F480265

General Info

Members Datasets Scaffolds Average Seq Length
775 552 1550 246

Family's Representative Sequence

Representative Sequence 3300028577|Ga0265318_10002087|Ga0265318_100020876
Length 291
Sequence MYDIPKITRPSKDIIAQLKDIGTATVAGSLAHAGFRQPHMIGPVTQYPGKSIVGTALTLQFLPQRPDLFSEGEYADVEKQLHRHVLYQVEEGDVVVVDARGDMTSGVFGDMMSTYFKGRGGAGIVIDGVMRDRPNVDKLDLALWLRGWTPNYHVQTGIYPSAVNVPIACGGVQVIPGDIIMADDDGVVVLPVSMAAKVIEDSKKHAEWEVFSREKLKQGADLRRYYPLHADAQGEYEAWRKLNPIRNSAYPATSVKCSSNHLPGTMRRLRDSSSVARALASITGTAVSSGT

Samples

Sample ID Description Type Environment
1 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
78 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
79 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
93 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
94 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
95 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
97 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
98 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
149 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
150 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
151 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
152 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
158 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
165 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
166 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
176 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
177 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
178 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
179 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
180 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
181 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
182 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
183 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
190 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
191 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
192 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
198 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
199 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
200 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
203 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
204 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
205 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
234 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
235 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
236 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
239 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
240 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
241 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
242 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
243 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
244 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
245 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
246 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
250 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
251 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
252 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
253 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
254 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
255 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
256 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
257 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
258 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
259 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
260 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
261 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
262 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
263 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
264 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
265 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
266 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
267 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
268 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
269 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
270 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
271 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
272 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
273 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
274 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
275 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
276 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
277 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
278 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
279 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
280 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
281 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
282 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
283 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
284 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
285 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
286 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
287 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
288 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
289 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
290 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
291 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
292 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
293 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
294 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
295 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
296 2643221580 Devosia sp. Root635 Isolate Unclassified
297 2643221591 Devosia sp. Root685 Isolate Unclassified
298 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
299 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
300 2643221629 Devosia sp. Root105 Isolate Unclassified
301 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
302 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
303 2643221662 Devosia sp. Root413D1 Isolate Unclassified
304 2643221674 Devosia sp. Root436 Isolate Unclassified
305 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
306 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
307 2718217882 Rhizobium sp. N741 Isolate Nodule
308 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
309 2718218009 Rhizobium sp. N561 Isolate Nodule
310 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
311 2718218363 Rhizobium sp. N113 Isolate Nodule
312 2718218365 Rhizobium sp. N731 Isolate Nodule
313 2718218366 Rhizobium sp. N621 Isolate Nodule
314 2721755514 Rhizobium sp. N6212 Isolate Nodule
315 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
316 2721755810 Rhizobium sp. N871 Isolate Nodule
317 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
318 2728369365 Rhizobium sp. N1341 Isolate Nodule
319 2728369397 Rhizobium sp. N1314 Isolate Nodule
320 2738541293 Rhizobium sp. GV031 Isolate Unclassified
321 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
322 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
323 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
324 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
325 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
326 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
327 2791355260 Rhizobium sp. L9 Isolate Nodule
328 2791355264 Rhizobium sp. S9 Isolate Nodule
329 2791355265 Rhizobium sp. H4 Isolate Nodule
330 2791355267 Rhizobium sp. L18 Isolate Nodule
331 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
332 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
333 2802429633 Rhizobium anhuiense J3 Isolate Nodule
334 2802429634 Rhizobium anhuiense S10 Isolate Nodule
335 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
336 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
337 2802429637 Rhizobium anhuiense C15 Isolate Nodule
338 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
339 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
340 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
341 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
342 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
343 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
344 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
345 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
346 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
347 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
348 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
349 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
350 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
351 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
352 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
353 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
354 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
355 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
356 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
357 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
358 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
359 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
360 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
361 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
362 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
363 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
364 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
365 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
366 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
367 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
368 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
369 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
370 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
371 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
372 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
373 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
374 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
375 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
376 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
377 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
378 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
379 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
380 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
381 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
382 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
383 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
384 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
385 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
386 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
387 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
388 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
389 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
390 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
391 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
392 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
393 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
394 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
395 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
396 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
397 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
398 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
399 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
400 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
401 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
402 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
403 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
404 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
405 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
406 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
407 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
408 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
409 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
410 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
411 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
412 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
413 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
414 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
415 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
416 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
417 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
418 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
419 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
420 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
421 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
422 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
423 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
424 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
425 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
426 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
427 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
428 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
429 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
430 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
431 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
432 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
433 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
434 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
435 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
436 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
437 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
438 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
439 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
440 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
441 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
442 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
443 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
444 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
445 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
446 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
447 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
448 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
449 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
450 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
451 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
452 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
453 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
454 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
455 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
456 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
457 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
458 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
459 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
460 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
461 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
462 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
463 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
464 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
465 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
466 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
467 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
468 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
469 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
470 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
471 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
472 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
473 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
474 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
475 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
476 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
477 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
478 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
479 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
480 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
481 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
482 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
483 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
484 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
485 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
486 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
487 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
488 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
489 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
490 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
491 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
492 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
493 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
494 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
495 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
496 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
497 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
498 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
499 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
500 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
501 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
502 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
503 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
504 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
505 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
506 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
507 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
508 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
509 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
510 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
511 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
512 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
513 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
514 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
515 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
516 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
517 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
518 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
519 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
520 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
521 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
522 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
523 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
524 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
525 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
526 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
527 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
528 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
529 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
530 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
531 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
532 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
533 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
534 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
535 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
536 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
537 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
538 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
539 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
540 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
541 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
542 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
543 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
544 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
545 8024501048 Rhizobium sp. H4 Isolate Nodule
546 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
547 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
548 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
549 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
550 8056382006 Rhizobium croatiense 13T Isolate Nodule
551 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
552 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 60.52
Metatranscriptomes 0
Isolates 39.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.23
Nodule 32.39
Rhizoplane 0.52
Rhizosphere 39.35
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265318_10002087 3300028577 Bacteria 10931
2 JGI24741J21665_1010079 3300001915 Bacteria 1708
3 JGI24739J22299_10018230 3300001989 Bacteria 2525
4 JGI25156J39149_1002223 3300002705 Bacteria 7181
5 JGI25158J39367_1000205 3300002739 Bacteria 14120
6 JGI25157J39369_1000599 3300002741 Bacteria 21188
7 JGI25152J39213_1004650 3300002773 Bacteria 4254
8 JGI25152J39213_1006150 3300002773 Bacteria 3337
9 JGI25152J39213_1009450 3300002773 Bacteria 2317
10 JGI25150J39212_1007385 3300002774 Bacteria 2212
11 JGI25159J45721_1001121 3300002987 Bacteria 11452
12 JGI25151J46595_10000867 3300003187 Bacteria 23973
13 JGI25151J46595_10004550 3300003187 Bacteria 7312
14 JGI25151J46595_10018558 3300003187 Bacteria 2981
15 rootL2_10015096 3300003322 Bacteria 17553
16 rootH1_10100374 3300003323 Bacteria 7653
17 JGI25161J50226_1000050 3300003374 Bacteria 110628
18 JGI25161J50226_1003954 3300003374 Bacteria 3223
19 Ga0055526_1000595 3300003771 Bacteria 28430
20 Ga0055526_1024018 3300003771 Bacteria 2010
21 Ga0055524_1000922 3300003775 Bacteria 18970
22 Ga0055524_1002690 3300003775 Bacteria 8994
23 Ga0055524_1018262 3300003775 Bacteria 2443
24 Ga0055536_1052975 3300003781 Bacteria 880
25 Ga0055528_1000096 3300003790 Bacteria 70375
26 Ga0055528_1000716 3300003790 Bacteria 23431
27 Ga0055528_1014786 3300003790 Bacteria 2863
28 Ga0055528_1018681 3300003790 Bacteria 2339
29 Ga0055528_1030026 3300003790 Bacteria 1454
30 Ga0055540_1000399 3300003792 Bacteria 35498
31 Ga0055540_1031822 3300003792 Bacteria 1209
32 Ga0055540_1049953 3300003792 Bacteria 866
33 Ga0055543_1000489 3300004625 Bacteria 22914
34 Ga0065165_1005024 3300005262 Bacteria 7736
35 Ga0065165_1007074 3300005262 Bacteria 5637
36 Ga0065165_1016267 3300005262 Bacteria 2793
37 Ga0065707_10120174 3300005295 Bacteria 2141
38 Ga0070658_10019519 3300005327 Bacteria 5428
39 Ga0070683_100108132 3300005329 Bacteria 2622
40 Ga0070683_100605748 3300005329 Bacteria 1048
41 Ga0070682_100068256 3300005337 Bacteria 2267
42 Ga0068868_100138538 3300005338 Bacteria 1996
43 Ga0070660_100030363 3300005339 Bacteria 4055
44 Ga0070660_100133813 3300005339 Bacteria 1986
45 Ga0070660_100145156 3300005339 Bacteria 1905
46 Ga0070660_100180793 3300005339 Bacteria 1706
47 Ga0070687_100332424 3300005343 Bacteria 975
48 Ga0070661_100005094 3300005344 Bacteria 9066
49 Ga0070661_100018671 3300005344 Bacteria 4934
50 Ga0070661_100042747 3300005344 Bacteria 3308
51 Ga0070661_100074458 3300005344 Bacteria 2501
52 Ga0070661_100079929 3300005344 Bacteria 2413
53 Ga0070668_100011517 3300005347 Bacteria 6586
54 Ga0070668_100176104 3300005347 Bacteria 1744
55 Ga0070669_100016868 3300005353 Bacteria 5213
56 Ga0070669_100086993 3300005353 Bacteria 2336
57 Ga0070669_100217606 3300005353 Bacteria 1509
58 Ga0070674_100016108 3300005356 Bacteria 4683
59 Ga0070674_100049340 3300005356 Bacteria 2893
60 Ga0070674_100433145 3300005356 Bacteria 1082
61 Ga0070673_100217950 3300005364 Bacteria 1651
62 Ga0070659_100017270 3300005366 Bacteria 5425
63 Ga0070659_100161964 3300005366 Bacteria 1830
64 Ga0070659_100378991 3300005366 Bacteria 1191
65 Ga0070710_10000809 3300005437 Bacteria 15018
66 Ga0070708_100222091 3300005445 Bacteria 1772
67 Ga0070663_100008664 3300005455 Bacteria 6271
68 Ga0070663_100028440 3300005455 Bacteria 3806
69 Ga0070662_100030424 3300005457 Bacteria 3777
70 Ga0068867_100338039 3300005459 Bacteria 1253
71 Ga0070707_100140234 3300005468 Bacteria 2353
72 Ga0070699_100422994 3300005518 Bacteria 1206
73 Ga0070679_100131508 3300005530 Bacteria 2483
74 Ga0070684_100328127 3300005535 Bacteria 1406
75 Ga0070684_100625806 3300005535 Bacteria 1001
76 Ga0070684_100914887 3300005535 Bacteria 822
77 Ga0068853_100001347 3300005539 Bacteria 17688
78 Ga0068853_100012183 3300005539 Bacteria 6993
79 Ga0068853_100022202 3300005539 Bacteria 5298
80 Ga0070686_100035123 3300005544 Bacteria 3094
81 Ga0070665_100008163 3300005548 Bacteria 10598
82 Ga0070665_100058286 3300005548 Bacteria 3872
83 Ga0070665_100336422 3300005548 Bacteria 1514
84 Ga0068855_100040893 3300005563 Bacteria 5498
85 Ga0068855_100353259 3300005563 Bacteria 1619
86 Ga0068857_100021902 3300005577 Bacteria 5624
87 Ga0068857_100074871 3300005577 Bacteria 3018
88 Ga0068857_100166175 3300005577 Bacteria 2004
89 Ga0068854_100001486 3300005578 Bacteria 14198
90 Ga0068854_100041169 3300005578 Bacteria 3264
91 Ga0068854_100044855 3300005578 Bacteria 3141
92 Ga0068856_100012342 3300005614 Bacteria 8274
93 Ga0068856_100154879 3300005614 Bacteria 2301
94 Ga0068856_100281122 3300005614 Bacteria 1681
95 Ga0068856_100322254 3300005614 Bacteria 1563
96 Ga0068856_100454630 3300005614 Bacteria 1301
97 Ga0068852_100017669 3300005616 Bacteria 5601
98 Ga0068852_100034234 3300005616 Bacteria 4224
99 Ga0068852_100050523 3300005616 Bacteria 3563
100 Ga0068852_100119104 3300005616 Bacteria 2413
101 Ga0068852_100375473 3300005616 Bacteria 1394
102 Ga0068852_100885067 3300005616 Bacteria 910
103 Ga0068851_10005070 3300005834 Bacteria 5974
104 Ga0068862_100003242 3300005844 Bacteria 14082
105 Ga0068862_100047167 3300005844 Bacteria 3676
106 Ga0068862_100547084 3300005844 Bacteria 1105
107 Ga0081540_1019814 3300005983 Bacteria 4072
108 Ga0081539_10000316 3300005985 Bacteria 107841
109 Ga0070717_10104762 3300006028 Bacteria 2407
110 Ga0075365_10020389 3300006038 Bacteria 4109
111 Ga0075365_10023833 3300006038 Bacteria 3853
112 Ga0075365_10036309 3300006038 Bacteria 3192
113 Ga0075365_10186122 3300006038 Bacteria 1452
114 Ga0075365_10228251 3300006038 Bacteria 1307
115 Ga0075368_10035242 3300006042 Bacteria 1952
116 Ga0075363_100072523 3300006048 Bacteria 1872
117 Ga0075363_100213452 3300006048 Bacteria 1105
118 Ga0075364_10222336 3300006051 Bacteria 1282
119 Ga0075364_10443482 3300006051 Bacteria 887
120 Ga0075362_10003549 3300006177 Bacteria 5474
121 Ga0075362_10128528 3300006177 Bacteria 1203
122 Ga0075367_10012197 3300006178 Bacteria 4572
123 Ga0075367_10016873 3300006178 Bacteria 3996
124 Ga0075367_10189720 3300006178 Bacteria 1282
125 Ga0075367_10310440 3300006178 Bacteria 993
126 Ga0075369_10030199 3300006186 Bacteria 2281
127 Ga0075369_10044691 3300006186 Bacteria 1903
128 Ga0075369_10105746 3300006186 Bacteria 1265
129 Ga0075366_10001329 3300006195 Bacteria 12354
130 Ga0075366_10200289 3300006195 Bacteria 1214
131 Ga0075370_10034041 3300006353 Bacteria 2855
132 Ga0075370_10076482 3300006353 Bacteria 1920
133 Ga0075370_10121047 3300006353 Bacteria 1523
134 Ga0075370_10332111 3300006353 Bacteria 906
135 Ga0068871_100533514 3300006358 Bacteria 1061
136 Ga0075431_100615695 3300006847 Bacteria 1069
137 Ga0075429_100564614 3300006880 Bacteria 997
138 Ga0068865_100108227 3300006881 Bacteria 2046
139 Ga0105244_10089445 3300009036 Bacteria 1516
140 Ga0105240_10000336 3300009093 Bacteria 87900
141 Ga0105240_10057132 3300009093 Bacteria 4878
142 Ga0111539_10698752 3300009094 Bacteria 1180
143 Ga0105245_10391104 3300009098 Bacteria 1387
144 Ga0114129_10080578 3300009147 Bacteria 4525
145 Ga0114129_10316295 3300009147 Bacteria 2076
146 Ga0114129_10384072 3300009147 Bacteria 1854
147 Ga0105241_10087477 3300009174 Bacteria 2453
148 Ga0105241_10105300 3300009174 Bacteria 2249
149 Ga0105241_10183428 3300009174 Bacteria 1737
150 Ga0105241_10350362 3300009174 Bacteria 1282
151 Ga0105237_10000690 3300009545 Bacteria 46704
152 Ga0105237_10167494 3300009545 Bacteria 2196
153 Ga0105237_10330040 3300009545 Bacteria 1530
154 Ga0105238_10013090 3300009551 Bacteria 8369
155 Ga0105238_10014048 3300009551 Bacteria 8097
156 Ga0105238_10034505 3300009551 Bacteria 5147
157 Ga0123341_1004539 3300009765 Bacteria 12198
158 Ga0123342_1017768 3300009766 Bacteria 5840
159 Ga0105032_103260 3300009979 Bacteria 1414
160 Ga0105239_10013586 3300010375 Bacteria 9038
161 Ga0105239_10183511 3300010375 Bacteria 2341
162 Ga0105239_10194870 3300010375 Bacteria 2269
163 Ga0105239_10281176 3300010375 Bacteria 1873
164 Ga0105239_10531845 3300010375 Bacteria 1338
165 Ga0157322_1004080 3300012490 Bacteria 934
166 Ga0157371_10028500 3300013102 Bacteria 4043
167 Ga0157370_10026622 3300013104 Bacteria 5707
168 Ga0157370_10658944 3300013104 Bacteria 956
169 Ga0157369_10113277 3300013105 Bacteria 2881
170 Ga0157374_10119111 3300013296 Bacteria 2546
171 Ga0157378_10082289 3300013297 Bacteria 2911
172 Ga0157378_10417244 3300013297 Bacteria 1326
173 Ga0157372_10128256 3300013307 Bacteria 2917
174 Ga0157372_10152488 3300013307 Bacteria 2668
175 Ga0157375_10149482 3300013308 Unclassified 2470
176 Ga0182008_10225101 3300014497 Bacteria 961
177 Ga0157379_10729142 3300014968 Bacteria 932
178 Ga0213876_10002694 3300021384 Bacteria 10371
179 Ga0209436_100031 3300025208 Bacteria 82827
180 Ga0209436_114778 3300025208 Bacteria 1231
181 Ga0207425_1002640 3300025245 Bacteria 6188
182 Ga0207425_1006193 3300025245 Bacteria 3302
183 Ga0207425_1017953 3300025245 Bacteria 1543
184 Ga0209026_1000029 3300025250 Bacteria 337109
185 Ga0209677_103335 3300025253 Bacteria 5282
186 Ga0209759_1000040 3300025256 Bacteria 254501
187 Ga0209129_1000016 3300025258 Bacteria 485491
188 Ga0209129_1000669 3300025258 Bacteria 22694
189 Ga0209129_1001340 3300025258 Bacteria 13927
190 Ga0209129_1002531 3300025258 Bacteria 8879
191 Ga0209233_1000097 3300025261 Bacteria 295452
192 Ga0209673_1000063 3300025273 Bacteria 256709
193 Ga0209673_1000252 3300025273 Bacteria 101552
194 Ga0209673_1000291 3300025273 Bacteria 93803
195 Ga0209673_1001400 3300025273 Bacteria 23490
196 Ga0209673_1002105 3300025273 Bacteria 14931
197 Ga0209673_1002242 3300025273 Bacteria 13961
198 Ga0209130_1000031 3300025284 Bacteria 322932
199 Ga0209130_1000048 3300025284 Bacteria 233357
200 Ga0209130_1005302 3300025284 Bacteria 4524
201 Ga0209025_1000338 3300025294 Bacteria 103479
202 Ga0209025_1000430 3300025294 Bacteria 83230
203 Ga0209025_1005207 3300025294 Bacteria 10728
204 Ga0209564_1000586 3300025295 Bacteria 57490
205 Ga0209564_1000664 3300025295 Bacteria 50898
206 Ga0209564_1000876 3300025295 Bacteria 40029
207 Ga0209564_1006096 3300025295 Bacteria 6625
208 Ga0209564_1013624 3300025295 Bacteria 3434
209 Ga0209758_1000490 3300025297 Bacteria 64714
210 Ga0209758_1001257 3300025297 Bacteria 31390
211 Ga0209758_1001647 3300025297 Bacteria 25345
212 Ga0209758_1002831 3300025297 Bacteria 16855
213 Ga0209758_1004719 3300025297 Bacteria 11117
214 Ga0209758_1013935 3300025297 Bacteria 4327
215 Ga0209758_1034009 3300025297 Bacteria 2036
216 Ga0209050_1003257 3300025298 Bacteria 12215
217 Ga0209256_1000463 3300025299 Bacteria 61298
218 Ga0209256_1001515 3300025299 Bacteria 23483
219 Ga0209256_1002067 3300025299 Bacteria 17689
220 Ga0209256_1004108 3300025299 Bacteria 9426
221 Ga0207426_1000042 3300025302 Bacteria 433289
222 Ga0207426_1000075 3300025302 Bacteria 321337
223 Ga0207426_1000136 3300025302 Bacteria 201401
224 Ga0209051_1000671 3300025303 Bacteria 38414
225 Ga0209051_1016239 3300025303 Bacteria 3382
226 Ga0209051_1025534 3300025303 Bacteria 2401
227 Ga0209257_1000504 3300025304 Bacteria 68999
228 Ga0209257_1065337 3300025304 Bacteria 975
229 Ga0207656_10003814 3300025321 Bacteria 5222
230 Ga0207692_10001415 3300025898 Bacteria 8982
231 Ga0207680_10179295 3300025903 Bacteria 1431
232 Ga0207647_10008504 3300025904 Bacteria 7354
233 Ga0207647_10107942 3300025904 Bacteria 1647
234 Ga0207645_10014079 3300025907 Bacteria 5360
235 Ga0207643_10338636 3300025908 Bacteria 942
236 Ga0207705_10184788 3300025909 Bacteria 1574
237 Ga0207705_10247464 3300025909 Bacteria 1359
238 Ga0207654_10035337 3300025911 Bacteria 2783
239 Ga0207654_10118616 3300025911 Bacteria 1658
240 Ga0207695_10000458 3300025913 Bacteria 88734
241 Ga0207695_10265603 3300025913 Bacteria 1613
242 Ga0207671_10000577 3300025914 Bacteria 49208
243 Ga0207671_10016228 3300025914 Bacteria 5797
244 Ga0207671_10373874 3300025914 Bacteria 1132
245 Ga0207657_10009115 3300025919 Bacteria 10011
246 Ga0207657_10011473 3300025919 Bacteria 8796
247 Ga0207657_10012411 3300025919 Bacteria 8419
248 Ga0207657_10020971 3300025919 Bacteria 6163
249 Ga0207649_10008971 3300025920 Bacteria 5464
250 Ga0207649_10011064 3300025920 Bacteria 4966
251 Ga0207649_10308811 3300025920 Bacteria 1158
252 Ga0207681_10092411 3300025923 Bacteria 2163
253 Ga0207694_10014161 3300025924 Bacteria 6013
254 Ga0207694_10033622 3300025924 Bacteria 3928
255 Ga0207694_10256710 3300025924 Bacteria 1431
256 Ga0207650_10318883 3300025925 Bacteria 1273
257 Ga0207687_10269151 3300025927 Bacteria 1361
258 Ga0207687_10364131 3300025927 Bacteria 1181
259 Ga0207664_10028791 3300025929 Bacteria 4225
260 Ga0207664_10398737 3300025929 Bacteria 1223
261 Ga0207690_10331894 3300025932 Bacteria 1198
262 Ga0207706_10511363 3300025933 Bacteria 1036
263 Ga0207669_10004321 3300025937 Bacteria 6244
264 Ga0207669_10025236 3300025937 Bacteria 3208
265 Ga0207669_10048578 3300025937 Bacteria 2522
266 Ga0207704_10232228 3300025938 Bacteria 1373
267 Ga0207691_10048476 3300025940 Bacteria 3895
268 Ga0207691_10466494 3300025940 Bacteria 1074
269 Ga0207679_10428795 3300025945 Bacteria 1168
270 Ga0207667_10004954 3300025949 Bacteria 16268
271 Ga0207667_10102920 3300025949 Bacteria 2945
272 Ga0207667_10201250 3300025949 Bacteria 2043
273 Ga0207651_10194905 3300025960 Bacteria 1619
274 Ga0207668_10009534 3300025972 Bacteria 5824
275 Ga0207668_10719554 3300025972 Bacteria 879
276 Ga0207640_10011282 3300025981 Bacteria 5055
277 Ga0207640_10011939 3300025981 Bacteria 4933
278 Ga0207677_10065799 3300026023 Bacteria 2531
279 Ga0207639_10042470 3300026041 Bacteria 3408
280 Ga0207639_10293587 3300026041 Bacteria 1434
281 Ga0207639_10895807 3300026041 Bacteria 829
282 Ga0207678_10012764 3300026067 Bacteria 7379
283 Ga0207678_10018975 3300026067 Bacteria 6041
284 Ga0207702_10132709 3300026078 Bacteria 2243
285 Ga0207702_10150220 3300026078 Bacteria 2118
286 Ga0207702_10373360 3300026078 Bacteria 1370
287 Ga0207702_10417985 3300026078 Bacteria 1296
288 Ga0207702_10571203 3300026078 Bacteria 1108
289 Ga0207648_10096669 3300026089 Bacteria 2584
290 Ga0207674_10004581 3300026116 Bacteria 16594
291 Ga0207674_10095351 3300026116 Bacteria 2961
292 Ga0207674_10159834 3300026116 Bacteria 2208
293 Ga0207674_10176501 3300026116 Bacteria 2089
294 Ga0207683_10046943 3300026121 Bacteria 3781
295 Ga0207698_10055985 3300026142 Bacteria 3043
296 Ga0207698_10073770 3300026142 Bacteria 2718
297 Ga0207698_10082567 3300026142 Bacteria 2598
298 Ga0207698_10247042 3300026142 Bacteria 1630
299 Ga0207698_10381936 3300026142 Bacteria 1340
300 Ga0268266_10003641 3300028379 Bacteria 15245
301 Ga0268266_10083243 3300028379 Bacteria 2793
302 Ga0268266_10236163 3300028379 Bacteria 1685
303 Ga0268265_10005163 3300028380 Bacteria 8944
304 Ga0268265_10028795 3300028380 Bacteria 3981
305 Ga0307517_10225947 3300028786 Bacteria 1131
306 Ga0307515_10299599 3300028794 Bacteria 1294
307 Ga0307512_10009090 3300030522 Bacteria 9610
308 Ga0316177_1021166 3300030731 Bacteria 3048
309 Ga0316176_1184345 3300030732 Bacteria 1549
310 Ga0316180_1172947 3300030736 Bacteria 3542
311 Ga0265332_10039082 3300031238 Bacteria 2055
312 Ga0307513_10007748 3300031456 Bacteria 13861
313 Ga0307513_10204001 3300031456 Bacteria 1815
314 Ga0307513_10275582 3300031456 Bacteria 1463
315 Ga0307408_100079573 3300031548 Bacteria 2446
316 Ga0265314_10034609 3300031711 Bacteria 3689
317 Ga0265342_10252510 3300031712 Bacteria 941
318 Ga0316576_10378557 3300031727 Bacteria 1051
319 Ga0307516_10117405 3300031730 Bacteria 2455
320 Ga0307413_10320543 3300031824 Bacteria 1184
321 Ga0307407_10283933 3300031903 Bacteria 1148
322 Ga0307412_10096675 3300031911 Bacteria 2079
323 Ga0307414_10083504 3300032004 Bacteria 2346
324 Ga0307414_10254581 3300032004 Bacteria 1461
325 Ga0307414_10275573 3300032004 Bacteria 1411
326 Ga0307411_10243830 3300032005 Bacteria 1409
327 Ga0373939_0104884 3300035114 Bacteria 976
328 Ga0373942_0047873 3300035207 Bacteria 1189
329 Ga0316574_0124785 3300035398 Unclassified 1654
330 Ga0373931_0013840 3300035691 Bacteria 3935
331 Ga0373947_0300628 3300035725 Bacteria 1070
332 Ga0316584_0390262 3300036712 Bacteria 993
333 Ga0395899_0036782 3300037312 Bacteria 3670
334 Ga0395905_0000791 3300037471 Bacteria 41576
335 Ga0395905_0005397 3300037471 Bacteria 13065
336 Ga0395905_0046646 3300037471 Bacteria 4063
337 Ga0395905_0229782 3300037471 Bacteria 1735
338 Ga0436364_0393289 3300037853 Bacteria 14105
339 Ga0436364_0469241 3300037853 Bacteria 9261
340 Ga0436364_0579643 3300037853 Bacteria 34127
341 Ga0395901_0092105 3300038443 Bacteria 3173
342 Ga0436365_0257230 3300039437 Bacteria 39667
343 Ga0436360_0835435 3300039438 Bacteria 1712
344 Ga0436363_1085806 3300039450 Bacteria 1694
345 Ga0439465_0014043 3300041413 Bacteria 2494
346 Ga0439465_0109519 3300041413 Bacteria 960
347 Ga0451839_1234649 3300041496 Bacteria 957
348 Ga0451845_0296105 3300041501 Bacteria 1446
349 Ga0451847_0268177 3300041503 Bacteria 1132
350 Ga0451849_1289643 3300041505 Bacteria 1320
351 Ga0451851_0444680 3300041507 Bacteria 1033
352 Ga0439448_0083916 3300042005 Bacteria 1072
353 Ga0466972_0022762 3300044658 Bacteria 3119
354 Ga0466971_0194570 3300044719 Bacteria 956
355 Ga0466957_0137622 3300044842 Bacteria 1571
356 Ga0466960_0117731 3300044901 Bacteria 1388
357 Ga0495638_0062685 3300046460 Bacteria 2294
358 Ga0495606_0112874 3300046507 Bacteria 1637
359 Ga0495610_0004552 3300046512 Bacteria 10196
360 Ga0495620_0141236 3300046515 Bacteria 942
361 Ga0495632_0073066 3300046519 Bacteria 1645
362 Ga0495668_0115828 3300046616 Bacteria 1466
363 Ga0495625_0254448 3300046660 Bacteria 1139
364 Ga0496106_0008218 3300048909 Bacteria 7715
365 Ga0496106_0243119 3300048909 Bacteria 1438
366 Ga0496109_0198173 3300048912 Bacteria 1888
367 Ga0496116_0003206 3300048919 Bacteria 16345
368 Ga0496116_0093227 3300048919 Bacteria 1824
369 Ga0496116_0117283 3300048919 Bacteria 1549
370 Ga0496117_0010959 3300048920 Bacteria 8171
371 Ga0496117_0059067 3300048920 Bacteria 2652
372 Ga0496118_0024130 3300048921 Bacteria 5259
373 Ga0496118_0090434 3300048921 Bacteria 2109
374 Ga0496118_0139409 3300048921 Bacteria 1541
375 Ga0496119_0000750 3300048922 Bacteria 43609
376 Ga0496119_0042991 3300048922 Bacteria 2860
377 Ga0496121_0003823 3300048924 Bacteria 20961
378 Ga0496121_0009961 3300048924 Bacteria 10816
379 Ga0496121_0150370 3300048924 Bacteria 1714
380 Ga0496121_0407874 3300048924 Bacteria 888
381 Ga0496122_0033522 3300048925 Bacteria 4222
382 Ga0496122_0081372 3300048925 Bacteria 2254
383 Ga0496123_0002938 3300048926 Bacteria 19929
384 Ga0496123_0020166 3300048926 Bacteria 5224
385 Ga0496123_0030754 3300048926 Bacteria 3923
386 Ga0496124_0001914 3300048927 Bacteria 28559
387 Ga0496124_0030119 3300048927 Bacteria 4822
388 Ga0496124_0140144 3300048927 Bacteria 1909
389 Ga0496124_0204706 3300048927 Bacteria 1498
390 Ga0496125_0125650 3300048928 Bacteria 1818
391 Ga0496126_0008697 3300048929 Bacteria 10902
392 Ga0496126_0017755 3300048929 Bacteria 7082
393 Ga0496126_0097560 3300048929 Bacteria 2575
394 Ga0496126_0100364 3300048929 Bacteria 2533
395 Ga0495678_050663 3300049459 Bacteria 1608
396 Ga0501031_0001559 3300049568 Bacteria 14268
397 Ga0501031_0089125 3300049568 Bacteria 2011
398 Ga0501032_0001034 3300049569 Bacteria 22327
399 Ga0501033_0003222 3300049570 Bacteria 13496
400 Ga0501033_0137820 3300049570 Bacteria 1765
401 Ga0501034_0000222 3300049571 Bacteria 108857
402 Ga0501034_0002860 3300049571 Bacteria 20110
403 Ga0501034_0009509 3300049571 Bacteria 10176
404 Ga0501034_0012347 3300049571 Bacteria 8826
405 Ga0501034_0073930 3300049571 Bacteria 3417
406 Ga0501034_0141388 3300049571 Bacteria 2386
407 Ga0501034_0152259 3300049571 Bacteria 2288
408 Ga0501034_0266055 3300049571 Bacteria 1656
409 Ga0501036_0066386 3300049572 Bacteria 3052
410 Ga0501036_0277558 3300049572 Bacteria 1402
411 Ga0501037_0000514 3300049573 Bacteria 31087
412 Ga0501038_0015873 3300049574 Bacteria 6842
413 Ga0501038_0038552 3300049574 Bacteria 4184
414 Ga0501038_0069097 3300049574 Bacteria 3001
415 Ga0501039_0000432 3300049575 Bacteria 30229
416 Ga0501039_0012347 3300049575 Bacteria 6517
417 Ga0501043_0035006 3300049579 Bacteria 3949
418 Ga0501046_0001262 3300049580 Bacteria 24516
419 Ga0501047_0006274 3300049581 Bacteria 11175
420 Ga0501047_0030949 3300049581 Bacteria 5159
421 Ga0501048_0003846 3300049582 Bacteria 11447
422 Ga0501067_0011888 3300049583 Bacteria 4825
423 Ga0501067_0019049 3300049583 Bacteria 3798
424 Ga0501068_0016396 3300049584 Bacteria 4271
425 Ga0501068_0099705 3300049584 Bacteria 1799
426 Ga0501068_0162193 3300049584 Bacteria 1409
427 Ga0501069_0001119 3300049585 Bacteria 12944
428 Ga0501070_0006527 3300049586 Bacteria 9924
429 Ga0501070_0017904 3300049586 Bacteria 5948
430 Ga0501071_0366574 3300049587 Bacteria 1097
431 Ga0501072_0039944 3300049588 Bacteria 3684
432 Ga0501073_0000534 3300049589 Bacteria 26731
433 Ga0501073_0028100 3300049589 Bacteria 4018
434 Ga0501073_0091242 3300049589 Bacteria 2117
435 Ga0501074_0035429 3300049590 Bacteria 3616
436 Ga0501074_0219144 3300049590 Bacteria 1355
437 Ga0501080_0003677 3300049742 Bacteria 13522
438 Ga0501080_0010159 3300049742 Bacteria 8608
439 Ga0501083_0018962 3300049744 Bacteria 4789
440 Ga0501083_0041672 3300049744 Bacteria 3113
441 Ga0501035_0030566 3300049822 Bacteria 4908
442 Ga0501035_0096494 3300049822 Bacteria 2597
443 Ga0501044_0004665 3300049823 Bacteria 15333
444 Ga0501044_0011230 3300049823 Bacteria 9709
445 Ga0501044_0552394 3300049823 Bacteria 1048
446 Ga0501045_0363619 3300049824 Bacteria 1077
447 nmdc:mga0yw44_457015_c1 3300050492 Bacteria 865
448 nmdc:mga0k408_124785_c1 3300050493 Bacteria 1526
449 nmdc:mga06z11_31466_c1 3300050494 Bacteria 2578
450 nmdc:mga06z11_69250_c1 3300050494 Bacteria 1862
451 nmdc:mga07m45_15904_c2 3300050496 Bacteria 3356
452 nmdc:mga05p37_347060_c1 3300050507 Bacteria 1748
453 nmdc:mga05p37_357443_c1 3300050507 Bacteria 1718
454 nmdc:mga05p37_503593_c1 3300050507 Bacteria 1389
455 Ga0500651_0068385 3300053093 Bacteria 2212
456 Ga0500572_002091 3300053111 Bacteria 4954
457 Ga0500642_0001239 3300053130 Bacteria 7296
458 Ga0500658_0001646 3300053134 Bacteria 8888
459 Ga0500568_0000361 3300053139 Bacteria 35246
460 Ga0500568_0035779 3300053139 Bacteria 2024
461 Ga0500604_0008235 3300053151 Bacteria 2763
462 Ga0500604_0043014 3300053151 Bacteria 1371
463 Ga0500616_0000686 3300053153 Bacteria 39652
464 Ga0500620_002500 3300053155 Bacteria 3722
465 Ga0500624_022879 3300053157 Bacteria 1020
466 Ga0501084_0000193 3300054114 Bacteria 47522
467 Ga0501084_0015147 3300054114 Bacteria 6394
468 Ga0501082_0003570 3300060353 Bacteria 13580
469 Ga0466962_0094782 3300061719 Bacteria 1431
470 2503200613 2503198000 Bacteria 6884444
471 2509079424 2508501114 Bacteria 7082538
472 2509118057 2508501123 Bacteria 6283661
473 2509139777 2508501127 Bacteria 7037543
474 2509389503 2509276021 Bacteria 7634384
475 2509398449 2509276022 Bacteria 6200534
476 2509446085 2509276033 Bacteria 7180565
477 2510131579 2510065019 Bacteria 6903379
478 2510892217 2510461076 Bacteria 8618824
479 2512932049 2512875016 Bacteria 6529530
480 2513567371 2513237084 Bacteria 7231967
481 2513579480 2513237085 Bacteria 7695351
482 2513597063 2513237088 Bacteria 6927906
483 2513611487 2513237090 Bacteria 7096802
484 2513632155 2513237093 Bacteria 7545552
485 2513712370 2513237103 Bacteria 7647401
486 2513868674 2513237138 Bacteria 7368160
487 2513909272 2513237144 Bacteria 7530820
488 2513924751 2513237146 Bacteria 7166346
489 2514023306 2513237162 Bacteria 7468464
490 2514039254 2513237164 Bacteria 7563725
491 2514423374 2513237305 Bacteria 7293571
492 2515113692 2515075009 Bacteria 7288508
493 2515632142 2515154113 Bacteria 7807172
494 2515644556 2515154114 Bacteria 7848616
495 2515660003 2515154116 Bacteria 7552979
496 2515738488 2515154134 Bacteria 7220242
497 2517037308 2516653077 Bacteria 7555578
498 2517080526 2516653085 Bacteria 7346596
499 2517097873 2517093000 Bacteria 7412387
500 2517409989 2517287029 Bacteria 6905599
501 2535517502 2534681796 Bacteria 7146037
502 2585277758 2582581308 Bacteria 7413247
503 2585526849 2585427526 Bacteria 7258840
504 2585533375 2585427527 Bacteria 7273426
505 2585542391 2585427528 Bacteria 6842387
506 2585557880 2585427530 Bacteria 7383882
507 2585841863 2585427593 Bacteria 7141551
508 2585996988 2585427633 Bacteria 6413184
509 2586001577 2585427634 Bacteria 6455027
510 2588517950 2588253730 Bacteria 6881675
511 2597815921 2597489875 Bacteria 7010078
512 2599416311 2599185170 Bacteria 7295545
513 2599936922 2599185301 Bacteria 6161860
514 2616295130 2615840624 Bacteria 6557588
515 2616310565 2615840626 Bacteria 7921970
516 2643911101 2643221580 Bacteria 3816678
517 2643912164 2643221580 Bacteria 3816678
518 2643966869 2643221591 Bacteria 4397626
519 2643986503 2643221595 Bacteria 6565519
520 2644152734 2643221627 Bacteria 6761570
521 2644164349 2643221629 Bacteria 5850260
522 2644195080 2643221634 Bacteria 6705461
523 2644239084 2643221643 Bacteria 5749658
524 2644346380 2643221662 Bacteria 5851492
525 2644413195 2643221674 Bacteria 3919126
526 2694629063 2693429783 Bacteria 7019804
527 2694637022 2693429784 Bacteria 7241525
528 2719183614 2718217882 Bacteria 6556348
529 2719667965 2718217997 Bacteria 6740740
530 2719728055 2718218009 Bacteria 6478651
531 2720494728 2718218199 Bacteria 6740745
532 2721144916 2718218363 Bacteria 6524337
533 2721155655 2718218365 Bacteria 6274507
534 2721167003 2718218366 Bacteria 6425255
535 2722837981 2721755514 Bacteria 6424414
536 2723575031 2721755686 Bacteria 7343952
537 2724042249 2721755810 Bacteria 6479005
538 2725949359 2724679232 Bacteria 7646494
539 2730161754 2728369365 Bacteria 6555560
540 2730300762 2728369397 Bacteria 6274511
541 2738802859 2738541293 Bacteria 7065685
542 2739038475 2738541333 Bacteria 7106503
543 2756676848 2756170246 Bacteria 7451806
544 2766066962 2765235942 Bacteria 7445910
545 2776265017 2775506901 Bacteria 9631051
546 2792749628 2791355123 Bacteria 8049106
547 2793313485 2791355259 Bacteria 7254731
548 2793321614 2791355260 Bacteria 6598818
549 2793346093 2791355264 Bacteria 6429314
550 2793353955 2791355265 Bacteria 6539969
551 2793365810 2791355267 Bacteria 7222458
552 2805927182 2802429605 Bacteria 6875453
553 2805934393 2802429606 Bacteria 6346811
554 2806048819 2802429633 Bacteria 7341974
555 2806056021 2802429634 Bacteria 7083200
556 2806062832 2802429635 Bacteria 7650140
557 2806070272 2802429636 Bacteria 7597525
558 2806077258 2802429637 Bacteria 7067217
559 2816510364 2816332139 Bacteria 9138787
560 2819643132 2818991453 Bacteria 7181617
561 2838036429 2838035591 Bacteria 7166484
562 2838668637 2838661181 Bacteria 7385261
563 2838669513 2838668709 Bacteria 6671819
564 2838690463 2838686498 Bacteria 7807632
565 2838701885 2838701080 Bacteria 6669771
566 2838733180 2838729681 Bacteria 7400765
567 2838747231 2838742623 Bacteria 7396178
568 2841734938 2841734538 Bacteria 6784580
569 2841855384 2841851746 Bacteria 7532261
570 2841867853 2841864319 Bacteria 6742987
571 2842111551 2842110456 Bacteria 7656360
572 2842160909 2842156927 Bacteria 6894975
573 2842164438 2842163707 Bacteria 6916235
574 2842184525 2842180545 Bacteria 6888678
575 2842196158 2842192696 Bacteria 6147454
576 2842207324 2842205361 Bacteria 6340321
577 2842218521 2842217011 Bacteria 7497767
578 2842232108 2842229732 Bacteria 7475766
579 2842248490 2842243621 Bacteria 7421798
580 2842251692 2842250916 Bacteria 6579627
581 2842262702 2842257432 Bacteria 7401195
582 2842267927 2842264693 Bacteria 6472963
583 2842275223 2842271015 Bacteria 7807131
584 2842280965 2842278818 Bacteria 6340002
585 2842288419 2842285085 Bacteria 6011953
586 2842307341 2842304105 Bacteria 7023636
587 2842311869 2842311132 Bacteria 6616990
588 2842323323 2842317721 Bacteria 6793725
589 2842346676 2842341865 Bacteria 7003929
590 2842406235 2842402390 Bacteria 6681310
591 2842412820 2842409023 Bacteria 6687331
592 2842419301 2842415677 Bacteria 6596907
593 2842432090 2842428310 Bacteria 6767288
594 2842438202 2842434925 Bacteria 6502746
595 2842443898 2842441272 Bacteria 6769273
596 2842449840 2842447887 Bacteria 6754142
597 2842466188 2842462802 Bacteria 6588055
598 2842472828 2842469257 Bacteria 6752936
599 2842489668 2842489311 Bacteria 6620893
600 2842500499 2842495871 Bacteria 6820686
601 2844006594 2844002411 Bacteria 7168230
602 2844460119 2844454524 Bacteria 7952546
603 2854917320 2854916844 Bacteria 5725939
604 2856326191 2856320880 Bacteria 7263508
605 2856344125 2856342000 Bacteria 7176905
606 2856353204 2856349417 Bacteria 6230045
607 2856356695 2856356410 Bacteria 6297484
608 2856367107 2856364286 Bacteria 6939991
609 2857354562 2857349434 Bacteria 7926032
610 2857518359 2857516855 Bacteria 7787325
611 2869164682 2869162929 Bacteria 6399702
612 2869284188 2869278585 Bacteria 7077053
613 2869287357 2869285874 Bacteria 6901219
614 2871430448 2871429161 Bacteria 6547891
615 2871467041 2871466892 Bacteria 6923287
616 2871476685 2871474448 Bacteria 6806570
617 2871492394 2871488783 Bacteria 6929816
618 2871501927 2871495908 Bacteria 6935695
619 2874124542 2874123672 Bacteria 7238285
620 2874144813 2874139085 Bacteria 7021506
621 2874148936 2874146452 Bacteria 7533118
622 2874155940 2874155637 Bacteria 6724144
623 2874169120 2874168670 Bacteria 8062617
624 2876365749 2876363079 Bacteria 6544991
625 2876372923 2876369609 Bacteria 6807521
626 2876381763 2876377896 Bacteria 6565995
627 2876397883 2876392853 Bacteria 6660880
628 2876415507 2876413966 Bacteria 6831344
629 2878743818 2878738818 Bacteria 7136951
630 2878746881 2878745973 Bacteria 6867388
631 2878758275 2878753008 Bacteria 6922523
632 2878765836 2878760144 Bacteria 6823465
633 2878772510 2878767105 Bacteria 6898628
634 2878790834 2878788777 Bacteria 6567085
635 2881150092 2881147464 Bacteria 7779814
636 2881158089 2881155292 Bacteria 6461656
637 2881166644 2881161766 Bacteria 7127907
638 2881847663 2881845957 Bacteria 6611900
639 2881864427 2881861095 Bacteria 7128710
640 2882639034 2882632389 Bacteria 8154593
641 2882914840 2882912400 Bacteria 6801539
642 2885308938 2885305155 Bacteria 7348390
643 2885318677 2885312484 Bacteria 6415165
644 2885320952 2885318864 Bacteria 6729568
645 2885326835 2885326080 Bacteria 7134805
646 2885337595 2885334103 Bacteria 7216818
647 2885347300 2885342637 Bacteria 7011821
648 2885353406 2885350715 Bacteria 6787678
649 2888342221 2888337043 Bacteria 6629336
650 2888348965 2888343758 Bacteria 6611049
651 2888351297 2888350351 Bacteria 7372807
652 2889013683 2889010040 Bacteria 6749192
653 2889021600 2889016732 Bacteria 6700763
654 2903450736 2903448605 Bacteria 7357801
655 2903496875 2903492973 Bacteria 13473544
656 2903503323 2903492973 Bacteria 13473544
657 2903521561 2903521522 Bacteria 6525694
658 2903529892 2903528002 Bacteria 6586099
659 2903546782 2903540706 Bacteria 7062119
660 2904664534 2904659560 Bacteria 6685615
661 2906309899 2906308376 Bacteria 6841989
662 2906322329 2906321335 Bacteria 6579571
663 2906357308 2906354277 Bacteria 6991324
664 2906379080 2906378014 Bacteria 6911440
665 2919102404 2919100787 Bacteria 7710546
666 2922133428 2922130491 Bacteria 7173936
667 2922190769 2922185730 Bacteria 7113964
668 2923561203 2923556063 Bacteria 6793593
669 2924726097 2924718760 Bacteria 6331356
670 2924761494 2924754689 Bacteria 6774424
671 2924769021 2924762789 Bacteria 6561353
672 2924781735 2924776078 Bacteria 7492003
673 2924784371 2924784321 Bacteria 7416538
674 2933574003 2933570622 Bacteria 7023390
675 2933588105 2933586486 Bacteria 7667493
676 2935906101 2935901341 Bacteria 7341747
677 2936369476 2936367885 Bacteria 7324495
678 2936380168 2936375103 Bacteria 6652732
679 2937815096 2937813078 Bacteria 7783518
680 2937824250 2937822353 Bacteria 7290551
681 2937838545 2937836603 Bacteria 6811263
682 2937848690 2937848649 Bacteria 6983481
683 2937878919 2937877337 Bacteria 7246526
684 2937978210 2937972304 Bacteria 7532020
685 2938000641 2937994558 Bacteria 7036190
686 2938017458 2938014810 Bacteria 6700592
687 2958040577 2958034702 Bacteria 6989922
688 2958042783 2958041894 Bacteria 13082850
689 2958055425 2958041894 Bacteria 13082850
690 2958065063 2958064165 Bacteria 7158582
691 2958074627 2958071322 Bacteria 6815895
692 2958087379 2958084443 Bacteria 7312792
693 2958098931 2958092219 Bacteria 6861151
694 2958105591 2958100919 Bacteria 6800575
695 2958131642 2958130278 Bacteria 6897202
696 2958144794 2958144490 Bacteria 6677056
697 2958171012 2958165035 Bacteria 6906348
698 2958177358 2958172287 Bacteria 6716688
699 2958180714 2958179912 Bacteria 6874908
700 2961078551 2961077736 Bacteria 7079850
701 2961119533 2961114664 Bacteria 6680456
702 2961132729 2961127735 Bacteria 7196641
703 2961169456 2961163497 Bacteria 6901077
704 2961173533 2961170736 Bacteria 7072258
705 2963647156 2963644680 Bacteria 6530403
706 2965023708 2965018300 Bacteria 6883036
707 2965125188 2965119406 Bacteria 6956431
708 2968005872 2968003550 Bacteria 6929263
709 2968021796 2968016561 Bacteria 7022047
710 2968088009 2968083720 Bacteria 7351627
711 2968115788 2968110612 Bacteria 6814636
712 2968118866 2968117919 Bacteria 6536078
713 2968177846 2968171901 Bacteria 6894245
714 2970474386 2970469710 Bacteria 6969209
715 2970506125 2970503327 Bacteria 7099517
716 2970530287 2970524798 Bacteria 6840927
717 2970545837 2970540015 Bacteria 6977556
718 2970560692 2970554993 Bacteria 6814252
719 2970598800 2970593180 Bacteria 7073582
720 2977826807 2977821940 Bacteria 6906439
721 2977835892 2977828996 Bacteria 7007971
722 2977845759 2977843712 Bacteria 6753583
723 2977871502 2977864932 Bacteria 7534097
724 2977928272 2977922695 Bacteria 6956781
725 2977946342 2977942078 Bacteria 7570577
726 2977971895 2977971508 Bacteria 7472917
727 2977990258 2977986579 Bacteria 6581278
728 2979716242 2979710463 Bacteria 6785254
729 2979746924 2979742915 Bacteria 7301278
730 2979810847 2979808191 Bacteria 7179355
731 2987643164 2987636660 Bacteria 8088555
732 2987658678 2987652177 Bacteria 6969023
733 2987665566 2987659509 Bacteria 6966464
734 2987672875 2987666974 Bacteria 6509233
735 2996353798 2996348954 Bacteria 7239054
736 3000136611 3000135777 Bacteria 6891109
737 3004194644 3004188549 Bacteria 6952365
738 3004206712 3004203850 Bacteria 7307914
739 3004215724 3004211236 Bacteria 7417683
740 3004224501 3004218560 Bacteria 7421728
741 3004280466 3004275668 Bacteria 7114440
742 3005414139 3005409236 Bacteria 7188837
743 3005451175 3005445848 Bacteria 6906074
744 637075145 637000159 Bacteria 7596297
745 639649731 639633055 Bacteria 7751309
746 8004379789 8004374579 Bacteria 6898112
747 8004389338 8004387939 Bacteria 7049250
748 8004398267 8004395343 Bacteria 6620908
749 8004634596 8004633249 Bacteria 6723080
750 8004645013 8004640170 Bacteria 6723001
751 8004716045 8004714634 Bacteria 6776161
752 8005294992 8005289223 Bacteria 6634003
753 8005305133 8005301065 Bacteria 6614431
754 8005308309 8005307578 Bacteria 7395396
755 8005377984 8005376324 Bacteria 6590079
756 8005464380 8005460587 Bacteria 7157962
757 8005502986 8005497431 Bacteria 6477605
758 8005546328 8005542996 Bacteria 7077758
759 8005561787 8005556819 Bacteria 6908598
760 8005568566 8005563573 Bacteria 7153261
761 8005571141 8005570704 Bacteria 6957481
762 8005674904 8005668836 Bacteria 6953162
763 8005689154 8005688590 Bacteria 6610080
764 8018127676 8018127388 Bacteria 7351159
765 8018163192 8018163183 Bacteria 7277977
766 8023681440 8023680758 Bacteria 7729763
767 8024479743 8024479707 Bacteria 6954785
768 8024507210 8024501048 Bacteria 6427847
769 8046770617 8046767195 Bacteria 7547379
770 8047712317 8047710418 Bacteria 11023148
771 8055619066 8055617313 Bacteria 7548464
772 8056380319 8056375014 Bacteria 7006639
773 8056383891 8056382006 Bacteria 6408074
774 8057578812 8057575449 Bacteria 7367519
775 8057878874 8057874678 Bacteria 7494653
776 Ga0265318_10002087
777 JGI24741J21665_1010079
778 JGI24739J22299_10018230
779 JGI25156J39149_1002223
780 JGI25158J39367_1000205
781 JGI25157J39369_1000599
782 JGI25152J39213_1004650
783 JGI25152J39213_1006150
784 JGI25152J39213_1009450
785 JGI25150J39212_1007385
786 JGI25159J45721_1001121
787 JGI25151J46595_10000867
788 JGI25151J46595_10004550
789 JGI25151J46595_10018558
790 rootL2_10015096
791 rootH1_10100374
792 JGI25161J50226_1000050
793 JGI25161J50226_1003954
794 Ga0055526_1000595
795 Ga0055526_1024018
796 Ga0055524_1000922
797 Ga0055524_1002690
798 Ga0055524_1018262
799 Ga0055536_1052975
800 Ga0055528_1000096
801 Ga0055528_1000716
802 Ga0055528_1014786
803 Ga0055528_1018681
804 Ga0055528_1030026
805 Ga0055540_1000399
806 Ga0055540_1031822
807 Ga0055540_1049953
808 Ga0055543_1000489
809 Ga0065165_1005024
810 Ga0065165_1007074
811 Ga0065165_1016267
812 Ga0065707_10120174
813 Ga0070658_10019519
814 Ga0070683_100108132
815 Ga0070683_100605748
816 Ga0070682_100068256
817 Ga0068868_100138538
818 Ga0070660_100030363
819 Ga0070660_100133813
820 Ga0070660_100145156
821 Ga0070660_100180793
822 Ga0070687_100332424
823 Ga0070661_100005094
824 Ga0070661_100018671
825 Ga0070661_100042747
826 Ga0070661_100074458
827 Ga0070661_100079929
828 Ga0070668_100011517
829 Ga0070668_100176104
830 Ga0070669_100016868
831 Ga0070669_100086993
832 Ga0070669_100217606
833 Ga0070674_100016108
834 Ga0070674_100049340
835 Ga0070674_100433145
836 Ga0070673_100217950
837 Ga0070659_100017270
838 Ga0070659_100161964
839 Ga0070659_100378991
840 Ga0070710_10000809
841 Ga0070708_100222091
842 Ga0070663_100008664
843 Ga0070663_100028440
844 Ga0070662_100030424
845 Ga0068867_100338039
846 Ga0070707_100140234
847 Ga0070699_100422994
848 Ga0070679_100131508
849 Ga0070684_100328127
850 Ga0070684_100625806
851 Ga0070684_100914887
852 Ga0068853_100001347
853 Ga0068853_100012183
854 Ga0068853_100022202
855 Ga0070686_100035123
856 Ga0070665_100008163
857 Ga0070665_100058286
858 Ga0070665_100336422
859 Ga0068855_100040893
860 Ga0068855_100353259
861 Ga0068857_100021902
862 Ga0068857_100074871
863 Ga0068857_100166175
864 Ga0068854_100001486
865 Ga0068854_100041169
866 Ga0068854_100044855
867 Ga0068856_100012342
868 Ga0068856_100154879
869 Ga0068856_100281122
870 Ga0068856_100322254
871 Ga0068856_100454630
872 Ga0068852_100017669
873 Ga0068852_100034234
874 Ga0068852_100050523
875 Ga0068852_100119104
876 Ga0068852_100375473
877 Ga0068852_100885067
878 Ga0068851_10005070
879 Ga0068862_100003242
880 Ga0068862_100047167
881 Ga0068862_100547084
882 Ga0081540_1019814
883 Ga0081539_10000316
884 Ga0070717_10104762
885 Ga0075365_10020389
886 Ga0075365_10023833
887 Ga0075365_10036309
888 Ga0075365_10186122
889 Ga0075365_10228251
890 Ga0075368_10035242
891 Ga0075363_100072523
892 Ga0075363_100213452
893 Ga0075364_10222336
894 Ga0075364_10443482
895 Ga0075362_10003549
896 Ga0075362_10128528
897 Ga0075367_10012197
898 Ga0075367_10016873
899 Ga0075367_10189720
900 Ga0075367_10310440
901 Ga0075369_10030199
902 Ga0075369_10044691
903 Ga0075369_10105746
904 Ga0075366_10001329
905 Ga0075366_10200289
906 Ga0075370_10034041
907 Ga0075370_10076482
908 Ga0075370_10121047
909 Ga0075370_10332111
910 Ga0068871_100533514
911 Ga0075431_100615695
912 Ga0075429_100564614
913 Ga0068865_100108227
914 Ga0105244_10089445
915 Ga0105240_10000336
916 Ga0105240_10057132
917 Ga0111539_10698752
918 Ga0105245_10391104
919 Ga0114129_10080578
920 Ga0114129_10316295
921 Ga0114129_10384072
922 Ga0105241_10087477
923 Ga0105241_10105300
924 Ga0105241_10183428
925 Ga0105241_10350362
926 Ga0105237_10000690
927 Ga0105237_10167494
928 Ga0105237_10330040
929 Ga0105238_10013090
930 Ga0105238_10014048
931 Ga0105238_10034505
932 Ga0123341_1004539
933 Ga0123342_1017768
934 Ga0105032_103260
935 Ga0105239_10013586
936 Ga0105239_10183511
937 Ga0105239_10194870
938 Ga0105239_10281176
939 Ga0105239_10531845
940 Ga0157322_1004080
941 Ga0157371_10028500
942 Ga0157370_10026622
943 Ga0157370_10658944
944 Ga0157369_10113277
945 Ga0157374_10119111
946 Ga0157378_10082289
947 Ga0157378_10417244
948 Ga0157372_10128256
949 Ga0157372_10152488
950 Ga0157375_10149482
951 Ga0182008_10225101
952 Ga0157379_10729142
953 Ga0213876_10002694
954 Ga0209436_100031
955 Ga0209436_114778
956 Ga0207425_1002640
957 Ga0207425_1006193
958 Ga0207425_1017953
959 Ga0209026_1000029
960 Ga0209677_103335
961 Ga0209759_1000040
962 Ga0209129_1000016
963 Ga0209129_1000669
964 Ga0209129_1001340
965 Ga0209129_1002531
966 Ga0209233_1000097
967 Ga0209673_1000063
968 Ga0209673_1000252
969 Ga0209673_1000291
970 Ga0209673_1001400
971 Ga0209673_1002105
972 Ga0209673_1002242
973 Ga0209130_1000031
974 Ga0209130_1000048
975 Ga0209130_1005302
976 Ga0209025_1000338
977 Ga0209025_1000430
978 Ga0209025_1005207
979 Ga0209564_1000586
980 Ga0209564_1000664
981 Ga0209564_1000876
982 Ga0209564_1006096
983 Ga0209564_1013624
984 Ga0209758_1000490
985 Ga0209758_1001257
986 Ga0209758_1001647
987 Ga0209758_1002831
988 Ga0209758_1004719
989 Ga0209758_1013935
990 Ga0209758_1034009
991 Ga0209050_1003257
992 Ga0209256_1000463
993 Ga0209256_1001515
994 Ga0209256_1002067
995 Ga0209256_1004108
996 Ga0207426_1000042
997 Ga0207426_1000075
998 Ga0207426_1000136
999 Ga0209051_1000671
1000 Ga0209051_1016239
1001 Ga0209051_1025534
1002 Ga0209257_1000504
1003 Ga0209257_1065337
1004 Ga0207656_10003814
1005 Ga0207692_10001415
1006 Ga0207680_10179295
1007 Ga0207647_10008504
1008 Ga0207647_10107942
1009 Ga0207645_10014079
1010 Ga0207643_10338636
1011 Ga0207705_10184788
1012 Ga0207705_10247464
1013 Ga0207654_10035337
1014 Ga0207654_10118616
1015 Ga0207695_10000458
1016 Ga0207695_10265603
1017 Ga0207671_10000577
1018 Ga0207671_10016228
1019 Ga0207671_10373874
1020 Ga0207657_10009115
1021 Ga0207657_10011473
1022 Ga0207657_10012411
1023 Ga0207657_10020971
1024 Ga0207649_10008971
1025 Ga0207649_10011064
1026 Ga0207649_10308811
1027 Ga0207681_10092411
1028 Ga0207694_10014161
1029 Ga0207694_10033622
1030 Ga0207694_10256710
1031 Ga0207650_10318883
1032 Ga0207687_10269151
1033 Ga0207687_10364131
1034 Ga0207664_10028791
1035 Ga0207664_10398737
1036 Ga0207690_10331894
1037 Ga0207706_10511363
1038 Ga0207669_10004321
1039 Ga0207669_10025236
1040 Ga0207669_10048578
1041 Ga0207704_10232228
1042 Ga0207691_10048476
1043 Ga0207691_10466494
1044 Ga0207679_10428795
1045 Ga0207667_10004954
1046 Ga0207667_10102920
1047 Ga0207667_10201250
1048 Ga0207651_10194905
1049 Ga0207668_10009534
1050 Ga0207668_10719554
1051 Ga0207640_10011282
1052 Ga0207640_10011939
1053 Ga0207677_10065799
1054 Ga0207639_10042470
1055 Ga0207639_10293587
1056 Ga0207639_10895807
1057 Ga0207678_10012764
1058 Ga0207678_10018975
1059 Ga0207702_10132709
1060 Ga0207702_10150220
1061 Ga0207702_10373360
1062 Ga0207702_10417985
1063 Ga0207702_10571203
1064 Ga0207648_10096669
1065 Ga0207674_10004581
1066 Ga0207674_10095351
1067 Ga0207674_10159834
1068 Ga0207674_10176501
1069 Ga0207683_10046943
1070 Ga0207698_10055985
1071 Ga0207698_10073770
1072 Ga0207698_10082567
1073 Ga0207698_10247042
1074 Ga0207698_10381936
1075 Ga0268266_10003641
1076 Ga0268266_10083243
1077 Ga0268266_10236163
1078 Ga0268265_10005163
1079 Ga0268265_10028795
1080 Ga0307517_10225947
1081 Ga0307515_10299599
1082 Ga0307512_10009090
1083 Ga0316177_1021166
1084 Ga0316176_1184345
1085 Ga0316180_1172947
1086 Ga0265332_10039082
1087 Ga0307513_10007748
1088 Ga0307513_10204001
1089 Ga0307513_10275582
1090 Ga0307408_100079573
1091 Ga0265314_10034609
1092 Ga0265342_10252510
1093 Ga0316576_10378557
1094 Ga0307516_10117405
1095 Ga0307413_10320543
1096 Ga0307407_10283933
1097 Ga0307412_10096675
1098 Ga0307414_10083504
1099 Ga0307414_10254581
1100 Ga0307414_10275573
1101 Ga0307411_10243830
1102 Ga0373939_0104884
1103 Ga0373942_0047873
1104 Ga0316574_0124785
1105 Ga0373931_0013840
1106 Ga0373947_0300628
1107 Ga0316584_0390262
1108 Ga0395899_0036782
1109 Ga0395905_0000791
1110 Ga0395905_0005397
1111 Ga0395905_0046646
1112 Ga0395905_0229782
1113 Ga0436364_0393289
1114 Ga0436364_0469241
1115 Ga0436364_0579643
1116 Ga0395901_0092105
1117 Ga0436365_0257230
1118 Ga0436360_0835435
1119 Ga0436363_1085806
1120 Ga0439465_0014043
1121 Ga0439465_0109519
1122 Ga0451839_1234649
1123 Ga0451845_0296105
1124 Ga0451847_0268177
1125 Ga0451849_1289643
1126 Ga0451851_0444680
1127 Ga0439448_0083916
1128 Ga0466972_0022762
1129 Ga0466971_0194570
1130 Ga0466957_0137622
1131 Ga0466960_0117731
1132 Ga0495638_0062685
1133 Ga0495606_0112874
1134 Ga0495610_0004552
1135 Ga0495620_0141236
1136 Ga0495632_0073066
1137 Ga0495668_0115828
1138 Ga0495625_0254448
1139 Ga0496106_0008218
1140 Ga0496106_0243119
1141 Ga0496109_0198173
1142 Ga0496116_0003206
1143 Ga0496116_0093227
1144 Ga0496116_0117283
1145 Ga0496117_0010959
1146 Ga0496117_0059067
1147 Ga0496118_0024130
1148 Ga0496118_0090434
1149 Ga0496118_0139409
1150 Ga0496119_0000750
1151 Ga0496119_0042991
1152 Ga0496121_0003823
1153 Ga0496121_0009961
1154 Ga0496121_0150370
1155 Ga0496121_0407874
1156 Ga0496122_0033522
1157 Ga0496122_0081372
1158 Ga0496123_0002938
1159 Ga0496123_0020166
1160 Ga0496123_0030754
1161 Ga0496124_0001914
1162 Ga0496124_0030119
1163 Ga0496124_0140144
1164 Ga0496124_0204706
1165 Ga0496125_0125650
1166 Ga0496126_0008697
1167 Ga0496126_0017755
1168 Ga0496126_0097560
1169 Ga0496126_0100364
1170 Ga0495678_050663
1171 Ga0501031_0001559
1172 Ga0501031_0089125
1173 Ga0501032_0001034
1174 Ga0501033_0003222
1175 Ga0501033_0137820
1176 Ga0501034_0000222
1177 Ga0501034_0002860
1178 Ga0501034_0009509
1179 Ga0501034_0012347
1180 Ga0501034_0073930
1181 Ga0501034_0141388
1182 Ga0501034_0152259
1183 Ga0501034_0266055
1184 Ga0501036_0066386
1185 Ga0501036_0277558
1186 Ga0501037_0000514
1187 Ga0501038_0015873
1188 Ga0501038_0038552
1189 Ga0501038_0069097
1190 Ga0501039_0000432
1191 Ga0501039_0012347
1192 Ga0501043_0035006
1193 Ga0501046_0001262
1194 Ga0501047_0006274
1195 Ga0501047_0030949
1196 Ga0501048_0003846
1197 Ga0501067_0011888
1198 Ga0501067_0019049
1199 Ga0501068_0016396
1200 Ga0501068_0099705
1201 Ga0501068_0162193
1202 Ga0501069_0001119
1203 Ga0501070_0006527
1204 Ga0501070_0017904
1205 Ga0501071_0366574
1206 Ga0501072_0039944
1207 Ga0501073_0000534
1208 Ga0501073_0028100
1209 Ga0501073_0091242
1210 Ga0501074_0035429
1211 Ga0501074_0219144
1212 Ga0501080_0003677
1213 Ga0501080_0010159
1214 Ga0501083_0018962
1215 Ga0501083_0041672
1216 Ga0501035_0030566
1217 Ga0501035_0096494
1218 Ga0501044_0004665
1219 Ga0501044_0011230
1220 Ga0501044_0552394
1221 Ga0501045_0363619
1222 nmdc:mga0yw44_457015_c1
1223 nmdc:mga0k408_124785_c1
1224 nmdc:mga06z11_31466_c1
1225 nmdc:mga06z11_69250_c1
1226 nmdc:mga07m45_15904_c2
1227 nmdc:mga05p37_347060_c1
1228 nmdc:mga05p37_357443_c1
1229 nmdc:mga05p37_503593_c1
1230 Ga0500651_0068385
1231 Ga0500572_002091
1232 Ga0500642_0001239
1233 Ga0500658_0001646
1234 Ga0500568_0000361
1235 Ga0500568_0035779
1236 Ga0500604_0008235
1237 Ga0500604_0043014
1238 Ga0500616_0000686
1239 Ga0500620_002500
1240 Ga0500624_022879
1241 Ga0501084_0000193
1242 Ga0501084_0015147
1243 Ga0501082_0003570
1244 Ga0466962_0094782
1245 2503200613
1246 2509079424
1247 2509118057
1248 2509139777
1249 2509389503
1250 2509398449
1251 2509446085
1252 2510131579
1253 2510892217
1254 2512932049
1255 2513567371
1256 2513579480
1257 2513597063
1258 2513611487
1259 2513632155
1260 2513712370
1261 2513868674
1262 2513909272
1263 2513924751
1264 2514023306
1265 2514039254
1266 2514423374
1267 2515113692
1268 2515632142
1269 2515644556
1270 2515660003
1271 2515738488
1272 2517037308
1273 2517080526
1274 2517097873
1275 2517409989
1276 2535517502
1277 2585277758
1278 2585526849
1279 2585533375
1280 2585542391
1281 2585557880
1282 2585841863
1283 2585996988
1284 2586001577
1285 2588517950
1286 2597815921
1287 2599416311
1288 2599936922
1289 2616295130
1290 2616310565
1291 2643911101
1292 2643912164
1293 2643966869
1294 2643986503
1295 2644152734
1296 2644164349
1297 2644195080
1298 2644239084
1299 2644346380
1300 2644413195
1301 2694629063
1302 2694637022
1303 2719183614
1304 2719667965
1305 2719728055
1306 2720494728
1307 2721144916
1308 2721155655
1309 2721167003
1310 2722837981
1311 2723575031
1312 2724042249
1313 2725949359
1314 2730161754
1315 2730300762
1316 2738802859
1317 2739038475
1318 2756676848
1319 2766066962
1320 2776265017
1321 2792749628
1322 2793313485
1323 2793321614
1324 2793346093
1325 2793353955
1326 2793365810
1327 2805927182
1328 2805934393
1329 2806048819
1330 2806056021
1331 2806062832
1332 2806070272
1333 2806077258
1334 2816510364
1335 2819643132
1336 2838036429
1337 2838668637
1338 2838669513
1339 2838690463
1340 2838701885
1341 2838733180
1342 2838747231
1343 2841734938
1344 2841855384
1345 2841867853
1346 2842111551
1347 2842160909
1348 2842164438
1349 2842184525
1350 2842196158
1351 2842207324
1352 2842218521
1353 2842232108
1354 2842248490
1355 2842251692
1356 2842262702
1357 2842267927
1358 2842275223
1359 2842280965
1360 2842288419
1361 2842307341
1362 2842311869
1363 2842323323
1364 2842346676
1365 2842406235
1366 2842412820
1367 2842419301
1368 2842432090
1369 2842438202
1370 2842443898
1371 2842449840
1372 2842466188
1373 2842472828
1374 2842489668
1375 2842500499
1376 2844006594
1377 2844460119
1378 2854917320
1379 2856326191
1380 2856344125
1381 2856353204
1382 2856356695
1383 2856367107
1384 2857354562
1385 2857518359
1386 2869164682
1387 2869284188
1388 2869287357
1389 2871430448
1390 2871467041
1391 2871476685
1392 2871492394
1393 2871501927
1394 2874124542
1395 2874144813
1396 2874148936
1397 2874155940
1398 2874169120
1399 2876365749
1400 2876372923
1401 2876381763
1402 2876397883
1403 2876415507
1404 2878743818
1405 2878746881
1406 2878758275
1407 2878765836
1408 2878772510
1409 2878790834
1410 2881150092
1411 2881158089
1412 2881166644
1413 2881847663
1414 2881864427
1415 2882639034
1416 2882914840
1417 2885308938
1418 2885318677
1419 2885320952
1420 2885326835
1421 2885337595
1422 2885347300
1423 2885353406
1424 2888342221
1425 2888348965
1426 2888351297
1427 2889013683
1428 2889021600
1429 2903450736
1430 2903496875
1431 2903503323
1432 2903521561
1433 2903529892
1434 2903546782
1435 2904664534
1436 2906309899
1437 2906322329
1438 2906357308
1439 2906379080
1440 2919102404
1441 2922133428
1442 2922190769
1443 2923561203
1444 2924726097
1445 2924761494
1446 2924769021
1447 2924781735
1448 2924784371
1449 2933574003
1450 2933588105
1451 2935906101
1452 2936369476
1453 2936380168
1454 2937815096
1455 2937824250
1456 2937838545
1457 2937848690
1458 2937878919
1459 2937978210
1460 2938000641
1461 2938017458
1462 2958040577
1463 2958042783
1464 2958055425
1465 2958065063
1466 2958074627
1467 2958087379
1468 2958098931
1469 2958105591
1470 2958131642
1471 2958144794
1472 2958171012
1473 2958177358
1474 2958180714
1475 2961078551
1476 2961119533
1477 2961132729
1478 2961169456
1479 2961173533
1480 2963647156
1481 2965023708
1482 2965125188
1483 2968005872
1484 2968021796
1485 2968088009
1486 2968115788
1487 2968118866
1488 2968177846
1489 2970474386
1490 2970506125
1491 2970530287
1492 2970545837
1493 2970560692
1494 2970598800
1495 2977826807
1496 2977835892
1497 2977845759
1498 2977871502
1499 2977928272
1500 2977946342
1501 2977971895
1502 2977990258
1503 2979716242
1504 2979746924
1505 2979810847
1506 2987643164
1507 2987658678
1508 2987665566
1509 2987672875
1510 2996353798
1511 3000136611
1512 3004194644
1513 3004206712
1514 3004215724
1515 3004224501
1516 3004280466
1517 3005414139
1518 3005451175
1519 637075145
1520 639649731
1521 8004379789
1522 8004389338
1523 8004398267
1524 8004634596
1525 8004645013
1526 8004716045
1527 8005294992
1528 8005305133
1529 8005308309
1530 8005377984
1531 8005464380
1532 8005502986
1533 8005546328
1534 8005561787
1535 8005568566
1536 8005571141
1537 8005674904
1538 8005689154
1539 8018127676
1540 8018163192
1541 8023681440
1542 8024479743
1543 8024507210
1544 8046770617
1545 8047712317
1546 8055619066
1547 8056380319
1548 8056383891
1549 8057578812
1550 8057878874

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03737

RraA-like

Aldolase/RraA

20

189

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x15-assembly1.cif.gz_C-2 crystal structure of streptomyces coelicolor rraas2, an unusual member of the rnase es inhibitor rraa protein family 0.9763 8 214
5x15-assembly1.cif.gz_A-2 crystal structure of streptomyces coelicolor rraas2, an unusual member of the rnase es inhibitor rraa protein family 0.9677 9 215
5x15-assembly1.cif.gz_A-2 crystal structure of streptomyces coelicolor rraas2, an unusual member of the rnase es inhibitor rraa protein family 0.9581 9 215
5x15-assembly1.cif.gz_C-2 crystal structure of streptomyces coelicolor rraas2, an unusual member of the rnase es inhibitor rraa protein family 0.957 8 214
3k4i-assembly1.cif.gz_B crystal structure of uncharacterized protein pspto_3204 from pseudomonas syringae pv. tomato str. dc3000 0.8937 8 226
ID Description Score Start End Superfamily
3k4iB01 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.9022 11 191 3.50.30.40
3k4iB01 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.8913 11 191 3.50.30.40
5ir2A00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.8689 3 210 3.50.30.40
2pcnA00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.8648 37 191 3.50.30.40
3nojA01 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.8499 27 190 3.50.30.40
ID Description Score Start End GO Terms
AF-A0A527ZK34-F1-model_v4 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase (Regulator of ribonuclease activity homolog) (RraA-like protein) 0.9851 1 189 GO:0046872
AF-A0A6B0XG78-F1-model_v4 Regulator of ribonuclease activity homolog 0.9824 1 242 GO:0046872
AF-A0A381VDY7-F1-model_v4 Uncharacterized protein 0.9814 1 191
AF-A0A527ZK34-F1-model_v4 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase (Regulator of ribonuclease activity homolog) (RraA-like protein) 0.9799 1 189 GO:0046872
AF-A0A381VDY7-F1-model_v4 Uncharacterized protein 0.9763 1 191

Map