | Ga0055536_1015488 | |||
| 809 | Ga0055536_1017660 | |||
| 810 | Ga0055534_1000016 | |||
| 811 | Ga0055534_1011279 | |||
| 812 | Ga0055528_1000894 | |||
| 813 | Ga0055528_1010911 | |||
| 814 | Ga0055528_1022580 | |||
| 815 | Ga0055530_10002826 | |||
| 816 | Ga0055530_10005609 | |||
| 817 | Ga0055540_1010029 | |||
| 818 | Ga0055540_1012059 | |||
| 819 | Ga0055540_1012085 | |||
| 820 | Ga0055540_1012688 | |||
| 821 | Ga0055540_1019961 | |||
| 822 | Ga0055531_10015213 | |||
| 823 | Ga0055531_10020363 | |||
| 824 | Ga0055531_10028252 | |||
| 825 | Ga0058692_1004345 | |||
| 826 | Ga0055543_1005291 | |||
| 827 | Ga0055543_1006975 | |||
| 828 | Ga0065165_1003383 | |||
| 829 | Ga0065165_1013354 | |||
| 830 | Ga0065165_1020086 | |||
| 831 | Ga0065714_10003179 | |||
| 832 | Ga0065714_10094920 | |||
| 833 | Ga0065707_10088077 | |||
| 834 | Ga0070658_10122685 | |||
| 835 | Ga0070690_100000075 | |||
| 836 | Ga0070670_100020310 | |||
| 837 | Ga0070670_100105881 | |||
| 838 | Ga0070677_10010516 | |||
| 839 | Ga0068869_100000841 | |||
| 840 | Ga0068869_100255259 | |||
| 841 | Ga0070666_10382839 | |||
| 842 | Ga0070680_100001183 | |||
| 843 | Ga0070682_100002153 | |||
| 844 | Ga0068868_100000329 | |||
| 845 | Ga0068868_100151365 | |||
| 846 | Ga0070689_100000481 | |||
| 847 | Ga0070689_100155762 | |||
| 848 | Ga0070691_10000399 | |||
| 849 | Ga0070687_100000014 | |||
| 850 | Ga0070687_100111412 | |||
| 851 | Ga0070661_100028727 | |||
| 852 | Ga0070692_10000041 | |||
| 853 | Ga0070675_100009449 | |||
| 854 | Ga0070675_100196077 | |||
| 855 | Ga0070671_100228407 | |||
| 856 | Ga0070671_100276856 | |||
| 857 | Ga0070674_100006507 | |||
| 858 | Ga0070673_100028604 | |||
| 859 | Ga0070673_100438207 | |||
| 860 | Ga0070667_100241851 | |||
| 861 | Ga0070703_10001484 | |||
| 862 | Ga0070714_100602312 | |||
| 863 | Ga0070701_10000641 | |||
| 864 | Ga0070705_100000466 | |||
| 865 | Ga0070700_100001345 | |||
| 866 | Ga0070700_100202954 | |||
| 867 | Ga0070694_100000099 | |||
| 868 | Ga0070694_100048243 | |||
| 869 | Ga0070708_100040247 | |||
| 870 | Ga0070663_100110828 | |||
| 871 | Ga0070663_100137893 | |||
| 872 | Ga0070678_100161320 | |||
| 873 | Ga0070662_100139441 | |||
| 874 | Ga0070681_10004134 | |||
| 875 | Ga0068867_100000174 | |||
| 876 | Ga0068867_100001412 | |||
| 877 | Ga0068867_100051153 | |||
| 878 | Ga0068867_100142491 | |||
| 879 | Ga0068867_100161679 | |||
| 880 | Ga0070679_100008012 | |||
| 881 | Ga0070679_100427909 | |||
| 882 | Ga0070679_100452585 | |||
| 883 | Ga0068853_100009734 | |||
| 884 | Ga0068853_100169141 | |||
| 885 | Ga0068853_100182792 | |||
| 886 | Ga0068853_100231983 | |||
| 887 | Ga0068853_100382396 | |||
| 888 | Ga0070672_100054132 | |||
| 889 | Ga0070686_100000134 | |||
| 890 | Ga0070695_100000018 | |||
| 891 | Ga0070695_100020478 | |||
| 892 | Ga0070696_100000384 | |||
| 893 | Ga0070696_100295433 | |||
| 894 | Ga0070693_100000021 | |||
| 895 | Ga0070665_100090933 | |||
| 896 | Ga0070665_100152237 | |||
| 897 | Ga0070665_100368261 | |||
| 898 | Ga0070704_100000043 | |||
| 899 | Ga0068855_100001327 | |||
| 900 | Ga0068855_100009203 | |||
| 901 | Ga0068854_100353393 | |||
| 902 | Ga0070702_100000007 | |||
| 903 | Ga0070702_100108515 | |||
| 904 | Ga0068852_100003873 | |||
| 905 | Ga0068852_100160858 | |||
| 906 | Ga0068859_100003085 | |||
| 907 | Ga0068859_100005193 | |||
| 908 | Ga0068864_100024915 | |||
| 909 | Ga0068866_10000561 | |||
| 910 | Ga0068866_10002518 | |||
| 911 | Ga0068861_100000632 | |||
| 912 | Ga0068861_100001082 | |||
| 913 | Ga0068861_100062852 | |||
| 914 | Ga0068851_10003399 | |||
| 915 | Ga0068851_10048817 | |||
| 916 | Ga0068870_10035250 | |||
| 917 | Ga0068858_100000334 | |||
| 918 | Ga0068858_100341344 | |||
| 919 | Ga0068860_100001410 | |||
| 920 | Ga0068860_100009209 | |||
| 921 | Ga0068862_100000688 | |||
| 922 | Ga0068862_100033181 | |||
| 923 | Ga0068862_100035210 | |||
| 924 | Ga0068862_100173873 | |||
| 925 | Ga0081455_10000306 | |||
| 926 | Ga0081540_1000611 | |||
| 927 | Ga0075365_10028907 | |||
| 928 | Ga0075365_10033864 | |||
| 929 | Ga0075363_100052882 | |||
| 930 | Ga0075363_100053902 | |||
| 931 | Ga0075363_100167069 | |||
| 932 | Ga0075363_100226536 | |||
| 933 | Ga0075364_10028512 | |||
| 934 | Ga0075367_10015540 | |||
| 935 | Ga0075367_10042080 | |||
| 936 | Ga0075366_10000612 | |||
| 937 | Ga0075366_10002010 | |||
| 938 | Ga0075366_10002408 | |||
| 939 | Ga0075366_10003773 | |||
| 940 | Ga0075366_10012757 | |||
| 941 | Ga0075366_10027241 | |||
| 942 | Ga0075366_10028016 | |||
| 943 | Ga0075366_10063050 | |||
| 944 | Ga0097621_100000593 | |||
| 945 | Ga0097621_100065343 | |||
| 946 | Ga0075370_10000304 | |||
| 947 | Ga0075370_10004349 | |||
| 948 | Ga0075370_10033537 | |||
| 949 | Ga0075370_10050547 | |||
| 950 | Ga0075370_10075368 | |||
| 951 | Ga0075370_10104915 | |||
| 952 | Ga0068871_100000157 | |||
| 953 | Ga0068871_100472197 | |||
| 954 | Ga0068871_100625271 | |||
| 955 | Ga0075428_100005860 | |||
| 956 | Ga0075428_100080905 | |||
| 957 | Ga0075431_100127398 | |||
| 958 | Ga0068865_100000296 | |||
| 959 | Ga0068865_100000553 | |||
| 960 | Ga0097620_100003085 | |||
| 961 | Ga0097620_100005193 | |||
| 962 | Ga0079104_1000004 | |||
| 963 | Ga0099826_10000101 | |||
| 964 | Ga0099826_10071922 | |||
| 965 | Ga0105251_10000652 | |||
| 966 | Ga0105244_10033478 | |||
| 967 | Ga0105250_10005698 | |||
| 968 | Ga0105250_10030250 | |||
| 969 | Ga0105240_10021677 | |||
| 970 | Ga0105240_10022829 | |||
| 971 | Ga0105240_10211209 | |||
| 972 | Ga0105240_10366625 | |||
| 973 | Ga0111539_10028937 | |||
| 974 | Ga0111539_10042602 | |||
| 975 | Ga0111539_10049002 | |||
| 976 | Ga0111539_10522649 | |||
| 977 | Ga0105245_10000405 | |||
| 978 | Ga0105243_10000466 | |||
| 979 | Ga0105243_10000719 | |||
| 980 | Ga0105243_10060016 | |||
| 981 | Ga0105243_10063896 | |||
| 982 | Ga0105243_10201690 | |||
| 983 | Ga0105241_10021114 | |||
| 984 | Ga0105242_10000191 | |||
| 985 | Ga0105242_10244772 | |||
| 986 | Ga0105242_10309329 | |||
| 987 | Ga0105248_10127252 | |||
| 988 | Ga0105248_10477111 | |||
| 989 | Ga0105237_10000678 | |||
| 990 | Ga0105237_10209704 | |||
| 991 | Ga0105238_10003760 | |||
| 992 | Ga0105238_10012462 | |||
| 993 | Ga0105249_10000555 | |||
| 994 | Ga0105249_10056979 | |||
| 995 | Ga0105239_10002757 | |||
| 996 | Ga0105239_10018903 | |||
| 997 | Ga0105246_10147351 | |||
| 998 | Ga0157322_1002519 | |||
| 999 | Ga0157373_10014339 | |||
| 1000 | Ga0157373_10072985 | |||
| 1001 | Ga0157371_10033489 | |||
| 1002 | Ga0157371_10083264 | |||
| 1003 | Ga0157370_10010321 | |||
| 1004 | Ga0157370_10041067 | |||
| 1005 | Ga0157370_10062545 | |||
| 1006 | Ga0157369_10018665 | |||
| 1007 | Ga0157369_10049404 | |||
| 1008 | Ga0157378_10000196 | |||
| 1009 | Ga0157378_10003317 | |||
| 1010 | Ga0163162_10002473 | |||
| 1011 | Ga0163162_10028904 | |||
| 1012 | Ga0163162_10124882 | |||
| 1013 | Ga0163162_10282771 | |||
| 1014 | Ga0163162_10312725 | |||
| 1015 | Ga0163162_10417876 | |||
| 1016 | Ga0163162_10427937 | |||
| 1017 | Ga0157372_10001008 | |||
| 1018 | Ga0157375_10109862 | |||
| 1019 | Ga0157375_10292063 | |||
| 1020 | Ga0157375_10751390 | |||
| 1021 | Ga0163163_10095631 | |||
| 1022 | Ga0163163_10698720 | |||
| 1023 | Ga0157380_10004926 | |||
| 1024 | Ga0157380_10222744 | |||
| 1025 | Ga0182008_10021576 | |||
| 1026 | Ga0157379_10011748 | |||
| 1027 | Ga0182006_1005908 | |||
| 1028 | Ga0182006_1007662 | |||
| 1029 | Ga0182007_10000853 | |||
| 1030 | Ga0182007_10003308 | |||
| 1031 | Ga0182007_10003412 | |||
| 1032 | Ga0182007_10029230 | |||
| 1033 | Ga0183362_10003 | |||
| 1034 | Ga0163161_10016046 | |||
| 1035 | Ga0163161_10022442 | |||
| 1036 | Ga0163161_10054961 | |||
| 1037 | Ga0163161_10089849 | |||
| 1038 | Ga0163161_10195599 | |||
| 1039 | Ga0213875_10000216 | |||
| 1040 | Ga0209436_111171 | |||
| 1041 | Ga0209436_112461 | |||
| 1042 | Ga0209672_100035 | |||
| 1043 | Ga0209672_100040 | |||
| 1044 | Ga0209672_100378 | |||
| 1045 | Ga0209147_100041 | |||
| 1046 | Ga0209147_100048 | |||
| 1047 | Ga0209147_100696 | |||
| 1048 | Ga0209258_100063 | |||
| 1049 | Ga0209258_100070 | |||
| 1050 | Ga0209258_100093 | |||
| 1051 | Ga0207425_1001814 | |||
| 1052 | Ga0207425_1007722 | |||
| 1053 | Ga0209148_1000007 | |||
| 1054 | Ga0209148_1000311 | |||
| 1055 | Ga0209148_1000450 | |||
| 1056 | Ga0209129_1000024 | |||
| 1057 | Ga0209129_1004707 | |||
| 1058 | Ga0209129_1021638 | |||
| 1059 | Ga0209565_1000098 | |||
| 1060 | Ga0209565_1000633 | |||
| 1061 | Ga0209565_1005528 | |||
| 1062 | Ga0209565_1007756 | |||
| 1063 | Ga0209455_1000351 | |||
| 1064 | Ga0209455_1000780 | |||
| 1065 | Ga0209673_1000030 | |||
| 1066 | Ga0209673_1000058 | |||
| 1067 | Ga0209673_1001185 | |||
| 1068 | Ga0209673_1002178 | |||
| 1069 | Ga0209673_1028050 | |||
| 1070 | Ga0209130_1000654 | |||
| 1071 | Ga0209130_1001114 | |||
| 1072 | Ga0209675_1000010 | |||
| 1073 | Ga0209675_1000151 | |||
| 1074 | Ga0209675_1000431 | |||
| 1075 | Ga0209675_1002776 | |||
| 1076 | Ga0209675_1023061 | |||
| 1077 | Ga0209676_1000028 | |||
| 1078 | Ga0209676_1000333 | |||
| 1079 | Ga0209676_1002526 | |||
| 1080 | Ga0209676_1005235 | |||
| 1081 | Ga0209676_1014874 | |||
| 1082 | Ga0209676_1037188 | |||
| 1083 | Ga0209025_1000685 | |||
| 1084 | Ga0209025_1001904 | |||
| 1085 | Ga0209025_1008279 | |||
| 1086 | Ga0209025_1008530 | |||
| 1087 | Ga0209564_1000209 | |||
| 1088 | Ga0209564_1002281 | |||
| 1089 | Ga0209564_1006924 | |||
| 1090 | Ga0209758_1000049 | |||
| 1091 | Ga0209758_1005721 | |||
| 1092 | Ga0209050_1000072 | |||
| 1093 | Ga0209050_1000721 | |||
| 1094 | Ga0209050_1000927 | |||
| 1095 | Ga0209050_1037603 | |||
| 1096 | Ga0209256_1000088 | |||
| 1097 | Ga0209256_1004126 | |||
| 1098 | Ga0207426_1000021 | |||
| 1099 | Ga0207426_1000038 | |||
| 1100 | Ga0207426_1000053 | |||
| 1101 | Ga0207426_1003265 | |||
| 1102 | Ga0209051_1000015 | |||
| 1103 | Ga0209051_1000056 | |||
| 1104 | Ga0209051_1000424 | |||
| 1105 | Ga0209051_1000545 | |||
| 1106 | Ga0209051_1000757 | |||
| 1107 | Ga0209051_1021185 | |||
| 1108 | Ga0209051_1023463 | |||
| 1109 | Ga0209257_1003278 | |||
| 1110 | Ga0209257_1003691 | |||
| 1111 | Ga0209257_1004686 | |||
| 1112 | Ga0207713_1005069 | |||
| 1113 | Ga0207682_10001551 | |||
| 1114 | Ga0207642_10001932 | |||
| 1115 | Ga0207680_10189332 | |||
| 1116 | Ga0207647_10005484 | |||
| 1117 | Ga0207643_10045223 | |||
| 1118 | Ga0207643_10206139 | |||
| 1119 | Ga0207654_10042125 | |||
| 1120 | Ga0207707_10047840 | |||
| 1121 | Ga0207695_10022456 | |||
| 1122 | Ga0207695_10159606 | |||
| 1123 | Ga0207695_10260834 | |||
| 1124 | Ga0207671_10002997 | |||
| 1125 | Ga0207660_10000284 | |||
| 1126 | Ga0207662_10000063 | |||
| 1127 | Ga0207662_10087984 | |||
| 1128 | Ga0207649_10012026 | |||
| 1129 | Ga0207652_10090395 | |||
| 1130 | Ga0207681_10318310 | |||
| 1131 | Ga0207694_10006188 | |||
| 1132 | Ga0207694_10007970 | |||
| 1133 | Ga0207694_10082026 | |||
| 1134 | Ga0207650_10000877 | |||
| 1135 | Ga0207659_10165588 | |||
| 1136 | Ga0207687_10005404 | |||
| 1137 | Ga0207644_10157439 | |||
| 1138 | Ga0207706_10034754 | |||
| 1139 | Ga0207706_10149924 | |||
| 1140 | Ga0207686_10000623 | |||
| 1141 | Ga0207686_10027163 | |||
| 1142 | Ga0207686_10085311 | |||
| 1143 | Ga0207686_10177720 | |||
| 1144 | Ga0207686_10419549 | |||
| 1145 | Ga0207709_10000019 | |||
| 1146 | Ga0207709_10000958 | |||
| 1147 | Ga0207709_10001025 | |||
| 1148 | Ga0207709_10003409 | |||
| 1149 | Ga0207670_10001140 | |||
| 1150 | Ga0207670_10078891 | |||
| 1151 | Ga0207670_10168924 | |||
| 1152 | Ga0207669_10038190 | |||
| 1153 | Ga0207704_10004232 | |||
| 1154 | Ga0207691_10088070 | |||
| 1155 | Ga0207691_10186589 | |||
| 1156 | Ga0207711_10047691 | |||
| 1157 | Ga0207689_10000214 | |||
| 1158 | Ga0207689_10112010 | |||
| 1159 | Ga0207689_10263351 | |||
| 1160 | Ga0207667_10024635 | |||
| 1161 | Ga0207667_10038913 | |||
| 1162 | Ga0207651_10042034 | |||
| 1163 | Ga0207651_10242270 | |||
| 1164 | Ga0207712_10000849 | |||
| 1165 | Ga0207712_10212381 | |||
| 1166 | Ga0207640_10000972 | |||
| 1167 | Ga0207658_10240123 | |||
| 1168 | Ga0207677_10010717 | |||
| 1169 | Ga0207677_10359633 | |||
| 1170 | Ga0207703_10007007 | |||
| 1171 | Ga0207639_10018508 | |||
| 1172 | Ga0207639_10294033 | |||
| 1173 | Ga0207678_10155630 | |||
| 1174 | Ga0207678_10164182 | |||
| 1175 | Ga0207708_10000117 | |||
| 1176 | Ga0207708_10144778 | |||
| 1177 | Ga0207641_10118767 | |||
| 1178 | Ga0207648_10000293 | |||
| 1179 | Ga0207648_10006211 | |||
| 1180 | Ga0207648_10007082 | |||
| 1181 | Ga0207648_10254656 | |||
| 1182 | Ga0207676_10088988 | |||
| 1183 | Ga0207674_10277622 | |||
| 1184 | Ga0207675_100000218 | |||
| 1185 | Ga0207675_100000819 | |||
| 1186 | Ga0207675_100029740 | |||
| 1187 | Ga0207675_100168829 | |||
| 1188 | Ga0207683_10001266 | |||
| 1189 | Ga0207683_10035360 | |||
| 1190 | Ga0207683_10161133 | |||
| 1191 | Ga0207698_10021889 | |||
| 1192 | Ga0207698_10066310 | |||
| 1193 | Ga0207698_10207444 | |||
| 1194 | Ga0207698_10524408 | |||
| 1195 | Ga0209281_1000005 | |||
| 1196 | Ga0209371_1000314 | |||
| 1197 | Ga0209282_1001024 | |||
| 1198 | Ga0207428_10022002 | |||
| 1199 | Ga0268266_10018918 | |||
| 1200 | Ga0268265_10009365 | |||
| 1201 | Ga0268265_10019397 | |||
| 1202 | Ga0268264_10000609 | |||
| 1203 | Ga0268264_10006549 | |||
| 1204 | Ga0307515_10000048 | |||
| 1205 | Ga0268256_1000257 | |||
| 1206 | Ga0316177_1185315 | |||
| 1207 | Ga0314311_1019256 | |||
| 1208 | Ga0316183_1181937 | |||
| 1209 | Ga0316181_1066331 | |||
| 1210 | Ga0265327_10000789 | |||
| 1211 | Ga0265316_10093317 | |||
| 1212 | Ga0307513_10009173 | |||
| 1213 | Ga0307513_10110737 | |||
| 1214 | Ga0307408_100050351 | |||
| 1215 | Ga0307408_100291685 | |||
| 1216 | Ga0307508_10022524 | |||
| 1217 | Ga0307514_10004647 | |||
| 1218 | Ga0307405_10019514 | |||
| 1219 | Ga0307405_10101129 | |||
| 1220 | Ga0307405_10155693 | |||
| 1221 | Ga0307405_10357117 | |||
| 1222 | Ga0307410_10122477 | |||
| 1223 | Ga0307410_10124172 | |||
| 1224 | Ga0307406_10005016 | |||
| 1225 | Ga0307406_10130177 | |||
| 1226 | Ga0307416_100178484 | |||
| 1227 | Ga0307414_10054630 | |||
| 1228 | Ga0307411_10026116 | |||
| 1229 | Ga0307411_10418991 | |||
| 1230 | Ga0373926_0008550 | |||
| 1231 | Ga0373944_0025474 | |||
| 1232 | Ga0373944_0073049 | |||
| 1233 | Ga0373936_0013787 | |||
| 1234 | Ga0373936_0024056 | |||
| 1235 | Ga0373945_0002475 | |||
| 1236 | Ga0373957_0064958 | |||
| 1237 | Ga0373943_0002249 | |||
| 1238 | Ga0373943_0036350 | |||
| 1239 | Ga0373946_0014865 | |||
| 1240 | Ga0373955_0007263 | |||
| 1241 | Ga0373942_0122722 | |||
| 1242 | Ga0373961_0032273 | |||
| 1243 | Ga0373924_0006212 | |||
| 1244 | Ga0373924_0045161 | |||
| 1245 | Ga0373931_0001350 | |||
| 1246 | Ga0373935_0041207 | |||
| 1247 | Ga0373935_0104694 | |||
| 1248 | Ga0373927_0096889 | |||
| 1249 | Ga0373947_0051400 | |||
| 1250 | Ga0373947_0088908 | |||
| 1251 | Ga0373937_0003903 | |||
| 1252 | Ga0373925_0020270 | |||
| 1253 | Ga0395900_0020164 | |||
| 1254 | Ga0395898_0564306 | |||
| 1255 | Ga0395905_0000143 | |||
| 1256 | Ga0436364_0093683 | |||
| 1257 | Ga0436364_0949154 | |||
| 1258 | Ga0395901_0027907 | |||
| 1259 | Ga0436365_0910371 | |||
| 1260 | Ga0439466_0032648 | |||
| 1261 | Ga0439465_0034032 | |||
| 1262 | Ga0451807_0797333 | |||
| 1263 | Ga0439445_0022254 | |||
| 1264 | Ga0439454_013298 | |||
| 1265 | Ga0450911_000121 | |||
| 1266 | Ga0450910_006925 | |||
| 1267 | Ga0439446_0034131 | |||
| 1268 | Ga0466969_0048521 | |||
| 1269 | Ga0466965_0077550 | |||
| 1270 | Ga0466966_0081171 | |||
| 1271 | Ga0466961_0007552 | |||
| 1272 | Ga0466960_0093023 | |||
| 1273 | Ga0451576_0164603 | |||
| 1274 | Ga0451576_0528201 | |||
| 1275 | Ga0495603_0010042 | |||
| 1276 | Ga0495590_0005072 | |||
| 1277 | Ga0495629_0001862 | |||
| 1278 | Ga0495629_0003276 | |||
| 1279 | Ga0495651_0231285 | |||
| 1280 | Ga0495653_0001825 | |||
| 1281 | Ga0495650_0009826 | |||
| 1282 | Ga0495580_0009565 | |||
| 1283 | Ga0495580_0092192 | |||
| 1284 | Ga0495582_0029835 | |||
| 1285 | Ga0495582_0096432 | |||
| 1286 | Ga0495605_0040379 | |||
| 1287 | Ga0495639_0067193 | |||
| 1288 | Ga0495639_0112842 | |||
| 1289 | Ga0495664_0078697 | |||
| 1290 | Ga0495584_0043651 | |||
| 1291 | Ga0495596_0081033 | |||
| 1292 | Ga0495607_0174456 | |||
| 1293 | Ga0495583_0003388 | |||
| 1294 | Ga0495606_0002910 | |||
| 1295 | Ga0495606_0065786 | |||
| 1296 | Ga0495616_0008804 | |||
| 1297 | Ga0495620_0010769 | |||
| 1298 | Ga0495620_0015706 | |||
| 1299 | Ga0495628_0014353 | |||
| 1300 | Ga0495630_0092996 | |||
| 1301 | Ga0495630_0154977 | |||
| 1302 | Ga0495631_0004715 | |||
| 1303 | Ga0495648_0022103 | |||
| 1304 | Ga0495666_0021882 | |||
| 1305 | Ga0495642_0001048 | |||
| 1306 | Ga0495642_0044563 | |||
| 1307 | Ga0495642_0089135 | |||
| 1308 | Ga0495652_0032596 | |||
| 1309 | Ga0495654_0032632 | |||
| 1310 | Ga0495654_0053084 | |||
| 1311 | Ga0495665_0007068 | |||
| 1312 | Ga0495665_0068089 | |||
| 1313 | Ga0495586_0013899 | |||
| 1314 | Ga0495586_0031911 | |||
| 1315 | Ga0495609_0059027 | |||
| 1316 | Ga0495621_0034393 | |||
| 1317 | Ga0495597_0002220 | |||
| 1318 | Ga0495645_0000267 | |||
| 1319 | Ga0495645_0011058 | |||
| 1320 | Ga0495622_0094936 | |||
| 1321 | Ga0495667_0028052 | |||
| 1322 | Ga0495667_0194740 | |||
| 1323 | Ga0495656_0000646 | |||
| 1324 | Ga0495625_0000950 | |||
| 1325 | Ga0495625_0152705 | |||
| 1326 | Ga0495635_0014095 | |||
| 1327 | Ga0495661_0047151 | |||
| 1328 | Ga0495661_0136270 | |||
| 1329 | Ga0495588_0041992 | |||
| 1330 | Ga0495623_0003659 | |||
| 1331 | Ga0495623_0194717 | |||
| 1332 | Ga0495646_0005877 | |||
| 1333 | Ga0495646_0070380 | |||
| 1334 | Ga0495647_0017673 | |||
| 1335 | Ga0495658_0061416 | |||
| 1336 | Ga0495658_0157973 | |||
| 1337 | Ga0495669_0001642 | |||
| 1338 | Ga0495669_0018189 | |||
| 1339 | Ga0495669_0141329 | |||
| 1340 | Ga0495613_0010203 | |||
| 1341 | Ga0495624_0033774 | |||
| 1342 | Ga0495670_0080427 | |||
| 1343 | Ga0495671_0005567 | |||
| 1344 | Ga0495649_0010601 | |||
| 1345 | Ga0495649_0061486 | |||
| 1346 | Ga0495649_0086426 | |||
| 1347 | Ga0495589_0004109 | |||
| 1348 | Ga0495589_0009291 | |||
| 1349 | Ga0495589_0033787 | |||
| 1350 | Ga0495589_0057640 | |||
| 1351 | Ga0495600_0139997 | |||
| 1352 | Ga0495600_0168793 | |||
| 1353 | Ga0495660_0107095 | |||
| 1354 | Ga0495581_0077415 | |||
| 1355 | Ga0495581_0096401 | |||
| 1356 | Ga0495674_0029512 | |||
| 1357 | Ga0495674_0072476 | |||
| 1358 | Ga0495672_0045150 | |||
| 1359 | Ga0495676_0071720 | |||
| 1360 | Ga0495680_0005821 | |||
| 1361 | Ga0495683_0002721 | |||
| 1362 | Ga0495683_0087906 | |||
| 1363 | Ga0495687_013714 | |||
| 1364 | Ga0495687_016923 | |||
| 1365 | Ga0495687_037893 | |||
| 1366 | Ga0495675_0040988 | |||
| 1367 | Ga0495675_0113718 | |||
| 1368 | Ga0495681_0037485 | |||
| 1369 | Ga0495593_0008842 | |||
| 1370 | Ga0495593_0061066 | |||
| 1371 | Ga0495593_0129545 | |||
| 1372 | Ga0495602_0054300 | |||
| 1373 | Ga0495614_0081426 | |||
| 1374 | Ga0495626_0037680 | |||
| 1375 | Ga0495626_0066559 | |||
| 1376 | Ga0496100_0000588 | |||
| 1377 | Ga0496100_0072467 | |||
| 1378 | Ga0496100_0198895 | |||
| 1379 | Ga0496101_0000441 | |||
| 1380 | Ga0496101_0003078 | |||
| 1381 | Ga0496101_0021260 | |||
| 1382 | Ga0496101_0029055 | |||
| 1383 | Ga0496101_0080802 | |||
| 1384 | Ga0496101_0298499 | |||
| 1385 | Ga0496102_0001021 | |||
| 1386 | Ga0496102_0029784 | |||
| 1387 | Ga0496102_0039923 | |||
| 1388 | Ga0496103_0002188 | |||
| 1389 | Ga0496103_0020307 | |||
| 1390 | Ga0496103_0217298 | |||
| 1391 | Ga0496104_0035535 | |||
| 1392 | Ga0496104_0036114 | |||
| 1393 | Ga0496104_0052227 | |||
| 1394 | Ga0496104_0070305 | |||
| 1395 | Ga0496105_0004053 | |||
| 1396 | Ga0496105_0151423 | |||
| 1397 | Ga0496106_0014372 | |||
| 1398 | Ga0496106_0090127 | |||
| 1399 | Ga0496107_0028871 | |||
| 1400 | Ga0496107_0350196 | |||
| 1401 | Ga0496109_0133660 | |||
| 1402 | Ga0496109_0542091 | |||
| 1403 | Ga0496110_0015898 | |||
| 1404 | Ga0496110_0052040 | |||
| 1405 | Ga0496110_0056966 | |||
| 1406 | Ga0496110_0080316 | |||
| 1407 | Ga0496111_0012891 | |||
| 1408 | Ga0496111_0017568 | |||
| 1409 | Ga0496112_0017573 | |||
| 1410 | Ga0496112_0287886 | |||
| 1411 | Ga0496113_0005804 | |||
| 1412 | Ga0496113_0006028 | |||
| 1413 | Ga0496114_0081997 | |||
| 1414 | Ga0496114_0123552 | |||
| 1415 | Ga0496117_0002412 | |||
| 1416 | Ga0496117_0015225 | |||
| 1417 | Ga0496117_0041471 | |||
| 1418 | Ga0496117_0058083 | |||
| 1419 | Ga0496118_0003264 | |||
| 1420 | Ga0496118_0007454 | |||
| 1421 | Ga0496120_0102737 | |||
| 1422 | Ga0496121_0001535 | |||
| 1423 | Ga0496121_0004607 | |||
| 1424 | Ga0496121_0005075 | |||
| 1425 | Ga0496121_0013189 | |||
| 1426 | Ga0496121_0029050 | |||
| 1427 | Ga0496121_0062280 | |||
| 1428 | Ga0496122_0015406 | |||
| 1429 | Ga0496122_0129383 | |||
| 1430 | Ga0496122_0140468 | |||
| 1431 | Ga0496122_0175141 | |||
| 1432 | Ga0496123_0006720 | |||
| 1433 | Ga0496124_0037502 | |||
| 1434 | Ga0496124_0056547 | |||
| 1435 | Ga0496124_0250646 | |||
| 1436 | Ga0496125_0007748 | |||
| 1437 | Ga0496125_0021863 | |||
| 1438 | Ga0496125_0086876 | |||
| 1439 | Ga0496125_0140353 | |||
| 1440 | Ga0496125_0175578 | |||
| 1441 | Ga0496126_0194457 | |||
| 1442 | Ga0496126_0334635 | |||
| 1443 | Ga0495682_0020288 | |||
| 1444 | Ga0495682_0067669 | |||
| 1445 | Ga0501067_0056711 | |||
| 1446 | Ga0501249_006316 | |||
| 1447 | Ga0501225_0014791 | |||
| 1448 | Ga0501262_000611 | |||
| 1449 | nmdc:mga03683_75008_c1 | |||
| 1450 | nmdc:mga03n38_109414_c1 | |||
| 1451 | nmdc:mga03n38_18792_c1 | |||
| 1452 | nmdc:mga00v17_230093_c1 | |||
| 1453 | nmdc:mga00v17_8095_c1 | |||
| 1454 | nmdc:mga0yw44_70737_c1 | |||
| 1455 | nmdc:mga0k408_10844_c1 | |||
| 1456 | nmdc:mga0k408_137917_c1 | |||
| 1457 | nmdc:mga0k408_2586_c1 | |||
| 1458 | nmdc:mga0k408_2741_c1 | |||
| 1459 | nmdc:mga0k408_27979_c1 | |||
| 1460 | nmdc:mga0k408_423_c1 | |||
| 1461 | nmdc:mga0k408_53260_c1 | |||
| 1462 | nmdc:mga0k408_56752_c1 | |||
| 1463 | nmdc:mga0k408_5696_c2 | |||
| 1464 | nmdc:mga07m45_280779_c1 | |||
| 1465 | nmdc:mga07m45_31422_c1 | |||
| 1466 | nmdc:mga07m45_38151_c1 | |||
| 1467 | nmdc:mga07m45_44961_c1 | |||
| 1468 | nmdc:mga07m45_4636_c1 | |||
| 1469 | nmdc:mga07m45_53556_c1 | |||
| 1470 | nmdc:mga07m45_8146_c2 | |||
| 1471 | nmdc:mga09592_6513_c1 | |||
| 1472 | nmdc:mga06r32_209111_c1 | |||
| 1473 | nmdc:mga08y16_205949_c1 | |||
| 1474 | nmdc:mga08y16_25553_c1 | |||
| 1475 | nmdc:mga0a205_299725_c1 | |||
| 1476 | nmdc:mga0sz30_81541_c1 | |||
| 1477 | Ga0500610_0017353 | |||
| 1478 | Ga0500651_0000347 | |||
| 1479 | Ga0500572_035712 | |||
| 1480 | Ga0500593_001062 | |||
| 1481 | Ga0500594_0001635 | |||
| 1482 | Ga0500607_029808 | |||
| 1483 | Ga0500618_025387 | |||
| 1484 | Ga0500626_021140 | |||
| 1485 | Ga0500658_0002780 | |||
| 1486 | Ga0500658_0013278 | |||
| 1487 | Ga0500559_0022801 | |||
| 1488 | Ga0500559_0103377 | |||
| 1489 | Ga0500559_0143023 | |||
| 1490 | Ga0500564_074863 | |||
| 1491 | Ga0500568_0011721 | |||
| 1492 | Ga0500577_0074078 | |||
| 1493 | Ga0500616_0004050 | |||
| 1494 | Ga0500616_0066404 | |||
| 1495 | Ga0500627_0045518 | |||
| 1496 | Ga0500636_0085584 | |||
| 1497 | Ga0500565_000833 | |||
| 1498 | 2722884340 | |||
| 1499 | 2513230084 | |||
| 1500 | 2514049699 | |||
| 1501 | 2563060565 | |||
| 1502 | 2599620566 | |||
| 1503 | 2599673865 | |||
| 1504 | 2599678818 | |||
| 1505 | 2599690077 | |||
| 1506 | 2644162170 | |||
| 1507 | 2644324293 | |||
| 1508 | 2644396134 | |||
| 1509 | 2644464954 | |||
| 1510 | 2713475742 | |||
| 1511 | 2738720460 | |||
| 1512 | 2739250123 | |||
| 1513 | 2739279659 | |||
| 1514 | 2831271543 | |||
| 1515 | 2838055445 | |||
| 1516 | 2839139445 | |||
| 1517 | 2842680593 | |||
| 1518 | 2863422760 | |||
| 1519 | 2885201023 | |||
| 1520 | 2885214194 | |||
| 1521 | 2899927511 | |||
| 1522 | 2904450762 | |||
| 1523 | 2904459738 | |||
| 1524 | 2904547984 | |||
| 1525 | 2904566627 | |||
| 1526 | 2904573672 | |||
| 1527 | 2904624979 | |||
| 1528 | 2919462708 | |||
| 1529 | 2928042577 | |||
| 1530 | 2928048996 | |||
| 1531 | 2928051546 | |||
| 1532 | 2928068757 | |||
| 1533 | 2928073245 | |||
| 1534 | 2928087006 | |||
| 1535 | 2928162201 | |||
| 1536 | 2928166364 | |||
| 1537 | 2928539492 | |||
| 1538 | 2929161621 | |||
| 1539 | 2929521480 | |||
| 1540 | 2945913937 | |||
| 1541 | 2945973539 | |||
| 1542 | 2945990665 | |||
| 1543 | 2981995535 | |||
| 1544 | 642420722 | |||
| 1545 | 8020940343 | |||
| 1546 | 8020955278 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8ovp-assembly1.cif.gz_A | x-ray structure of the iaspsnfr in complex with l-aspartate | 0.9781 | 28 | 269 |
| 8ovo-assembly1.cif.gz_B | x-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate | 0.976 | 28 | 269 |
| 8ovp-assembly1.cif.gz_B | x-ray structure of the iaspsnfr in complex with l-aspartate | 0.9715 | 26 | 269 |
| 2vha-assembly1.cif.gz_B | debp | 0.9637 | 26 | 290 |
| 6svf-assembly1.cif.gz_A | crystal structure of the p235gk mutant of argbp from t. maritima | 0.9452 | 31 | 269 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P96257_184_272_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9279 | 133 | 224 | 3.40.190.10 |
| 2ia4B02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.925 | 133 | 227 | 3.40.190.10 |
| 2pyyC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9166 | 130 | 226 | 3.40.190.10 |
| 3vv5A02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.915 | 130 | 222 | 3.40.190.10 |
| 2ia4A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9063 | 26 | 290 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A259CJ43-F1-model_v4 | Amino acid ABC transporter substrate-binding protein | 0.9784 | 33 | 290 |
GO:0005576
GO:0006865 GO:0030288 |
| AF-A0A537N2P0-F1-model_v4 | Amino acid ABC transporter substrate-binding protein | 0.9743 | 72 | 221 |
GO:0005576
GO:0006865 GO:0030288 |
| AF-A0A421DJ27-F1-model_v4 | ABC transporter substrate-binding protein | 0.9742 | 30 | 289 |
GO:0005576
GO:0006865 GO:0030288 |
| AF-A0A6P1J7U9-F1-model_v4 | Amino acid ABC transporter substrate-binding protein | 0.9704 | 25 | 290 |
GO:0005576
GO:0006865 GO:0030288 |
| AF-A0A5T7LS93-F1-model_v4 | deleted | 0.9673 | 21 | 289 |
|