F480253

General Info

Members Datasets Scaffolds Average Seq Length
775 611 1550 308

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10069802|Ga0075364_100698022
Length 330
Sequence MANTMDSPRTAVSNPPVQPMETNLTQRDLIRRSATSELPPPERQLTPVAKLIDVSKCIGCKACQSACVEWNDTNPAVGENVGVYTNPHDLTADMFTLMRFTEWVNPETDNLEWLIRKDGCMHCADPGCLKACPAPGAIVQYSNGIVDFIHDNCIGCGYCVKGCPFNIPRISKADHRAYKCTLCSDRVAVGQGPACAKACPTQAIVFGTKEDMKKHAEGRIADLKSRGYANAGLYDPPGVGGTHVMYVLHHNDKPHIYADLPDNPAISAVVQTWKGATKYAGLAVMGLAAAGTLLHGLFAKANRVSKHEEEEAKELVDESVEHAEKREEDA

Samples

Sample ID Description Type Environment
1 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
108 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
109 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
118 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
119 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
168 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
174 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
175 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
176 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
177 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
178 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
179 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
180 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
183 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
184 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
195 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
196 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
197 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
198 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
199 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
200 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
201 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
202 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
203 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
204 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
205 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
206 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
207 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
208 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
209 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
217 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
218 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
219 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
220 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
224 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
225 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
226 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
227 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
228 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
229 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
230 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
231 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
234 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
235 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
236 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
237 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
238 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
241 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
242 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
243 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
244 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
245 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
246 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
247 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
248 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
249 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
250 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
251 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
252 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
253 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
254 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
255 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
256 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
257 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
258 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
259 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
260 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
261 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
262 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
263 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
264 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
265 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
268 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
269 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
270 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
272 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
273 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
274 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
275 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
276 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
277 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
278 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
290 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
291 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
292 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
293 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
294 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
295 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
296 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
297 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
298 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
299 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
300 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
301 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
302 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
303 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
304 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
305 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
306 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
316 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
317 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
318 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
319 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
320 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
321 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
322 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
323 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
325 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
326 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
327 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
328 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
329 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
330 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
331 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
332 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
333 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
334 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
335 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
336 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
337 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
338 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
339 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
340 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
341 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
342 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
343 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
344 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
347 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
348 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
349 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
350 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
351 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
352 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
353 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
354 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
355 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
356 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
357 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
358 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
359 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
360 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
361 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
362 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
363 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
364 2519103095 Burkholderia sp. KJ006 Isolate Nodule
365 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
366 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
367 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
368 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
369 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
370 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
371 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
372 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
373 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
374 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
375 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
376 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
377 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
378 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
379 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
380 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
381 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
382 2643221618 Ensifer sp. Root231 Isolate Unclassified
383 2643221626 Ensifer sp. Root31 Isolate Unclassified
384 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
385 2643221655 Ensifer sp. Root1252 Isolate Unclassified
386 2643221659 Ensifer sp. Root127 Isolate Unclassified
387 2643221698 Ensifer sp. Root142 Isolate Unclassified
388 2643221712 Ensifer sp. Root258 Isolate Unclassified
389 2643221718 Rhizobium sp. Root268 Isolate Unclassified
390 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
391 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
392 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
393 2721755523 Delftia sp. HK171 Isolate Unclassified
394 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
395 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
396 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
397 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
398 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
399 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
400 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
401 2818991467 Bosea vestrisii 3192 Isolate Unclassified
402 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
403 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
404 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
405 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
406 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
407 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
408 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
409 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
410 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
411 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
412 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
413 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
414 2844163670 Ensifer sp. 1H6 Isolate Unclassified
415 2854911287 Brucella lupini LUP21 Isolate Unclassified
416 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
417 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
418 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
419 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
420 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
421 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
422 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
423 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
424 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
425 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
426 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
427 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
428 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
429 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
430 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
431 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
432 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
433 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
434 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
435 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
436 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
437 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
438 2904564687 Burkholderia sp. 571 Isolate Unclassified
439 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
440 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
441 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
442 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
443 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
444 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
445 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
446 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
447 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
448 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
449 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
450 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
451 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
452 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
453 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
454 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
455 2919404418 Luteibacter sp. 3190 Isolate Unclassified
456 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
457 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
458 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
459 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
460 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
461 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
462 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
463 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
464 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
465 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
466 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
467 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
468 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
469 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
470 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
471 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
472 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
473 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
474 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
475 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
476 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
477 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
478 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
479 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
480 2928163908 Burkholderia sp. 567 Isolate Unclassified
481 2928536128 Burkholderia sola 565 Isolate Unclassified
482 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
483 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
484 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
485 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
486 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
487 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
488 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
489 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
490 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
491 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
492 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
493 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
494 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
495 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
496 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
497 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
498 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
499 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
500 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
501 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
502 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
503 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
504 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
505 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
506 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
507 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
508 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
509 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
510 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
511 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
512 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
513 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
514 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
515 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
516 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
517 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
518 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
519 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
520 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
521 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
522 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
523 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
524 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
525 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
526 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
527 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
528 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
529 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
530 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
531 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
532 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
533 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
534 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
535 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
536 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
537 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
538 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
539 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
540 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
541 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
542 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
543 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
544 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
545 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
546 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
547 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
548 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
549 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
550 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
551 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
552 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
553 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
554 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
555 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
556 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
557 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
558 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
559 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
560 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
561 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
562 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
563 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
564 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
565 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
566 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
567 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
568 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
569 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
570 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
571 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
572 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
573 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
574 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
575 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
576 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
577 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
578 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
579 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
580 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
581 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
582 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
583 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
584 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
585 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
586 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
587 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
588 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
589 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
590 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
591 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
592 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
593 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
594 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
595 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
596 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
597 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
598 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
599 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
600 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
601 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
602 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
603 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
604 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
605 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
606 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
607 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
608 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
609 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
610 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
611 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 64.13
Metatranscriptomes 1.55
Isolates 34.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.1
Nodule 25.55
Rhizoplane 4.39
Rhizosphere 47.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075364_10069802 3300006051 Bacteria 2312
2 JGI24739J22299_10012955 3300001989 Bacteria 3052
3 JGI24738J21930_10000095 3300002075 Bacteria 20134
4 JGI25156J39149_1000311 3300002705 Bacteria 32300
5 JGI25150J39212_1002960 3300002774 Bacteria 4094
6 JGI25151J46595_10000056 3300003187 Bacteria 151555
7 Ga0006562J51391_1005875 3300003578 Bacteria 6709
8 Ga0055539_1000180 3300003752 Bacteria 53702
9 Ga0055533_1000169 3300003756 Bacteria 59989
10 Ga0055525_1000526 3300003759 Bacteria 18471
11 Ga0055529_1000290 3300003763 Bacteria 58992
12 Ga0055526_1000114 3300003771 Bacteria 71399
13 Ga0055526_1003873 3300003771 Bacteria 9276
14 Ga0055526_1008399 3300003771 Bacteria 5162
15 Ga0055524_1000089 3300003775 Bacteria 115137
16 Ga0055528_1004510 3300003790 Bacteria 6688
17 Ga0055528_1013940 3300003790 Bacteria 3012
18 Ga0058863_11912999 3300004799 Bacteria 2601
19 Ga0058860_11973371 3300004801 Bacteria 1960
20 Ga0065704_10079656 3300005289 Bacteria 4107
21 Ga0065704_10098008 3300005289 Bacteria 2368
22 Ga0065704_10222936 3300005289 Bacteria 1068
23 Ga0065712_10003363 3300005290 Bacteria 3779
24 Ga0070683_100098939 3300005329 Bacteria 2745
25 Ga0070670_100034614 3300005331 Bacteria 4346
26 Ga0070682_100029203 3300005337 Bacteria 3319
27 Ga0070689_100075032 3300005340 Bacteria 2647
28 Ga0070671_100112679 3300005355 Bacteria 2285
29 Ga0070688_100013086 3300005365 Bacteria 4670
30 Ga0070659_100118667 3300005366 Bacteria 2140
31 Ga0070667_100056722 3300005367 Bacteria 3310
32 Ga0070709_10003505 3300005434 Bacteria 8425
33 Ga0070714_100055792 3300005435 Bacteria 3377
34 Ga0070713_100004851 3300005436 Bacteria 9115
35 Ga0070713_100180645 3300005436 Bacteria 1896
36 Ga0070713_100199091 3300005436 Bacteria 1808
37 Ga0070713_100608241 3300005436 Bacteria 1039
38 Ga0070710_10002012 3300005437 Bacteria 9618
39 Ga0070711_100010930 3300005439 Bacteria 5627
40 Ga0070694_100022736 3300005444 Bacteria 4022
41 Ga0070663_100030959 3300005455 Bacteria 3672
42 Ga0070678_100034522 3300005456 Bacteria 3524
43 Ga0070662_100338561 3300005457 Bacteria 1230
44 Ga0070681_10057743 3300005458 Bacteria 3861
45 Ga0070685_10145974 3300005466 Bacteria 1495
46 Ga0070679_100050981 3300005530 Bacteria 4122
47 Ga0070697_100572695 3300005536 Bacteria 991
48 Ga0068853_100053311 3300005539 Bacteria 3483
49 Ga0070695_100005596 3300005545 Bacteria 7399
50 Ga0070665_100088128 3300005548 Bacteria 3109
51 Ga0070665_100106568 3300005548 Bacteria 2805
52 Ga0068855_100022819 3300005563 Bacteria 7499
53 Ga0070664_100009118 3300005564 Bacteria 8053
54 Ga0068857_100101065 3300005577 Bacteria 2587
55 Ga0068854_100393449 3300005578 Bacteria 1145
56 Ga0068859_100161848 3300005617 Bacteria 2317
57 Ga0068866_10035858 3300005718 Bacteria 2425
58 Ga0068861_100008454 3300005719 Bacteria 7089
59 Ga0068861_100096253 3300005719 Bacteria 2345
60 Ga0068861_100106711 3300005719 Bacteria 2238
61 Ga0068863_100058324 3300005841 Bacteria 3653
62 Ga0068858_100023351 3300005842 Bacteria 5761
63 Ga0068862_100008291 3300005844 Bacteria 8598
64 Ga0081455_10130165 3300005937 Bacteria 1969
65 Ga0081538_10097957 3300005981 Bacteria 1488
66 Ga0081540_1000080 3300005983 Bacteria 103320
67 Ga0081540_1000114 3300005983 Bacteria 85489
68 Ga0081540_1008986 3300005983 Bacteria 6912
69 Ga0081540_1029164 3300005983 Bacteria 3080
70 Ga0081539_10002321 3300005985 Bacteria 27418
71 Ga0070717_10006158 3300006028 Bacteria 8808
72 Ga0075365_10153162 3300006038 Bacteria 1604
73 Ga0075368_10011432 3300006042 Bacteria 3230
74 Ga0075363_100003699 3300006048 Bacteria 6577
75 Ga0075364_10003434 3300006051 Bacteria 9008
76 Ga0070715_10001469 3300006163 Bacteria 6852
77 Ga0070715_10038430 3300006163 Bacteria 1987
78 Ga0070716_100007591 3300006173 Bacteria 5349
79 Ga0070712_100022128 3300006175 Bacteria 4183
80 Ga0075362_10060156 3300006177 Bacteria 1716
81 Ga0075369_10035938 3300006186 Bacteria 2107
82 Ga0075369_10052781 3300006186 Bacteria 1763
83 Ga0075366_10031043 3300006195 Bacteria 3143
84 Ga0097621_100011914 3300006237 Bacteria 6431
85 Ga0075433_10278847 3300006852 Bacteria 1481
86 Ga0075434_100247029 3300006871 Bacteria 1804
87 Ga0097620_100161847 3300006931 Bacteria 2317
88 Ga0079104_1000011 3300006946 Bacteria 359962
89 Ga0079104_1000044 3300006946 Bacteria 185367
90 Ga0099794_10072907 3300007265 Bacteria 1684
91 Ga0099795_10005699 3300007788 Bacteria 3338
92 Ga0099795_10013258 3300007788 Bacteria 2525
93 Ga0105250_10011799 3300009092 Bacteria 3621
94 Ga0111539_10000244 3300009094 Bacteria 65141
95 Ga0111539_10615801 3300009094 Bacteria 1264
96 Ga0105245_10027864 3300009098 Bacteria 4979
97 Ga0114129_10042279 3300009147 Bacteria 6417
98 Ga0114129_10095248 3300009147 Bacteria 4123
99 Ga0105243_10000661 3300009148 Bacteria 34076
100 Ga0105243_10048621 3300009148 Bacteria 3344
101 Ga0105241_10256269 3300009174 Bacteria 1485
102 Ga0105248_10062722 3300009177 Bacteria 4173
103 Ga0105237_10091606 3300009545 Bacteria 3030
104 Ga0105238_10003753 3300009551 Bacteria 15085
105 Ga0105238_10129024 3300009551 Bacteria 2507
106 Ga0105239_10637902 3300010375 Bacteria 1216
107 Ga0105246_10010435 3300011119 Bacteria 5748
108 Ga0157373_10007320 3300013100 Bacteria 8220
109 Ga0157370_10056781 3300013104 Bacteria 3725
110 Ga0157369_10000801 3300013105 Bacteria 40212
111 Ga0157369_10013180 3300013105 Bacteria 9355
112 Ga0171462_1038 3300013250 Bacteria 77485
113 Ga0157378_10014070 3300013297 Bacteria 7005
114 Ga0163162_10026365 3300013306 Bacteria 5744
115 Ga0163162_10209936 3300013306 Bacteria 2077
116 Ga0163162_10876046 3300013306 Bacteria 1012
117 Ga0157372_10110193 3300013307 Bacteria 3153
118 Ga0157375_10049410 3300013308 Bacteria 4121
119 Ga0163163_10051675 3300014325 Bacteria 4052
120 Ga0157380_10310806 3300014326 Bacteria 1456
121 Ga0182008_10066558 3300014497 Bacteria 1773
122 Ga0157379_10023040 3300014968 Bacteria 5520
123 Ga0157376_10020248 3300014969 Bacteria 5142
124 Ga0183361_10002 3300016635 Bacteria 907642
125 Ga0163161_10015050 3300017792 Bacteria 5391
126 Ga0206349_1584086 3300020075 Bacteria 5166
127 Ga0206351_10081535 3300020077 Bacteria 5225
128 Ga0206352_10921183 3300020078 Bacteria 1627
129 Ga0206350_10392259 3300020080 Bacteria 5265
130 Ga0154015_1119340 3300020610 Bacteria 2312
131 Ga0213872_10001065 3300021361 Bacteria 18985
132 Ga0213872_10018027 3300021361 Bacteria 3257
133 Ga0213876_10013098 3300021384 Bacteria 4406
134 Ga0213875_10006323 3300021388 Bacteria 6234
135 Ga0213875_10025939 3300021388 Bacteria 2789
136 Ga0213871_10009286 3300021441 Bacteria 2199
137 Ga0213871_10014233 3300021441 Bacteria 1884
138 Ga0224712_10001857 3300022467 Bacteria 5068
139 Ga0224712_10037198 3300022467 Bacteria 1810
140 Ga0209674_100165 3300025226 Bacteria 86006
141 Ga0209672_100015 3300025228 Bacteria 529352
142 Ga0209672_100329 3300025228 Bacteria 30814
143 Ga0209147_100016 3300025229 Bacteria 527606
144 Ga0209147_100102 3300025229 Bacteria 159415
145 Ga0209563_100137 3300025230 Bacteria 87321
146 Ga0209258_100026 3300025242 Bacteria 527606
147 Ga0209258_100131 3300025242 Bacteria 175316
148 Ga0209677_100124 3300025253 Bacteria 79576
149 Ga0209148_1000130 3300025254 Bacteria 175316
150 Ga0209759_1005773 3300025256 Bacteria 4259
151 Ga0209233_1005216 3300025261 Bacteria 4336
152 Ga0209565_1007238 3300025263 Bacteria 3013
153 Ga0209455_1000118 3300025272 Bacteria 175316
154 Ga0209455_1001611 3300025272 Bacteria 9901
155 Ga0209673_1000028 3300025273 Bacteria 358901
156 Ga0209673_1001486 3300025273 Bacteria 21871
157 Ga0209673_1004990 3300025273 Bacteria 6878
158 Ga0209675_1000344 3300025291 Bacteria 40566
159 Ga0209675_1007946 3300025291 Bacteria 3972
160 Ga0209676_1023870 3300025292 Bacteria 1993
161 Ga0209025_1000016 3300025294 Bacteria 770739
162 Ga0209025_1003251 3300025294 Bacteria 15657
163 Ga0209564_1000035 3300025295 Bacteria 442446
164 Ga0209564_1000075 3300025295 Bacteria 285760
165 Ga0209564_1000416 3300025295 Bacteria 74830
166 Ga0209564_1005738 3300025295 Bacteria 6936
167 Ga0209564_1006664 3300025295 Bacteria 6157
168 Ga0209758_1013592 3300025297 Bacteria 4419
169 Ga0209256_1000025 3300025299 Bacteria 442449
170 Ga0209256_1000550 3300025299 Bacteria 53839
171 Ga0209256_1000905 3300025299 Bacteria 36349
172 Ga0207426_1014878 3300025302 Bacteria 2843
173 Ga0207426_1039171 3300025302 Bacteria 1487
174 Ga0209051_1001060 3300025303 Bacteria 25669
175 Ga0209051_1024135 3300025303 Bacteria 2509
176 Ga0209051_1030890 3300025303 Bacteria 2071
177 Ga0209257_1031842 3300025304 Bacteria 1680
178 Ga0207696_1012840 3300025711 Bacteria 2946
179 Ga0207692_10002901 3300025898 Bacteria 6637
180 Ga0207642_10044013 3300025899 Bacteria 1973
181 Ga0207647_10011633 3300025904 Bacteria 6163
182 Ga0207647_10026393 3300025904 Bacteria 3802
183 Ga0207699_10000754 3300025906 Bacteria 15470
184 Ga0207705_10012230 3300025909 Bacteria 6201
185 Ga0207695_10002981 3300025913 Bacteria 24373
186 Ga0207671_10013869 3300025914 Bacteria 6400
187 Ga0207693_10009137 3300025915 Bacteria 8092
188 Ga0207663_10007888 3300025916 Bacteria 5552
189 Ga0207660_10151804 3300025917 Bacteria 1780
190 Ga0207657_10000119 3300025919 Bacteria 78609
191 Ga0207657_10008994 3300025919 Bacteria 10086
192 Ga0207649_10097855 3300025920 Bacteria 1935
193 Ga0207694_10005838 3300025924 Bacteria 9438
194 Ga0207694_10021382 3300025924 Bacteria 4903
195 Ga0207700_10001387 3300025928 Bacteria 13762
196 Ga0207644_10111691 3300025931 Bacteria 2067
197 Ga0207690_10000008 3300025932 Bacteria 366090
198 Ga0207686_10037878 3300025934 Bacteria 2913
199 Ga0207709_10000074 3300025935 Bacteria 174947
200 Ga0207709_10062653 3300025935 Bacteria 2328
201 Ga0207670_10255565 3300025936 Bacteria 1356
202 Ga0207665_10013874 3300025939 Bacteria 5299
203 Ga0207711_10026953 3300025941 Bacteria 4824
204 Ga0207689_10173613 3300025942 Bacteria 1777
205 Ga0207661_10178732 3300025944 Bacteria 1852
206 Ga0207667_10013144 3300025949 Bacteria 9496
207 Ga0207658_10071944 3300025986 Bacteria 2620
208 Ga0207703_10084652 3300026035 Bacteria 2652
209 Ga0207678_10000527 3300026067 Bacteria 34787
210 Ga0207678_10012566 3300026067 Bacteria 7440
211 Ga0207708_10186897 3300026075 Bacteria 1647
212 Ga0207702_10343650 3300026078 Bacteria 1426
213 Ga0207641_10010003 3300026088 Bacteria 7802
214 Ga0207676_10024053 3300026095 Bacteria 4503
215 Ga0207674_10210404 3300026116 Bacteria 1894
216 Ga0207675_100016350 3300026118 Bacteria 6925
217 Ga0207675_100036605 3300026118 Bacteria 4577
218 Ga0207675_100037536 3300026118 Bacteria 4519
219 Ga0207683_10011219 3300026121 Bacteria 7637
220 Ga0207698_10094294 3300026142 Bacteria 2460
221 Ga0209281_1000005 3300027111 Bacteria 1242284
222 Ga0209281_1000129 3300027111 Bacteria 194490
223 Ga0209281_1002284 3300027111 Bacteria 8068
224 Ga0209371_1000431 3300027312 Bacteria 42664
225 Ga0209813_10000617 3300027866 Bacteria 8297
226 Ga0207428_10000050 3300027907 Bacteria 177286
227 Ga0268266_10036319 3300028379 Bacteria 4193
228 Ga0268266_10093119 3300028379 Bacteria 2644
229 Ga0268264_10144969 3300028381 Bacteria 2122
230 Ga0268256_1000370 3300030500 Bacteria 42664
231 Ga0265332_10001024 3300031238 Bacteria 16483
232 Ga0265328_10000118 3300031239 Bacteria 37735
233 Ga0265328_10014711 3300031239 Bacteria 3076
234 Ga0265325_10000488 3300031241 Bacteria 28779
235 Ga0265325_10032012 3300031241 Bacteria 2811
236 Ga0265340_10027132 3300031247 Bacteria 2888
237 Ga0265339_10001333 3300031249 Bacteria 18457
238 Ga0265339_10002468 3300031249 Bacteria 13229
239 Ga0265331_10010642 3300031250 Bacteria 5077
240 Ga0265327_10000356 3300031251 Bacteria 87168
241 Ga0265327_10005102 3300031251 Bacteria 11167
242 Ga0265316_10019397 3300031344 Bacteria 5819
243 Ga0265316_10058419 3300031344 Bacteria 3005
244 Ga0265316_10148737 3300031344 Bacteria 1755
245 Ga0265316_10152977 3300031344 Bacteria 1728
246 Ga0265313_10001139 3300031595 Bacteria 25409
247 Ga0265313_10002551 3300031595 Bacteria 15587
248 Ga0265313_10059630 3300031595 Bacteria 1794
249 Ga0265313_10116192 3300031595 Bacteria 1171
250 Ga0265314_10129305 3300031711 Bacteria 1578
251 Ga0265342_10000039 3300031712 Bacteria 140091
252 Ga0307406_10019386 3300031901 Bacteria 3991
253 Ga0307414_10004415 3300032004 Bacteria 7640
254 Ga0373925_0128432 3300037068 Bacteria 1974
255 Ga0395899_0047668 3300037312 Bacteria 3189
256 Ga0395900_0076322 3300037418 Bacteria 3444
257 Ga0395898_0008192 3300037466 Bacteria 11056
258 Ga0436364_0222040 3300037853 Bacteria 3131
259 Ga0436364_1330136 3300037853 Bacteria 1911
260 Ga0436364_1508438 3300037853 Bacteria 17040
261 Ga0395901_0097857 3300038443 Bacteria 3076
262 Ga0395901_0170396 3300038443 Bacteria 2284
263 Ga0436365_0152513 3300039437 Bacteria 5120
264 Ga0436365_0760767 3300039437 Bacteria 27378
265 Ga0436365_1077690 3300039437 Bacteria 1805
266 Ga0436360_0369616 3300039438 Bacteria 1897
267 Ga0436360_0767206 3300039438 Bacteria 5870
268 Ga0436360_1297757 3300039438 Bacteria 1255
269 Ga0436361_0404369 3300039447 Bacteria 8973
270 Ga0436361_0651128 3300039447 Bacteria 3976
271 Ga0436361_1212122 3300039447 Bacteria 1180
272 Ga0436363_1337362 3300039450 Bacteria 1511
273 Ga0439436_0000063 3300041404 Bacteria 29794
274 Ga0439436_0003002 3300041404 Bacteria 5120
275 Ga0439438_004298 3300041405 Bacteria 5515
276 Ga0439447_003715 3300041407 Bacteria 5377
277 Ga0439466_0013734 3300041411 Bacteria 2962
278 Ga0439465_0000670 3300041413 Bacteria 10457
279 Ga0451802_0628774 3300041460 Bacteria 815
280 Ga0439432_000816 3300042006 Bacteria 11609
281 Ga0439432_045745 3300042006 Bacteria 1376
282 Ga0439434_0000608 3300042435 Bacteria 10307
283 Ga0439464_0000683 3300042439 Bacteria 7336
284 Ga0451577_0000194 3300042876 Bacteria 127614
285 Ga0453684_0000218 3300044712 Bacteria 250267
286 Ga0453684_0072013 3300044712 Bacteria 4366
287 Ga0466968_0056416 3300044735 Bacteria 1687
288 Ga0466960_0018190 3300044901 Bacteria 3076
289 Ga0451576_0088576 3300045051 Bacteria 3220
290 Ga0466967_0418783 3300045976 Bacteria 1305
291 Ga0495617_000304 3300046452 Bacteria 27738
292 Ga0495617_026219 3300046452 Bacteria 1962
293 Ga0495603_0010738 3300046455 Bacteria 5554
294 Ga0495590_0003022 3300046457 Bacteria 6894
295 Ga0495629_0023675 3300046459 Bacteria 4374
296 Ga0495638_0000543 3300046460 Bacteria 43505
297 Ga0495638_0041599 3300046460 Bacteria 2906
298 Ga0495638_0097684 3300046460 Bacteria 1760
299 Ga0495641_0105352 3300046461 Bacteria 1258
300 Ga0495651_0024083 3300046462 Bacteria 4736
301 Ga0495653_0001022 3300046463 Bacteria 21574
302 Ga0495653_0275462 3300046463 Bacteria 1106
303 Ga0495650_0000233 3300046471 Bacteria 113132
304 Ga0495580_0000974 3300046472 Bacteria 25086
305 Ga0495580_0003791 3300046472 Bacteria 12807
306 Ga0495580_0020079 3300046472 Bacteria 4952
307 Ga0495582_0010082 3300046473 Bacteria 5203
308 Ga0495605_0003199 3300046474 Bacteria 9823
309 Ga0495664_0008848 3300046477 Bacteria 5625
310 Ga0495596_0001934 3300046500 Bacteria 11460
311 Ga0495607_0034214 3300046501 Bacteria 3084
312 Ga0495606_0000333 3300046507 Bacteria 81527
313 Ga0495606_0000719 3300046507 Bacteria 51243
314 Ga0495606_0001577 3300046507 Bacteria 29881
315 Ga0495606_0015127 3300046507 Bacteria 5968
316 Ga0495606_0036569 3300046507 Bacteria 3342
317 Ga0495608_0228888 3300046511 Bacteria 1164
318 Ga0495610_0002695 3300046512 Bacteria 14636
319 Ga0495610_0021549 3300046512 Bacteria 3541
320 Ga0495616_0000001 3300046513 Bacteria 780061
321 Ga0495616_0124197 3300046513 Bacteria 1188
322 Ga0495618_0023790 3300046514 Bacteria 3792
323 Ga0495628_0000457 3300046516 Bacteria 37378
324 Ga0495630_0008398 3300046517 Bacteria 7405
325 Ga0495630_0009099 3300046517 Bacteria 7139
326 Ga0495630_0025307 3300046517 Bacteria 4387
327 Ga0495637_0041677 3300046520 Bacteria 1968
328 Ga0495643_0086119 3300046522 Bacteria 1628
329 Ga0495648_0005071 3300046524 Bacteria 11053
330 Ga0495648_0013506 3300046524 Bacteria 6031
331 Ga0495666_0000229 3300046526 Bacteria 23906
332 Ga0495642_0021528 3300046528 Bacteria 2536
333 Ga0495652_0032536 3300046529 Bacteria 4560
334 Ga0495652_0035435 3300046529 Bacteria 4343
335 Ga0495652_0181889 3300046529 Bacteria 1612
336 Ga0495654_0000757 3300046530 Bacteria 25005
337 Ga0495665_0000139 3300046531 Bacteria 35407
338 Ga0495640_0029472 3300046533 Bacteria 3941
339 Ga0495640_0036212 3300046533 Bacteria 3487
340 Ga0495640_0038965 3300046533 Bacteria 3339
341 Ga0495586_0000124 3300046535 Bacteria 47092
342 Ga0495587_0007614 3300046536 Bacteria 7009
343 Ga0495609_0006102 3300046538 Bacteria 6199
344 Ga0495597_0000065 3300046542 Bacteria 90745
345 Ga0495645_0024538 3300046543 Bacteria 4376
346 Ga0495622_0000286 3300046557 Bacteria 38555
347 Ga0495622_0084620 3300046557 Bacteria 1459
348 Ga0495656_0166196 3300046615 Bacteria 1075
349 Ga0495634_0006812 3300046642 Bacteria 8648
350 Ga0495611_0059974 3300046648 Bacteria 1728
351 Ga0495635_0050538 3300046663 Bacteria 2866
352 Ga0495635_0214034 3300046663 Bacteria 1305
353 Ga0495661_0021441 3300046665 Bacteria 4212
354 Ga0495657_0142180 3300046675 Bacteria 1495
355 Ga0495599_0018796 3300046678 Bacteria 4308
356 Ga0495599_0044958 3300046678 Bacteria 2768
357 Ga0495599_0090113 3300046678 Bacteria 1914
358 Ga0495623_0061820 3300046679 Bacteria 2348
359 Ga0495646_0053956 3300046680 Bacteria 2420
360 Ga0495613_0007348 3300046689 Bacteria 8208
361 Ga0495624_0001510 3300046690 Bacteria 18034
362 Ga0495624_0102119 3300046690 Bacteria 1765
363 Ga0495649_0029721 3300046694 Bacteria 3020
364 Ga0495649_0101146 3300046694 Bacteria 1532
365 Ga0495589_0000999 3300046794 Bacteria 17183
366 Ga0495589_0003525 3300046794 Bacteria 8464
367 Ga0495660_0000009 3300046810 Bacteria 427395
368 Ga0495581_0065243 3300047315 Bacteria 2105
369 Ga0495604_0017449 3300047317 Bacteria 5746
370 Ga0495636_0114764 3300047318 Bacteria 1187
371 Ga0495674_0035238 3300047319 Bacteria 4516
372 Ga0495674_0053430 3300047319 Bacteria 3551
373 Ga0495674_0087965 3300047319 Bacteria 2658
374 Ga0495674_0198903 3300047319 Bacteria 1663
375 Ga0495672_0002041 3300047320 Bacteria 19000
376 Ga0495672_0003022 3300047320 Bacteria 14796
377 Ga0495672_0080585 3300047320 Bacteria 1815
378 Ga0495672_0083748 3300047320 Bacteria 1770
379 Ga0495676_0025328 3300047321 Bacteria 5124
380 Ga0495680_0001071 3300047322 Bacteria 30324
381 Ga0495680_0045674 3300047322 Bacteria 3458
382 Ga0495683_0029742 3300047323 Bacteria 2790
383 Ga0495683_0068638 3300047323 Bacteria 1743
384 Ga0495675_0072040 3300047444 Bacteria 2180
385 Ga0495675_0075569 3300047444 Bacteria 2123
386 Ga0495679_000001 3300047446 Bacteria 1607568
387 Ga0495679_000269 3300047446 Bacteria 43503
388 Ga0495673_0000001 3300047469 Bacteria 1630730
389 Ga0495673_0000089 3300047469 Bacteria 188744
390 Ga0495681_0145019 3300047470 Bacteria 1000
391 Ga0495684_0051601 3300047471 Bacteria 3139
392 Ga0495684_0227409 3300047471 Bacteria 1365
393 Ga0495686_0000045 3300047472 Bacteria 284761
394 Ga0495686_0000321 3300047472 Bacteria 79813
395 Ga0495602_0000446 3300048088 Bacteria 38693
396 Ga0495602_0267021 3300048088 Bacteria 1266
397 Ga0495614_0000125 3300048089 Bacteria 26649
398 Ga0495614_0056469 3300048089 Bacteria 1685
399 Ga0496100_0013286 3300048903 Bacteria 4743
400 Ga0496101_0051174 3300048904 Bacteria 2975
401 Ga0496102_0135761 3300048905 Bacteria 2305
402 Ga0496102_0568263 3300048905 Bacteria 1057
403 Ga0496103_0025457 3300048906 Bacteria 3576
404 Ga0496104_0000509 3300048907 Bacteria 33320
405 Ga0496104_0010540 3300048907 Bacteria 8255
406 Ga0496104_0010728 3300048907 Bacteria 8193
407 Ga0496104_0060641 3300048907 Bacteria 3584
408 Ga0496105_0000091 3300048908 Bacteria 63179
409 Ga0496105_0000906 3300048908 Bacteria 20196
410 Ga0496105_0003091 3300048908 Bacteria 12242
411 Ga0496105_0010403 3300048908 Bacteria 7316
412 Ga0496106_0124069 3300048909 Bacteria 2021
413 Ga0496108_0012799 3300048911 Bacteria 6831
414 Ga0496109_0008764 3300048912 Bacteria 8612
415 Ga0496110_0007154 3300048913 Bacteria 8885
416 Ga0496110_0072664 3300048913 Bacteria 3052
417 Ga0496111_0003166 3300048914 Bacteria 10136
418 Ga0496112_0020333 3300048915 Bacteria 6290
419 Ga0496112_0059720 3300048915 Bacteria 3757
420 Ga0496113_0019272 3300048916 Bacteria 4769
421 Ga0496114_0004934 3300048917 Bacteria 10398
422 Ga0496114_0504277 3300048917 Bacteria 1070
423 Ga0496115_0069522 3300048918 Bacteria 2852
424 Ga0496116_0001200 3300048919 Bacteria 30339
425 Ga0496116_0005406 3300048919 Bacteria 11880
426 Ga0496116_0007420 3300048919 Bacteria 9732
427 Ga0496117_0009484 3300048920 Bacteria 9048
428 Ga0496117_0013937 3300048920 Bacteria 6967
429 Ga0496117_0115524 3300048920 Bacteria 1661
430 Ga0496118_0001748 3300048921 Bacteria 31538
431 Ga0496118_0015654 3300048921 Bacteria 7005
432 Ga0496118_0017892 3300048921 Bacteria 6429
433 Ga0496119_0001353 3300048922 Bacteria 29962
434 Ga0496119_0001827 3300048922 Bacteria 24654
435 Ga0496119_0002209 3300048922 Bacteria 21740
436 Ga0496119_0018135 3300048922 Bacteria 5256
437 Ga0496119_0259249 3300048922 Bacteria 873
438 Ga0496121_0001280 3300048924 Bacteria 43316
439 Ga0496121_0024603 3300048924 Bacteria 5751
440 Ga0496121_0032632 3300048924 Bacteria 4730
441 Ga0496122_0018190 3300048925 Bacteria 6507
442 Ga0496122_0192354 3300048925 Bacteria 1202
443 Ga0496123_0000625 3300048926 Bacteria 59349
444 Ga0496123_0015321 3300048926 Bacteria 6296
445 Ga0496123_0072936 3300048926 Bacteria 2132
446 Ga0496124_0005319 3300048927 Bacteria 14551
447 Ga0496125_0002186 3300048928 Bacteria 26107
448 Ga0496125_0004081 3300048928 Bacteria 17082
449 Ga0496125_0043289 3300048928 Bacteria 3824
450 Ga0496125_0045080 3300048928 Bacteria 3717
451 Ga0496125_0110937 3300048928 Bacteria 1987
452 Ga0496126_0019890 3300048929 Bacteria 6601
453 Ga0496126_0201790 3300048929 Bacteria 1679
454 Ga0496126_0240291 3300048929 Bacteria 1513
455 Ga0495678_000023 3300049459 Bacteria 233463
456 Ga0495678_070942 3300049459 Bacteria 1277
457 Ga0495682_0007907 3300049460 Bacteria 4206
458 Ga0501032_0028255 3300049569 Bacteria 3854
459 Ga0501033_0018284 3300049570 Bacteria 5296
460 Ga0501034_0090764 3300049571 Bacteria 3052
461 Ga0501037_0174627 3300049573 Bacteria 1526
462 Ga0501038_0027633 3300049574 Bacteria 5046
463 Ga0501039_0239208 3300049575 Bacteria 1428
464 Ga0501042_0028477 3300049578 Bacteria 3936
465 Ga0501043_0028881 3300049579 Bacteria 4353
466 Ga0501047_0006980 3300049581 Bacteria 10603
467 Ga0501067_0035046 3300049583 Bacteria 2786
468 Ga0501070_0104901 3300049586 Bacteria 2337
469 Ga0501073_0009227 3300049589 Bacteria 7273
470 Ga0501076_0015016 3300049592 Bacteria 5848
471 Ga0501238_005774 3300049671 Bacteria 1579
472 Ga0501249_011278 3300049679 Bacteria 1874
473 Ga0501080_0095752 3300049742 Bacteria 2756
474 Ga0501269_000055 3300049766 Bacteria 34934
475 Ga0501035_0008241 3300049822 Bacteria 9710
476 Ga0501044_0041463 3300049823 Bacteria 4792
477 Ga0501044_0295134 3300049823 Bacteria 1551
478 nmdc:mga03683_10012_c1 3300050489 Bacteria 3388
479 nmdc:mga03n38_1083_c1 3300050490 Bacteria 7512
480 nmdc:mga00v17_240_c1 3300050491 Bacteria 32452
481 nmdc:mga00v17_48410_c1 3300050491 Bacteria 2577
482 nmdc:mga0k408_16176_c1 3300050493 Bacteria 4136
483 nmdc:mga06z11_32565_c1 3300050494 Bacteria 2047
484 nmdc:mga06z11_43415_c1 3300050494 Bacteria 2262
485 nmdc:mga07m45_87811_c1 3300050496 Bacteria 1779
486 nmdc:mga08y16_554145_c1 3300050511 Bacteria 1163
487 nmdc:mga08y16_56_c1 3300050511 Bacteria 99587
488 nmdc:mga0sz30_10525_c1 3300050516 Bacteria 3549
489 nmdc:mga0sz30_50820_c1 3300050516 Bacteria 1758
490 nmdc:mga0sz30_88842_c1 3300050516 Bacteria 1343
491 Ga0500643_000002 3300053087 Bacteria 1277657
492 Ga0500643_007159 3300053087 Bacteria 4559
493 Ga0500644_0000829 3300053088 Bacteria 10425
494 Ga0500651_0033392 3300053093 Bacteria 3245
495 Ga0500556_0000327 3300053104 Bacteria 35744
496 Ga0500562_003035 3300053108 Bacteria 4194
497 Ga0500595_000078 3300053119 Bacteria 68089
498 Ga0500642_0000005 3300053130 Bacteria 422725
499 Ga0500652_001106 3300053131 Bacteria 8687
500 Ga0500652_016222 3300053131 Bacteria 2706
501 Ga0500652_020783 3300053131 Bacteria 2462
502 Ga0500574_000170 3300053141 Bacteria 7649
503 Ga0500616_0000006 3300053153 Bacteria 944738
504 Ga0500645_000486 3300053730 Bacteria 26878
505 Ga0500645_006022 3300053730 Bacteria 4377
506 Ga0500645_014691 3300053730 Bacteria 2491
507 Ga0587082_002216 3300059504 Bacteria 2159
508 Ga0587085_002115 3300059506 Bacteria 1986
509 Ga0530510_0202180 3300061734 Bacteria 1476
510 2501084245 2501025502 Bacteria 9641094
511 2509075831 2508501114 Bacteria 7082538
512 2510284258 2510065053 Bacteria 5005518
513 2510293058 2510065055 Bacteria 5037935
514 2510304815 2510065057 Bacteria 6649661
515 2511088669 2510917013 Bacteria 9951648
516 2511499194 2511231052 Bacteria 6974333
517 2512530479 2512047086 Bacteria 6850303
518 2513564583 2513237083 Bacteria 8410967
519 2513585140 2513237086 Bacteria 7265287
520 2513590838 2513237087 Bacteria 5817514
521 2513616035 2513237091 Bacteria 6900273
522 2513723436 2513237104 Bacteria 10034502
523 2513883320 2513237140 Bacteria 7076289
524 2513902774 2513237143 Bacteria 6664116
525 2516021049 2515154189 Bacteria 9629850
526 2516898047 2516653046 Bacteria 6989037
527 2519461960 2519103095 Bacteria 6629912
528 2524451608 2524023207 Bacteria 6813453
529 2535518079 2534681796 Bacteria 7146037
530 2551679153 2551306084 Bacteria 8942552
531 2551680979 2551306084 Bacteria 8942552
532 2551686056 2551306085 Bacteria 7347181
533 2551713236 2551306089 Bacteria 7162724
534 2551717062 2551306090 Bacteria 7953713
535 2551733427 2551306092 Bacteria 6992595
536 2554817825 2554235132 Bacteria 6772433
537 2585290223 2582581311 Bacteria 6763856
538 2596374952 2595698237 Bacteria 6712432
539 2599720725 2599185236 Bacteria 6875203
540 2599748583 2599185240 Bacteria 7968121
541 2599941078 2599185301 Bacteria 6161860
542 2600210429 2599185355 Bacteria 7968906
543 2603862063 2602042107 Bacteria 6226103
544 2608380852 2606217733 Bacteria 6360972
545 2643754810 2643221547 Bacteria 4740017
546 2644108188 2643221618 Bacteria 7717186
547 2644145885 2643221626 Bacteria 8069654
548 2644206858 2643221637 Bacteria 5345260
549 2644307364 2643221655 Bacteria 7722067
550 2644331380 2643221659 Bacteria 7890716
551 2644541396 2643221698 Bacteria 7756764
552 2644613453 2643221712 Bacteria 7729434
553 2644650506 2643221718 Bacteria 5345506
554 2671695293 2671180139 Bacteria 4196045
555 2676746674 2675903129 Bacteria 7964495
556 2687578660 2687453129 Bacteria 4387428
557 2722883980 2721755523 Bacteria 6430384
558 2729145507 2728369097 Bacteria 4333476
559 2808967885 2808606384 Bacteria 8474373
560 2812369009 2811994881 Bacteria 6298475
561 2817258815 2816332253 Bacteria 6764532
562 2817280752 2816332256 Bacteria 6891714
563 2817454740 2816332286 Bacteria 6853759
564 2819686733 2818991461 Bacteria 7026071
565 2819717751 2818991467 Bacteria 5893227
566 2821127262 2821123053 Bacteria 7836056
567 2823425289 2823421272 Bacteria 5372474
568 2828307013 2828305725 Bacteria 4916900
569 2834580915 2834578030 Bacteria 3530182
570 2835319004 2835312727 Bacteria 7413381
571 2838740594 2838736955 Bacteria 5760694
572 2839140247 2839138175 Bacteria 6549354
573 2841844435 2841840854 Bacteria 5761912
574 2842144497 2842140634 Bacteria 5759631
575 2842325908 2842324504 Bacteria 9364110
576 2842718443 2842718218 Bacteria 4560148
577 2842920561 2842918807 Bacteria 4289178
578 2844166961 2844163670 Bacteria 7266046
579 2854914771 2854911287 Bacteria 5582813
580 2855829899 2855825444 Bacteria 6785811
581 2855846180 2855839649 Bacteria 7135830
582 2857534757 2857531043 Bacteria 6754041
583 2858804814 2858800743 Bacteria 6603254
584 2863426104 2863421361 Bacteria 7300805
585 2870075061 2870068957 Bacteria 8925310
586 2871501626 2871495908 Bacteria 6935695
587 2874123968 2874123672 Bacteria 7238285
588 2878765563 2878760144 Bacteria 6823465
589 2878772753 2878767105 Bacteria 6898628
590 2881151070 2881147464 Bacteria 7779814
591 2883356348 2883354860 Bacteria 5865246
592 2883577858 2883577096 Bacteria 4709178
593 2885306070 2885305155 Bacteria 7348390
594 2885332228 2885326080 Bacteria 7134805
595 2885338026 2885334103 Bacteria 7216818
596 2889306488 2889306138 Bacteria 6358934
597 2891635126 2891633521 Bacteria 4602265
598 2894027117 2894023352 Bacteria 5167372
599 2894817670 2894817345 Bacteria 4892941
600 2902411420 2902405164 Bacteria 6784948
601 2903546442 2903540706 Bacteria 7062119
602 2904565299 2904564687 Bacteria 7609577
603 2904572005 2904571731 Bacteria 7608790
604 2915654520 2915650412 Bacteria 4288180
605 2915989604 2915986958 Bacteria 6739310
606 2915999148 2915993759 Bacteria 7016183
607 2916001086 2916000859 Bacteria 6865702
608 2916011956 2916007675 Bacteria 6898660
609 2916017835 2916014648 Bacteria 6946486
610 2916025607 2916021584 Bacteria 6854472
611 2916032342 2916028427 Bacteria 6748433
612 2916035509 2916035215 Bacteria 6755766
613 2916043178 2916041962 Bacteria 6820487
614 2916049410 2916048683 Bacteria 6543552
615 2916056502 2916055098 Bacteria 6758838
616 2916071080 2916068649 Bacteria 6943657
617 2916076632 2916076590 Bacteria 6596108
618 2917700940 2917699015 Bacteria 7043791
619 2919405641 2919404418 Bacteria 4232372
620 2921206511 2921201388 Bacteria 6926299
621 2921208619 2921208531 Bacteria 6745326
622 2921238396 2921237296 Bacteria 6876710
623 2921249963 2921244191 Bacteria 6568419
624 2921259691 2921257292 Bacteria 6808382
625 2921265531 2921263974 Bacteria 6864552
626 2921289188 2921282425 Bacteria 6826397
627 2921292488 2921289301 Bacteria 7316391
628 2921302712 2921296804 Bacteria 7176999
629 2923523089 2923519811 Bacteria 6298479
630 2924150267 2924144063 Bacteria 6883928
631 2924153506 2924150972 Bacteria 7169444
632 2924162734 2924158325 Bacteria 7188855
633 2924168988 2924165586 Bacteria 7260590
634 2924174047 2924172951 Bacteria 6749356
635 2924184841 2924179722 Bacteria 6843264
636 2924189297 2924186466 Bacteria 6876637
637 2924198073 2924193448 Bacteria 6955718
638 2924206380 2924200457 Bacteria 6757188
639 2924208622 2924207177 Bacteria 6917007
640 2924220798 2924214083 Bacteria 7080103
641 2924224882 2924221636 Bacteria 7113495
642 2924234772 2924228884 Bacteria 6633132
643 2928157465 2928157003 Bacteria 7522202
644 2928165279 2928163908 Bacteria 7561269
645 2928537324 2928536128 Bacteria 7657547
646 2932425430 2932422444 Bacteria 4678430
647 2937008813 2937002841 Bacteria 6934057
648 2937012340 2937009748 Bacteria 6746052
649 2937021231 2937016420 Bacteria 6782579
650 2937026277 2937023124 Bacteria 6815156
651 2937047112 2937042894 Bacteria 6741576
652 2937049828 2937049772 Bacteria 6757901
653 2937056737 2937056579 Bacteria 7107896
654 2937068106 2937063883 Bacteria 7199456
655 2937075510 2937071275 Bacteria 6984483
656 2937091857 2937091812 Bacteria 6979387
657 2937103229 2937098957 Bacteria 7249374
658 2937110621 2937106411 Bacteria 6947143
659 2937113799 2937113482 Bacteria 6505872
660 2937121271 2937119839 Bacteria 6597547
661 2937126420 2937126314 Bacteria 6771275
662 2938000303 2937994558 Bacteria 7036190
663 2941502869 2941499720 Bacteria 7599444
664 2957384024 2957382221 Bacteria 6737050
665 2957390954 2957388812 Bacteria 6778072
666 2957396363 2957395598 Bacteria 6822399
667 2957405365 2957402308 Bacteria 6741770
668 2957412724 2957408893 Bacteria 6558585
669 2957415866 2957415311 Bacteria 6991633
670 2957423124 2957422303 Bacteria 7172205
671 2957432381 2957430029 Bacteria 7022557
672 2957448149 2957443900 Bacteria 6869977
673 2957454166 2957450854 Bacteria 6765715
674 2957462328 2957457609 Bacteria 6967680
675 2957470357 2957464669 Bacteria 6568877
676 2957474101 2957471148 Bacteria 6797643
677 2957478098 2957478035 Bacteria 6756658
678 2957487996 2957484790 Bacteria 6703082
679 2957493529 2957491536 Bacteria 6695180
680 2957498252 2957498199 Bacteria 7126688
681 2957508385 2957505466 Bacteria 7253085
682 2958170735 2958165035 Bacteria 6906348
683 2960585479 2960584000 Bacteria 6864594
684 2960598975 2960597568 Bacteria 6550735
685 2960606082 2960603979 Bacteria 6898737
686 2960611513 2960610863 Bacteria 6691244
687 2960620656 2960617483 Bacteria 6727748
688 2960629491 2960624210 Bacteria 6875384
689 2960639332 2960637947 Bacteria 7296468
690 2960651705 2960645483 Bacteria 7211087
691 2960658281 2960652885 Bacteria 7083688
692 2960665967 2960660292 Bacteria 7041660
693 2960673624 2960667422 Bacteria 6763020
694 2960679978 2960674078 Bacteria 6609048
695 2960691254 2960687367 Bacteria 6535474
696 2961169185 2961163497 Bacteria 6901077
697 2964608037 2964607997 Bacteria 7101408
698 2964617670 2964615318 Bacteria 6809089
699 2964628678 2964621998 Bacteria 6834995
700 2964629587 2964628898 Bacteria 7083044
701 2964638726 2964636051 Bacteria 7091832
702 2964644673 2964643177 Bacteria 6820887
703 2964654667 2964649959 Bacteria 6675118
704 2964660858 2964656573 Bacteria 7100150
705 2964664553 2964663802 Bacteria 7019362
706 2964674673 2964670856 Bacteria 6851364
707 2964683819 2964678106 Bacteria 6792020
708 2964691514 2964685014 Bacteria 6839111
709 2964694460 2964691889 Bacteria 6802758
710 2964701091 2964698721 Bacteria 6765331
711 2964705538 2964705432 Bacteria 7114648
712 2964718262 2964712639 Bacteria 6695970
713 2964720920 2964719344 Bacteria 7286602
714 2965019132 2965018300 Bacteria 6883036
715 2967665011 2967664464 Bacteria 6948836
716 2967678098 2967671571 Bacteria 7021409
717 2967682837 2967678726 Bacteria 7264382
718 2967693891 2967693043 Bacteria 6804451
719 2967706311 2967699805 Bacteria 6854538
720 2967708716 2967706974 Bacteria 7186053
721 2967719722 2967714385 Bacteria 7000047
722 2967726735 2967721400 Bacteria 7073753
723 2967738051 2967735183 Bacteria 6827012
724 2967747310 2967742019 Bacteria 6794534
725 2967753194 2967748971 Bacteria 6733771
726 2967756821 2967755722 Bacteria 6814706
727 2967765623 2967762386 Bacteria 6923502
728 2967775123 2967769361 Bacteria 6587838
729 2967780981 2967775926 Bacteria 6738189
730 2968177568 2968171901 Bacteria 6894245
731 2970025447 2970019648 Bacteria 7072033
732 2970036595 2970033650 Bacteria 7118744
733 2970043699 2970040964 Bacteria 6731123
734 2970047931 2970047711 Bacteria 7088379
735 2970056350 2970054988 Bacteria 6611507
736 2970061609 2970061556 Bacteria 7099761
737 2970072220 2970068827 Bacteria 7123112
738 2970079916 2970076120 Bacteria 6697332
739 2970085513 2970082768 Bacteria 6183754
740 2970088868 2970088815 Bacteria 6933825
741 2970098198 2970095765 Bacteria 6936963
742 2970106281 2970102677 Bacteria 6812532
743 2970113264 2970109326 Bacteria 6863976
744 2970117205 2970116247 Bacteria 6501857
745 2970130666 2970129317 Bacteria 6806560
746 2970139091 2970136068 Bacteria 7207982
747 2970156547 2970149975 Bacteria 6779706
748 2970156812 2970156795 Bacteria 7168044
749 2970164247 2970164137 Bacteria 6861252
750 2970172561 2970170962 Bacteria 6876229
751 2970182658 2970177841 Bacteria 6768001
752 2970185195 2970184632 Bacteria 7054431
753 2970193205 2970191845 Bacteria 7032787
754 2970560414 2970554993 Bacteria 6814252
755 2977517533 2977516862 Bacteria 6940108
756 2977529621 2977523885 Bacteria 6960446
757 2977541887 2977537788 Bacteria 6929320
758 2977555147 2977551784 Bacteria 7125765
759 2977565691 2977558990 Bacteria 6863948
760 2977567806 2977565890 Bacteria 6901543
761 2977578577 2977572785 Bacteria 6763888
762 2977581358 2977579622 Bacteria 6772100
763 2977871510 2977864932 Bacteria 7534097
764 2987665251 2987659509 Bacteria 6966464
765 3004194304 3004188549 Bacteria 6952365
766 648736280 648276728 Bacteria 6968865
767 8003960125 8003955200 Bacteria 8601927
768 8003998641 8003992118 Bacteria 7266902
769 8005548961 8005542996 Bacteria 7077758
770 8018846490 8018845410 Bacteria 8933938
771 8020808479 8020807995 Bacteria 6801506
772 8020948605 8020945358 Bacteria 8467355
773 8040168172 8040167225 Bacteria 6542727
774 8040174437 8040173305 Bacteria 6827067
775 8057134691 8057132660 Bacteria 4061191
776 Ga0075364_10069802
777 JGI24739J22299_10012955
778 JGI24738J21930_10000095
779 JGI25156J39149_1000311
780 JGI25150J39212_1002960
781 JGI25151J46595_10000056
782 Ga0006562J51391_1005875
783 Ga0055539_1000180
784 Ga0055533_1000169
785 Ga0055525_1000526
786 Ga0055529_1000290
787 Ga0055526_1000114
788 Ga0055526_1003873
789 Ga0055526_1008399
790 Ga0055524_1000089
791 Ga0055528_1004510
792 Ga0055528_1013940
793 Ga0058863_11912999
794 Ga0058860_11973371
795 Ga0065704_10079656
796 Ga0065704_10098008
797 Ga0065704_10222936
798 Ga0065712_10003363
799 Ga0070683_100098939
800 Ga0070670_100034614
801 Ga0070682_100029203
802 Ga0070689_100075032
803 Ga0070671_100112679
804 Ga0070688_100013086
805 Ga0070659_100118667
806 Ga0070667_100056722
807 Ga0070709_10003505
808 Ga0070714_100055792
809 Ga0070713_100004851
810 Ga0070713_100180645
811 Ga0070713_100199091
812 Ga0070713_100608241
813 Ga0070710_10002012
814 Ga0070711_100010930
815 Ga0070694_100022736
816 Ga0070663_100030959
817 Ga0070678_100034522
818 Ga0070662_100338561
819 Ga0070681_10057743
820 Ga0070685_10145974
821 Ga0070679_100050981
822 Ga0070697_100572695
823 Ga0068853_100053311
824 Ga0070695_100005596
825 Ga0070665_100088128
826 Ga0070665_100106568
827 Ga0068855_100022819
828 Ga0070664_100009118
829 Ga0068857_100101065
830 Ga0068854_100393449
831 Ga0068859_100161848
832 Ga0068866_10035858
833 Ga0068861_100008454
834 Ga0068861_100096253
835 Ga0068861_100106711
836 Ga0068863_100058324
837 Ga0068858_100023351
838 Ga0068862_100008291
839 Ga0081455_10130165
840 Ga0081538_10097957
841 Ga0081540_1000080
842 Ga0081540_1000114
843 Ga0081540_1008986
844 Ga0081540_1029164
845 Ga0081539_10002321
846 Ga0070717_10006158
847 Ga0075365_10153162
848 Ga0075368_10011432
849 Ga0075363_100003699
850 Ga0075364_10003434
851 Ga0070715_10001469
852 Ga0070715_10038430
853 Ga0070716_100007591
854 Ga0070712_100022128
855 Ga0075362_10060156
856 Ga0075369_10035938
857 Ga0075369_10052781
858 Ga0075366_10031043
859 Ga0097621_100011914
860 Ga0075433_10278847
861 Ga0075434_100247029
862 Ga0097620_100161847
863 Ga0079104_1000011
864 Ga0079104_1000044
865 Ga0099794_10072907
866 Ga0099795_10005699
867 Ga0099795_10013258
868 Ga0105250_10011799
869 Ga0111539_10000244
870 Ga0111539_10615801
871 Ga0105245_10027864
872 Ga0114129_10042279
873 Ga0114129_10095248
874 Ga0105243_10000661
875 Ga0105243_10048621
876 Ga0105241_10256269
877 Ga0105248_10062722
878 Ga0105237_10091606
879 Ga0105238_10003753
880 Ga0105238_10129024
881 Ga0105239_10637902
882 Ga0105246_10010435
883 Ga0157373_10007320
884 Ga0157370_10056781
885 Ga0157369_10000801
886 Ga0157369_10013180
887 Ga0171462_1038
888 Ga0157378_10014070
889 Ga0163162_10026365
890 Ga0163162_10209936
891 Ga0163162_10876046
892 Ga0157372_10110193
893 Ga0157375_10049410
894 Ga0163163_10051675
895 Ga0157380_10310806
896 Ga0182008_10066558
897 Ga0157379_10023040
898 Ga0157376_10020248
899 Ga0183361_10002
900 Ga0163161_10015050
901 Ga0206349_1584086
902 Ga0206351_10081535
903 Ga0206352_10921183
904 Ga0206350_10392259
905 Ga0154015_1119340
906 Ga0213872_10001065
907 Ga0213872_10018027
908 Ga0213876_10013098
909 Ga0213875_10006323
910 Ga0213875_10025939
911 Ga0213871_10009286
912 Ga0213871_10014233
913 Ga0224712_10001857
914 Ga0224712_10037198
915 Ga0209674_100165
916 Ga0209672_100015
917 Ga0209672_100329
918 Ga0209147_100016
919 Ga0209147_100102
920 Ga0209563_100137
921 Ga0209258_100026
922 Ga0209258_100131
923 Ga0209677_100124
924 Ga0209148_1000130
925 Ga0209759_1005773
926 Ga0209233_1005216
927 Ga0209565_1007238
928 Ga0209455_1000118
929 Ga0209455_1001611
930 Ga0209673_1000028
931 Ga0209673_1001486
932 Ga0209673_1004990
933 Ga0209675_1000344
934 Ga0209675_1007946
935 Ga0209676_1023870
936 Ga0209025_1000016
937 Ga0209025_1003251
938 Ga0209564_1000035
939 Ga0209564_1000075
940 Ga0209564_1000416
941 Ga0209564_1005738
942 Ga0209564_1006664
943 Ga0209758_1013592
944 Ga0209256_1000025
945 Ga0209256_1000550
946 Ga0209256_1000905
947 Ga0207426_1014878
948 Ga0207426_1039171
949 Ga0209051_1001060
950 Ga0209051_1024135
951 Ga0209051_1030890
952 Ga0209257_1031842
953 Ga0207696_1012840
954 Ga0207692_10002901
955 Ga0207642_10044013
956 Ga0207647_10011633
957 Ga0207647_10026393
958 Ga0207699_10000754
959 Ga0207705_10012230
960 Ga0207695_10002981
961 Ga0207671_10013869
962 Ga0207693_10009137
963 Ga0207663_10007888
964 Ga0207660_10151804
965 Ga0207657_10000119
966 Ga0207657_10008994
967 Ga0207649_10097855
968 Ga0207694_10005838
969 Ga0207694_10021382
970 Ga0207700_10001387
971 Ga0207644_10111691
972 Ga0207690_10000008
973 Ga0207686_10037878
974 Ga0207709_10000074
975 Ga0207709_10062653
976 Ga0207670_10255565
977 Ga0207665_10013874
978 Ga0207711_10026953
979 Ga0207689_10173613
980 Ga0207661_10178732
981 Ga0207667_10013144
982 Ga0207658_10071944
983 Ga0207703_10084652
984 Ga0207678_10000527
985 Ga0207678_10012566
986 Ga0207708_10186897
987 Ga0207702_10343650
988 Ga0207641_10010003
989 Ga0207676_10024053
990 Ga0207674_10210404
991 Ga0207675_100016350
992 Ga0207675_100036605
993 Ga0207675_100037536
994 Ga0207683_10011219
995 Ga0207698_10094294
996 Ga0209281_1000005
997 Ga0209281_1000129
998 Ga0209281_1002284
999 Ga0209371_1000431
1000 Ga0209813_10000617
1001 Ga0207428_10000050
1002 Ga0268266_10036319
1003 Ga0268266_10093119
1004 Ga0268264_10144969
1005 Ga0268256_1000370
1006 Ga0265332_10001024
1007 Ga0265328_10000118
1008 Ga0265328_10014711
1009 Ga0265325_10000488
1010 Ga0265325_10032012
1011 Ga0265340_10027132
1012 Ga0265339_10001333
1013 Ga0265339_10002468
1014 Ga0265331_10010642
1015 Ga0265327_10000356
1016 Ga0265327_10005102
1017 Ga0265316_10019397
1018 Ga0265316_10058419
1019 Ga0265316_10148737
1020 Ga0265316_10152977
1021 Ga0265313_10001139
1022 Ga0265313_10002551
1023 Ga0265313_10059630
1024 Ga0265313_10116192
1025 Ga0265314_10129305
1026 Ga0265342_10000039
1027 Ga0307406_10019386
1028 Ga0307414_10004415
1029 Ga0373925_0128432
1030 Ga0395899_0047668
1031 Ga0395900_0076322
1032 Ga0395898_0008192
1033 Ga0436364_0222040
1034 Ga0436364_1330136
1035 Ga0436364_1508438
1036 Ga0395901_0097857
1037 Ga0395901_0170396
1038 Ga0436365_0152513
1039 Ga0436365_0760767
1040 Ga0436365_1077690
1041 Ga0436360_0369616
1042 Ga0436360_0767206
1043 Ga0436360_1297757
1044 Ga0436361_0404369
1045 Ga0436361_0651128
1046 Ga0436361_1212122
1047 Ga0436363_1337362
1048 Ga0439436_0000063
1049 Ga0439436_0003002
1050 Ga0439438_004298
1051 Ga0439447_003715
1052 Ga0439466_0013734
1053 Ga0439465_0000670
1054 Ga0451802_0628774
1055 Ga0439432_000816
1056 Ga0439432_045745
1057 Ga0439434_0000608
1058 Ga0439464_0000683
1059 Ga0451577_0000194
1060 Ga0453684_0000218
1061 Ga0453684_0072013
1062 Ga0466968_0056416
1063 Ga0466960_0018190
1064 Ga0451576_0088576
1065 Ga0466967_0418783
1066 Ga0495617_000304
1067 Ga0495617_026219
1068 Ga0495603_0010738
1069 Ga0495590_0003022
1070 Ga0495629_0023675
1071 Ga0495638_0000543
1072 Ga0495638_0041599
1073 Ga0495638_0097684
1074 Ga0495641_0105352
1075 Ga0495651_0024083
1076 Ga0495653_0001022
1077 Ga0495653_0275462
1078 Ga0495650_0000233
1079 Ga0495580_0000974
1080 Ga0495580_0003791
1081 Ga0495580_0020079
1082 Ga0495582_0010082
1083 Ga0495605_0003199
1084 Ga0495664_0008848
1085 Ga0495596_0001934
1086 Ga0495607_0034214
1087 Ga0495606_0000333
1088 Ga0495606_0000719
1089 Ga0495606_0001577
1090 Ga0495606_0015127
1091 Ga0495606_0036569
1092 Ga0495608_0228888
1093 Ga0495610_0002695
1094 Ga0495610_0021549
1095 Ga0495616_0000001
1096 Ga0495616_0124197
1097 Ga0495618_0023790
1098 Ga0495628_0000457
1099 Ga0495630_0008398
1100 Ga0495630_0009099
1101 Ga0495630_0025307
1102 Ga0495637_0041677
1103 Ga0495643_0086119
1104 Ga0495648_0005071
1105 Ga0495648_0013506
1106 Ga0495666_0000229
1107 Ga0495642_0021528
1108 Ga0495652_0032536
1109 Ga0495652_0035435
1110 Ga0495652_0181889
1111 Ga0495654_0000757
1112 Ga0495665_0000139
1113 Ga0495640_0029472
1114 Ga0495640_0036212
1115 Ga0495640_0038965
1116 Ga0495586_0000124
1117 Ga0495587_0007614
1118 Ga0495609_0006102
1119 Ga0495597_0000065
1120 Ga0495645_0024538
1121 Ga0495622_0000286
1122 Ga0495622_0084620
1123 Ga0495656_0166196
1124 Ga0495634_0006812
1125 Ga0495611_0059974
1126 Ga0495635_0050538
1127 Ga0495635_0214034
1128 Ga0495661_0021441
1129 Ga0495657_0142180
1130 Ga0495599_0018796
1131 Ga0495599_0044958
1132 Ga0495599_0090113
1133 Ga0495623_0061820
1134 Ga0495646_0053956
1135 Ga0495613_0007348
1136 Ga0495624_0001510
1137 Ga0495624_0102119
1138 Ga0495649_0029721
1139 Ga0495649_0101146
1140 Ga0495589_0000999
1141 Ga0495589_0003525
1142 Ga0495660_0000009
1143 Ga0495581_0065243
1144 Ga0495604_0017449
1145 Ga0495636_0114764
1146 Ga0495674_0035238
1147 Ga0495674_0053430
1148 Ga0495674_0087965
1149 Ga0495674_0198903
1150 Ga0495672_0002041
1151 Ga0495672_0003022
1152 Ga0495672_0080585
1153 Ga0495672_0083748
1154 Ga0495676_0025328
1155 Ga0495680_0001071
1156 Ga0495680_0045674
1157 Ga0495683_0029742
1158 Ga0495683_0068638
1159 Ga0495675_0072040
1160 Ga0495675_0075569
1161 Ga0495679_000001
1162 Ga0495679_000269
1163 Ga0495673_0000001
1164 Ga0495673_0000089
1165 Ga0495681_0145019
1166 Ga0495684_0051601
1167 Ga0495684_0227409
1168 Ga0495686_0000045
1169 Ga0495686_0000321
1170 Ga0495602_0000446
1171 Ga0495602_0267021
1172 Ga0495614_0000125
1173 Ga0495614_0056469
1174 Ga0496100_0013286
1175 Ga0496101_0051174
1176 Ga0496102_0135761
1177 Ga0496102_0568263
1178 Ga0496103_0025457
1179 Ga0496104_0000509
1180 Ga0496104_0010540
1181 Ga0496104_0010728
1182 Ga0496104_0060641
1183 Ga0496105_0000091
1184 Ga0496105_0000906
1185 Ga0496105_0003091
1186 Ga0496105_0010403
1187 Ga0496106_0124069
1188 Ga0496108_0012799
1189 Ga0496109_0008764
1190 Ga0496110_0007154
1191 Ga0496110_0072664
1192 Ga0496111_0003166
1193 Ga0496112_0020333
1194 Ga0496112_0059720
1195 Ga0496113_0019272
1196 Ga0496114_0004934
1197 Ga0496114_0504277
1198 Ga0496115_0069522
1199 Ga0496116_0001200
1200 Ga0496116_0005406
1201 Ga0496116_0007420
1202 Ga0496117_0009484
1203 Ga0496117_0013937
1204 Ga0496117_0115524
1205 Ga0496118_0001748
1206 Ga0496118_0015654
1207 Ga0496118_0017892
1208 Ga0496119_0001353
1209 Ga0496119_0001827
1210 Ga0496119_0002209
1211 Ga0496119_0018135
1212 Ga0496119_0259249
1213 Ga0496121_0001280
1214 Ga0496121_0024603
1215 Ga0496121_0032632
1216 Ga0496122_0018190
1217 Ga0496122_0192354
1218 Ga0496123_0000625
1219 Ga0496123_0015321
1220 Ga0496123_0072936
1221 Ga0496124_0005319
1222 Ga0496125_0002186
1223 Ga0496125_0004081
1224 Ga0496125_0043289
1225 Ga0496125_0045080
1226 Ga0496125_0110937
1227 Ga0496126_0019890
1228 Ga0496126_0201790
1229 Ga0496126_0240291
1230 Ga0495678_000023
1231 Ga0495678_070942
1232 Ga0495682_0007907
1233 Ga0501032_0028255
1234 Ga0501033_0018284
1235 Ga0501034_0090764
1236 Ga0501037_0174627
1237 Ga0501038_0027633
1238 Ga0501039_0239208
1239 Ga0501042_0028477
1240 Ga0501043_0028881
1241 Ga0501047_0006980
1242 Ga0501067_0035046
1243 Ga0501070_0104901
1244 Ga0501073_0009227
1245 Ga0501076_0015016
1246 Ga0501238_005774
1247 Ga0501249_011278
1248 Ga0501080_0095752
1249 Ga0501269_000055
1250 Ga0501035_0008241
1251 Ga0501044_0041463
1252 Ga0501044_0295134
1253 nmdc:mga03683_10012_c1
1254 nmdc:mga03n38_1083_c1
1255 nmdc:mga00v17_240_c1
1256 nmdc:mga00v17_48410_c1
1257 nmdc:mga0k408_16176_c1
1258 nmdc:mga06z11_32565_c1
1259 nmdc:mga06z11_43415_c1
1260 nmdc:mga07m45_87811_c1
1261 nmdc:mga08y16_554145_c1
1262 nmdc:mga08y16_56_c1
1263 nmdc:mga0sz30_10525_c1
1264 nmdc:mga0sz30_50820_c1
1265 nmdc:mga0sz30_88842_c1
1266 Ga0500643_000002
1267 Ga0500643_007159
1268 Ga0500644_0000829
1269 Ga0500651_0033392
1270 Ga0500556_0000327
1271 Ga0500562_003035
1272 Ga0500595_000078
1273 Ga0500642_0000005
1274 Ga0500652_001106
1275 Ga0500652_016222
1276 Ga0500652_020783
1277 Ga0500574_000170
1278 Ga0500616_0000006
1279 Ga0500645_000486
1280 Ga0500645_006022
1281 Ga0500645_014691
1282 Ga0587082_002216
1283 Ga0587085_002115
1284 Ga0530510_0202180
1285 2501084245
1286 2509075831
1287 2510284258
1288 2510293058
1289 2510304815
1290 2511088669
1291 2511499194
1292 2512530479
1293 2513564583
1294 2513585140
1295 2513590838
1296 2513616035
1297 2513723436
1298 2513883320
1299 2513902774
1300 2516021049
1301 2516898047
1302 2519461960
1303 2524451608
1304 2535518079
1305 2551679153
1306 2551680979
1307 2551686056
1308 2551713236
1309 2551717062
1310 2551733427
1311 2554817825
1312 2585290223
1313 2596374952
1314 2599720725
1315 2599748583
1316 2599941078
1317 2600210429
1318 2603862063
1319 2608380852
1320 2643754810
1321 2644108188
1322 2644145885
1323 2644206858
1324 2644307364
1325 2644331380
1326 2644541396
1327 2644613453
1328 2644650506
1329 2671695293
1330 2676746674
1331 2687578660
1332 2722883980
1333 2729145507
1334 2808967885
1335 2812369009
1336 2817258815
1337 2817280752
1338 2817454740
1339 2819686733
1340 2819717751
1341 2821127262
1342 2823425289
1343 2828307013
1344 2834580915
1345 2835319004
1346 2838740594
1347 2839140247
1348 2841844435
1349 2842144497
1350 2842325908
1351 2842718443
1352 2842920561
1353 2844166961
1354 2854914771
1355 2855829899
1356 2855846180
1357 2857534757
1358 2858804814
1359 2863426104
1360 2870075061
1361 2871501626
1362 2874123968
1363 2878765563
1364 2878772753
1365 2881151070
1366 2883356348
1367 2883577858
1368 2885306070
1369 2885332228
1370 2885338026
1371 2889306488
1372 2891635126
1373 2894027117
1374 2894817670
1375 2902411420
1376 2903546442
1377 2904565299
1378 2904572005
1379 2915654520
1380 2915989604
1381 2915999148
1382 2916001086
1383 2916011956
1384 2916017835
1385 2916025607
1386 2916032342
1387 2916035509
1388 2916043178
1389 2916049410
1390 2916056502
1391 2916071080
1392 2916076632
1393 2917700940
1394 2919405641
1395 2921206511
1396 2921208619
1397 2921238396
1398 2921249963
1399 2921259691
1400 2921265531
1401 2921289188
1402 2921292488
1403 2921302712
1404 2923523089
1405 2924150267
1406 2924153506
1407 2924162734
1408 2924168988
1409 2924174047
1410 2924184841
1411 2924189297
1412 2924198073
1413 2924206380
1414 2924208622
1415 2924220798
1416 2924224882
1417 2924234772
1418 2928157465
1419 2928165279
1420 2928537324
1421 2932425430
1422 2937008813
1423 2937012340
1424 2937021231
1425 2937026277
1426 2937047112
1427 2937049828
1428 2937056737
1429 2937068106
1430 2937075510
1431 2937091857
1432 2937103229
1433 2937110621
1434 2937113799
1435 2937121271
1436 2937126420
1437 2938000303
1438 2941502869
1439 2957384024
1440 2957390954
1441 2957396363
1442 2957405365
1443 2957412724
1444 2957415866
1445 2957423124
1446 2957432381
1447 2957448149
1448 2957454166
1449 2957462328
1450 2957470357
1451 2957474101
1452 2957478098
1453 2957487996
1454 2957493529
1455 2957498252
1456 2957508385
1457 2958170735
1458 2960585479
1459 2960598975
1460 2960606082
1461 2960611513
1462 2960620656
1463 2960629491
1464 2960639332
1465 2960651705
1466 2960658281
1467 2960665967
1468 2960673624
1469 2960679978
1470 2960691254
1471 2961169185
1472 2964608037
1473 2964617670
1474 2964628678
1475 2964629587
1476 2964638726
1477 2964644673
1478 2964654667
1479 2964660858
1480 2964664553
1481 2964674673
1482 2964683819
1483 2964691514
1484 2964694460
1485 2964701091
1486 2964705538
1487 2964718262
1488 2964720920
1489 2965019132
1490 2967665011
1491 2967678098
1492 2967682837
1493 2967693891
1494 2967706311
1495 2967708716
1496 2967719722
1497 2967726735
1498 2967738051
1499 2967747310
1500 2967753194
1501 2967756821
1502 2967765623
1503 2967775123
1504 2967780981
1505 2968177568
1506 2970025447
1507 2970036595
1508 2970043699
1509 2970047931
1510 2970056350
1511 2970061609
1512 2970072220
1513 2970079916
1514 2970085513
1515 2970088868
1516 2970098198
1517 2970106281
1518 2970113264
1519 2970117205
1520 2970130666
1521 2970139091
1522 2970156547
1523 2970156812
1524 2970164247
1525 2970172561
1526 2970182658
1527 2970185195
1528 2970193205
1529 2970560414
1530 2977517533
1531 2977529621
1532 2977541887
1533 2977555147
1534 2977565691
1535 2977567806
1536 2977578577
1537 2977581358
1538 2977871510
1539 2987665251
1540 3004194304
1541 648736280
1542 8003960125
1543 8003998641
1544 8005548961
1545 8018846490
1546 8020808479
1547 8020948605
1548 8040168172
1549 8040174437
1550 8057134691

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09163

Form-deh_trans

Formate dehydrogenase N, transmembrane

266

309

0.99

PF13247

Fer4_11

4Fe-4S dicluster domain

111

209

0.95

PF00037

Fer4

4Fe-4S binding domain

146

169

0.88

PF12837

Fer4_6

4Fe-4S binding domain

145

168

0.88

PF13237

Fer4_10

4Fe-4S dicluster domain

112

164

0.88

PF12838

Fer4_7

4Fe-4S dicluster domain

56

137

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bqk-assembly1.cif.gz_B w-formate dehydrogenase from desulfovibrio vulgaris - soaking with formate 22 min 0.8432 28 238
1h0h-assembly2.cif.gz_L tungsten containing formate dehydrogenase from desulfovibrio gigas 0.8357 28 238
1kqf-assembly1.cif.gz_B formate dehydrogenase n from e. coli 0.8321 2 289
1kqf-assembly1.cif.gz_B formate dehydrogenase n from e. coli 0.8267 2 289
8bqk-assembly1.cif.gz_B w-formate dehydrogenase from desulfovibrio vulgaris - soaking with formate 22 min 0.8254 28 238
ID Description Score Start End Superfamily
1kqgB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9209 99 162 3.30.70.20
1kqgB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8935 27 228 3.30.70.20
1kqgB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8875 27 228 3.30.70.20
af_Q86I95_32_170_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.8682 79 97 1.20.1280.290
af_D4A2T2_39_180_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.8607 79 97 1.20.1280.290
ID Description Score Start End GO Terms
AF-A0A378EHB2-F1-model_v4 deleted 0.9467 101 255
AF-A0A316XKB8-F1-model_v4 deleted 0.9411 86 246
AF-A0A377LQA2-F1-model_v4 Formate dehydrogenase subunit beta (EC 1.17.1.9) 0.9389 80 230 GO:0008863
GO:0030313
GO:0046872
GO:0051539
AF-A0A378EHB2-F1-model_v4 deleted 0.9351 101 255
AF-A0A6N6X763-F1-model_v4 deleted 0.9305 75 238

Map