F480290
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 776 | 247 | 776 | 323 |
Family's Representative Sequence
| Representative Sequence | 3300005293|Ga0065715_10129688|Ga0065715_101296883 |
| Length | 336 |
| Sequence | MSVAAHADREVVVIGSGPAGLTAALYAARANLRPLLIEGLEAGGQLMLTTMVENWPGFRDGIMGPDLMGEMRAQAERFGTEVLQGNVTSVDLKDRPFTITLEGGRKITTVALIIATGASARWLDIGSDRKLSGHGVSTCATCDGYFFRGRPIAVVGGGDSAMEEAVYLTKFASKVTVIHRRDTLRASKIMQDKAFANPKIEFVWDSEVIDVADLQKGEVTHLVLRNLKTAQTSHLPVDGVFIAIGHTPNTALFKGQLDLDPTGYIVTNGGTRTNVPGVFAAGDVQDHVYRQAVTAAGSGCMAAIDAERYIEGLPVADRPADGGPADGTVHRGDIAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 67 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 68 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 69 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 70 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 146 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 150 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 151 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 152 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 153 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 154 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 155 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 156 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 157 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 158 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 159 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 160 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 161 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 162 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 164 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 165 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 168 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 169 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 170 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 171 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 172 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 173 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 174 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 175 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 176 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 177 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 194 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 195 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 196 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 197 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 200 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 201 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 202 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 203 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 222 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 223 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 226 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 227 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 228 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 229 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 230 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 231 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 241 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 243 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 244 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 245 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 246 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.71 |
| Nodule | 0 |
| Rhizoplane | 2.71 |
| Rhizosphere | 94.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10007048 | 3300003203 | Bacteria | 5153 |
| 2 | Ga0065712_10004141 | 3300005290 | Bacteria | 4840 |
| 3 | Ga0065712_10068502 | 3300005290 | Bacteria | 10191 |
| 4 | Ga0065712_10084064 | 3300005290 | Bacteria | 2792 |
| 5 | Ga0065712_10092356 | 3300005290 | Bacteria | 2334 |
| 6 | Ga0065712_10130484 | 3300005290 | Bacteria | 1556 |
| 7 | Ga0065715_10035970 | 3300005293 | Bacteria | 1220 |
| 8 | Ga0065715_10096489 | 3300005293 | Bacteria | 3870 |
| 9 | Ga0065715_10129688 | 3300005293 | Bacteria | 2041 |
| 10 | Ga0065715_10176268 | 3300005293 | Bacteria | 1478 |
| 11 | Ga0065715_10203068 | 3300005293 | Bacteria | 1350 |
| 12 | Ga0065707_10009461 | 3300005295 | Bacteria | 3110 |
| 13 | Ga0070658_10143452 | 3300005327 | Bacteria | 1996 |
| 14 | Ga0070676_10010170 | 3300005328 | Bacteria | 5100 |
| 15 | Ga0070676_10024363 | 3300005328 | Bacteria | 3409 |
| 16 | Ga0070676_10214393 | 3300005328 | Bacteria | 1269 |
| 17 | Ga0070683_100013764 | 3300005329 | Bacteria | 7063 |
| 18 | Ga0070683_100016062 | 3300005329 | Bacteria | 6589 |
| 19 | Ga0070690_100011832 | 3300005330 | Bacteria | 5118 |
| 20 | Ga0070690_100038525 | 3300005330 | Bacteria | 3017 |
| 21 | Ga0070670_100001472 | 3300005331 | Bacteria | 18962 |
| 22 | Ga0070670_100007560 | 3300005331 | Bacteria | 9222 |
| 23 | Ga0070670_100011715 | 3300005331 | Bacteria | 7502 |
| 24 | Ga0070670_100019868 | 3300005331 | Bacteria | 5768 |
| 25 | Ga0070670_100020776 | 3300005331 | Bacteria | 5645 |
| 26 | Ga0070670_100035298 | 3300005331 | Bacteria | 4306 |
| 27 | Ga0070670_100051665 | 3300005331 | Bacteria | 3529 |
| 28 | Ga0070670_100070492 | 3300005331 | Bacteria | 3001 |
| 29 | Ga0070670_100435109 | 3300005331 | Bacteria | 1161 |
| 30 | Ga0070677_10079765 | 3300005333 | Bacteria | 1397 |
| 31 | Ga0068869_100001451 | 3300005334 | Bacteria | 14018 |
| 32 | Ga0068869_100009316 | 3300005334 | Bacteria | 6369 |
| 33 | Ga0068869_100018614 | 3300005334 | Bacteria | 4731 |
| 34 | Ga0068869_100118017 | 3300005334 | Bacteria | 2026 |
| 35 | Ga0068869_100184748 | 3300005334 | Bacteria | 1636 |
| 36 | Ga0070666_10014202 | 3300005335 | Bacteria | 5068 |
| 37 | Ga0070666_10045698 | 3300005335 | Bacteria | 2936 |
| 38 | Ga0070680_100370492 | 3300005336 | Bacteria | 1219 |
| 39 | Ga0068868_100011007 | 3300005338 | Bacteria | 6573 |
| 40 | Ga0070689_100025190 | 3300005340 | Bacteria | 4468 |
| 41 | Ga0070689_100045884 | 3300005340 | Bacteria | 3366 |
| 42 | Ga0070689_100087173 | 3300005340 | Bacteria | 2456 |
| 43 | Ga0070689_100096588 | 3300005340 | Bacteria | 2336 |
| 44 | Ga0070689_100137679 | 3300005340 | Bacteria | 1962 |
| 45 | Ga0070689_100270590 | 3300005340 | Bacteria | 1406 |
| 46 | Ga0070687_100010429 | 3300005343 | Bacteria | 4019 |
| 47 | Ga0070687_100043442 | 3300005343 | Bacteria | 2284 |
| 48 | Ga0070687_100045461 | 3300005343 | Bacteria | 2242 |
| 49 | Ga0070687_100107109 | 3300005343 | Bacteria | 1575 |
| 50 | Ga0070661_100057423 | 3300005344 | Bacteria | 2852 |
| 51 | Ga0070692_10036167 | 3300005345 | Bacteria | 2505 |
| 52 | Ga0070692_10067771 | 3300005345 | Bacteria | 1895 |
| 53 | Ga0070668_100256277 | 3300005347 | Bacteria | 1454 |
| 54 | Ga0070669_100001008 | 3300005353 | Bacteria | 20525 |
| 55 | Ga0070669_100003108 | 3300005353 | Bacteria | 11951 |
| 56 | Ga0070669_100005330 | 3300005353 | Bacteria | 9286 |
| 57 | Ga0070669_100039125 | 3300005353 | Bacteria | 3444 |
| 58 | Ga0070669_100102117 | 3300005353 | Bacteria | 2165 |
| 59 | Ga0070669_100113179 | 3300005353 | Bacteria | 2061 |
| 60 | Ga0070669_100122469 | 3300005353 | Bacteria | 1986 |
| 61 | Ga0070675_100001179 | 3300005354 | Bacteria | 18976 |
| 62 | Ga0070675_100001605 | 3300005354 | Bacteria | 16679 |
| 63 | Ga0070675_100009067 | 3300005354 | Bacteria | 7728 |
| 64 | Ga0070675_100012936 | 3300005354 | Bacteria | 6549 |
| 65 | Ga0070675_100019910 | 3300005354 | Bacteria | 5353 |
| 66 | Ga0070675_100019983 | 3300005354 | Bacteria | 5344 |
| 67 | Ga0070675_100021012 | 3300005354 | Bacteria | 5213 |
| 68 | Ga0070675_100028688 | 3300005354 | Bacteria | 4480 |
| 69 | Ga0070675_100032873 | 3300005354 | Bacteria | 4201 |
| 70 | Ga0070675_100042602 | 3300005354 | Bacteria | 3709 |
| 71 | Ga0070675_100230552 | 3300005354 | Bacteria | 1615 |
| 72 | Ga0070675_100253754 | 3300005354 | Bacteria | 1540 |
| 73 | Ga0070675_100361768 | 3300005354 | Bacteria | 1288 |
| 74 | Ga0070671_100091343 | 3300005355 | Bacteria | 2550 |
| 75 | Ga0070671_100167583 | 3300005355 | Bacteria | 1857 |
| 76 | Ga0070671_100459694 | 3300005355 | Bacteria | 1092 |
| 77 | Ga0070674_100010787 | 3300005356 | Bacteria | 5540 |
| 78 | Ga0070674_100017253 | 3300005356 | Bacteria | 4537 |
| 79 | Ga0070673_100002948 | 3300005364 | Bacteria | 10491 |
| 80 | Ga0070673_100008407 | 3300005364 | Bacteria | 6862 |
| 81 | Ga0070673_100016632 | 3300005364 | Bacteria | 5207 |
| 82 | Ga0070673_100019697 | 3300005364 | Bacteria | 4849 |
| 83 | Ga0070673_100031521 | 3300005364 | Bacteria | 3979 |
| 84 | Ga0070673_100044100 | 3300005364 | Bacteria | 3451 |
| 85 | Ga0070673_100092556 | 3300005364 | Bacteria | 2473 |
| 86 | Ga0070688_100025395 | 3300005365 | Bacteria | 3507 |
| 87 | Ga0070688_100060756 | 3300005365 | Bacteria | 2387 |
| 88 | Ga0070688_100138948 | 3300005365 | Bacteria | 1648 |
| 89 | Ga0070688_100260295 | 3300005365 | Bacteria | 1239 |
| 90 | Ga0070688_100305117 | 3300005365 | Bacteria | 1152 |
| 91 | Ga0070667_100025919 | 3300005367 | Bacteria | 4876 |
| 92 | Ga0070667_100138715 | 3300005367 | Bacteria | 2128 |
| 93 | Ga0070667_100149903 | 3300005367 | Bacteria | 2048 |
| 94 | Ga0070667_100211711 | 3300005367 | Bacteria | 1723 |
| 95 | Ga0070667_100351882 | 3300005367 | Bacteria | 1334 |
| 96 | Ga0070703_10020979 | 3300005406 | Bacteria | 1906 |
| 97 | Ga0070701_10022675 | 3300005438 | Bacteria | 3012 |
| 98 | Ga0070701_10026649 | 3300005438 | Bacteria | 2821 |
| 99 | Ga0070701_10029415 | 3300005438 | Bacteria | 2709 |
| 100 | Ga0070701_10054667 | 3300005438 | Bacteria | 2083 |
| 101 | Ga0070701_10069828 | 3300005438 | Bacteria | 1875 |
| 102 | Ga0070700_100004623 | 3300005441 | Bacteria | 7208 |
| 103 | Ga0070700_100013263 | 3300005441 | Bacteria | 4627 |
| 104 | Ga0070700_100052389 | 3300005441 | Bacteria | 2544 |
| 105 | Ga0070700_100092432 | 3300005441 | Bacteria | 1977 |
| 106 | Ga0070694_100120839 | 3300005444 | Bacteria | 1879 |
| 107 | Ga0070708_100177462 | 3300005445 | Bacteria | 1991 |
| 108 | Ga0070708_100194395 | 3300005445 | Bacteria | 1898 |
| 109 | Ga0070663_100029234 | 3300005455 | Bacteria | 3763 |
| 110 | Ga0070663_100403407 | 3300005455 | Bacteria | 1118 |
| 111 | Ga0070678_100038752 | 3300005456 | Bacteria | 3357 |
| 112 | Ga0070678_100050809 | 3300005456 | Bacteria | 3002 |
| 113 | Ga0070678_100434272 | 3300005456 | Bacteria | 1147 |
| 114 | Ga0070662_100012018 | 3300005457 | Bacteria | 5731 |
| 115 | Ga0070662_100027875 | 3300005457 | Bacteria | 3927 |
| 116 | Ga0070662_100237636 | 3300005457 | Bacteria | 1460 |
| 117 | Ga0070681_10075385 | 3300005458 | Bacteria | 3333 |
| 118 | Ga0070681_10317317 | 3300005458 | Bacteria | 1468 |
| 119 | Ga0068867_100002915 | 3300005459 | Bacteria | 12056 |
| 120 | Ga0068867_100015432 | 3300005459 | Bacteria | 5418 |
| 121 | Ga0068867_100048676 | 3300005459 | Bacteria | 3120 |
| 122 | Ga0068867_100199013 | 3300005459 | Bacteria | 1603 |
| 123 | Ga0070685_10006838 | 3300005466 | Bacteria | 5823 |
| 124 | Ga0070685_10066593 | 3300005466 | Bacteria | 2123 |
| 125 | Ga0070685_10100115 | 3300005466 | Bacteria | 1769 |
| 126 | Ga0070698_100000806 | 3300005471 | Bacteria | 34225 |
| 127 | Ga0070698_100025140 | 3300005471 | Bacteria | 6207 |
| 128 | Ga0070699_100000386 | 3300005518 | Bacteria | 42744 |
| 129 | Ga0070699_100006186 | 3300005518 | Bacteria | 10458 |
| 130 | Ga0070699_100068674 | 3300005518 | Bacteria | 3079 |
| 131 | Ga0070679_100295205 | 3300005530 | Bacteria | 1572 |
| 132 | Ga0070684_100000069 | 3300005535 | Bacteria | 65354 |
| 133 | Ga0070697_100037002 | 3300005536 | Bacteria | 3942 |
| 134 | Ga0070672_100006792 | 3300005543 | Bacteria | 7727 |
| 135 | Ga0070672_100022174 | 3300005543 | Bacteria | 4658 |
| 136 | Ga0070672_100029469 | 3300005543 | Bacteria | 4116 |
| 137 | Ga0070672_100030643 | 3300005543 | Bacteria | 4043 |
| 138 | Ga0070672_100111714 | 3300005543 | Bacteria | 2228 |
| 139 | Ga0070672_100195611 | 3300005543 | Bacteria | 1690 |
| 140 | Ga0070672_100252510 | 3300005543 | Bacteria | 1485 |
| 141 | Ga0070672_100484818 | 3300005543 | Bacteria | 1068 |
| 142 | Ga0070686_100033883 | 3300005544 | Bacteria | 3142 |
| 143 | Ga0070695_100065489 | 3300005545 | Bacteria | 2366 |
| 144 | Ga0070696_100064510 | 3300005546 | Bacteria | 2566 |
| 145 | Ga0070696_100067266 | 3300005546 | Bacteria | 2514 |
| 146 | Ga0070693_100036407 | 3300005547 | Bacteria | 2736 |
| 147 | Ga0070693_100081703 | 3300005547 | Bacteria | 1928 |
| 148 | Ga0070665_100060629 | 3300005548 | Bacteria | 3792 |
| 149 | Ga0070704_100006063 | 3300005549 | Bacteria | 7090 |
| 150 | Ga0070704_100028365 | 3300005549 | Bacteria | 3723 |
| 151 | Ga0070704_100059701 | 3300005549 | Bacteria | 2722 |
| 152 | Ga0070664_100029842 | 3300005564 | Bacteria | 4547 |
| 153 | Ga0070664_100035652 | 3300005564 | Bacteria | 4177 |
| 154 | Ga0070664_100043148 | 3300005564 | Bacteria | 3805 |
| 155 | Ga0070664_100177679 | 3300005564 | Bacteria | 1891 |
| 156 | Ga0070664_100462565 | 3300005564 | Bacteria | 1166 |
| 157 | Ga0070664_100512773 | 3300005564 | Bacteria | 1106 |
| 158 | Ga0068857_100012663 | 3300005577 | Bacteria | 7348 |
| 159 | Ga0068857_100028553 | 3300005577 | Bacteria | 4923 |
| 160 | Ga0068857_100060235 | 3300005577 | Bacteria | 3372 |
| 161 | Ga0068854_100002999 | 3300005578 | Bacteria | 10477 |
| 162 | Ga0068854_100031544 | 3300005578 | Bacteria | 3684 |
| 163 | Ga0068856_100175684 | 3300005614 | Bacteria | 2154 |
| 164 | Ga0070702_100136052 | 3300005615 | Bacteria | 1559 |
| 165 | Ga0068859_100002081 | 3300005617 | Bacteria | 20395 |
| 166 | Ga0068859_100010866 | 3300005617 | Bacteria | 9162 |
| 167 | Ga0068859_100015676 | 3300005617 | Bacteria | 7615 |
| 168 | Ga0068859_100039203 | 3300005617 | Bacteria | 4752 |
| 169 | Ga0068859_100057245 | 3300005617 | Bacteria | 3927 |
| 170 | Ga0068859_100097828 | 3300005617 | Bacteria | 2988 |
| 171 | Ga0068859_100188619 | 3300005617 | Bacteria | 2146 |
| 172 | Ga0068859_100239583 | 3300005617 | Bacteria | 1903 |
| 173 | Ga0068859_100297212 | 3300005617 | Bacteria | 1708 |
| 174 | Ga0068859_100529208 | 3300005617 | Bacteria | 1273 |
| 175 | Ga0068864_100005332 | 3300005618 | Bacteria | 10533 |
| 176 | Ga0068864_100005475 | 3300005618 | Bacteria | 10411 |
| 177 | Ga0068864_100007453 | 3300005618 | Bacteria | 9010 |
| 178 | Ga0068864_100218930 | 3300005618 | Bacteria | 1756 |
| 179 | Ga0068864_100264108 | 3300005618 | Bacteria | 1602 |
| 180 | Ga0068864_100306959 | 3300005618 | Bacteria | 1487 |
| 181 | Ga0068866_10007464 | 3300005718 | Bacteria | 4578 |
| 182 | Ga0068861_100001989 | 3300005719 | Bacteria | 13206 |
| 183 | Ga0068861_100011620 | 3300005719 | Bacteria | 6125 |
| 184 | Ga0068861_100080622 | 3300005719 | Bacteria | 2546 |
| 185 | Ga0068861_100089158 | 3300005719 | Bacteria | 2431 |
| 186 | Ga0068861_100385923 | 3300005719 | Bacteria | 1239 |
| 187 | Ga0068870_10000269 | 3300005840 | Bacteria | 19239 |
| 188 | Ga0068870_10003442 | 3300005840 | Bacteria | 6708 |
| 189 | Ga0068870_10003674 | 3300005840 | Bacteria | 6517 |
| 190 | Ga0068863_100006562 | 3300005841 | Bacteria | 11419 |
| 191 | Ga0068863_100154643 | 3300005841 | Bacteria | 2195 |
| 192 | Ga0068863_100232909 | 3300005841 | Bacteria | 1777 |
| 193 | Ga0068863_100473802 | 3300005841 | Bacteria | 1230 |
| 194 | Ga0068863_100481960 | 3300005841 | Bacteria | 1220 |
| 195 | Ga0068858_100008296 | 3300005842 | Bacteria | 9989 |
| 196 | Ga0068860_100067582 | 3300005843 | Bacteria | 3395 |
| 197 | Ga0068860_100080168 | 3300005843 | Bacteria | 3104 |
| 198 | Ga0068862_100000662 | 3300005844 | Bacteria | 35343 |
| 199 | Ga0068862_100001000 | 3300005844 | Bacteria | 27052 |
| 200 | Ga0068862_100039327 | 3300005844 | Bacteria | 4016 |
| 201 | Ga0068862_100058781 | 3300005844 | Bacteria | 3299 |
| 202 | Ga0081538_10064337 | 3300005981 | Bacteria | 2075 |
| 203 | Ga0081539_10000034 | 3300005985 | Bacteria | 307597 |
| 204 | Ga0081539_10000190 | 3300005985 | Bacteria | 142511 |
| 205 | Ga0075365_10039266 | 3300006038 | Bacteria | 3081 |
| 206 | Ga0075365_10042337 | 3300006038 | Bacteria | 2977 |
| 207 | Ga0075368_10042760 | 3300006042 | Bacteria | 1784 |
| 208 | Ga0075368_10092734 | 3300006042 | Bacteria | 1236 |
| 209 | Ga0075362_10003939 | 3300006177 | Bacteria | 5274 |
| 210 | Ga0075367_10006522 | 3300006178 | Bacteria | 5902 |
| 211 | Ga0075367_10054158 | 3300006178 | Bacteria | 2378 |
| 212 | Ga0075366_10005889 | 3300006195 | Bacteria | 6665 |
| 213 | Ga0075366_10026146 | 3300006195 | Bacteria | 3417 |
| 214 | Ga0075366_10027436 | 3300006195 | Bacteria | 3341 |
| 215 | Ga0097621_100072035 | 3300006237 | Bacteria | 2857 |
| 216 | Ga0097621_100074644 | 3300006237 | Bacteria | 2809 |
| 217 | Ga0097621_100136293 | 3300006237 | Bacteria | 2094 |
| 218 | Ga0097621_100156079 | 3300006237 | Bacteria | 1959 |
| 219 | Ga0097621_100346097 | 3300006237 | Bacteria | 1321 |
| 220 | Ga0068871_100133895 | 3300006358 | Bacteria | 2103 |
| 221 | Ga0068871_100204475 | 3300006358 | Bacteria | 1706 |
| 222 | Ga0075428_100000439 | 3300006844 | Bacteria | 41450 |
| 223 | Ga0075428_100004439 | 3300006844 | Bacteria | 15493 |
| 224 | Ga0075428_100013447 | 3300006844 | Bacteria | 9108 |
| 225 | Ga0075428_100014410 | 3300006844 | Bacteria | 8785 |
| 226 | Ga0075428_100018233 | 3300006844 | Bacteria | 7757 |
| 227 | Ga0075428_100024526 | 3300006844 | Bacteria | 6674 |
| 228 | Ga0075428_100034518 | 3300006844 | Bacteria | 5578 |
| 229 | Ga0075428_100035169 | 3300006844 | Bacteria | 5523 |
| 230 | Ga0075428_100200251 | 3300006844 | Bacteria | 2159 |
| 231 | Ga0075428_100411845 | 3300006844 | Bacteria | 1448 |
| 232 | Ga0075430_100000107 | 3300006846 | Bacteria | 49582 |
| 233 | Ga0075430_100001499 | 3300006846 | Bacteria | 19059 |
| 234 | Ga0075430_100016781 | 3300006846 | Bacteria | 6235 |
| 235 | Ga0075430_100017890 | 3300006846 | Bacteria | 6033 |
| 236 | Ga0075430_100027691 | 3300006846 | Bacteria | 4814 |
| 237 | Ga0075430_100064303 | 3300006846 | Bacteria | 3082 |
| 238 | Ga0075430_100093115 | 3300006846 | Bacteria | 2519 |
| 239 | Ga0075430_100104309 | 3300006846 | Bacteria | 2367 |
| 240 | Ga0075430_100318834 | 3300006846 | Bacteria | 1285 |
| 241 | Ga0075431_100000506 | 3300006847 | Bacteria | 32563 |
| 242 | Ga0075431_100005881 | 3300006847 | Bacteria | 12143 |
| 243 | Ga0075431_100014360 | 3300006847 | Bacteria | 8009 |
| 244 | Ga0075431_100153812 | 3300006847 | Bacteria | 2367 |
| 245 | Ga0075431_100157670 | 3300006847 | Bacteria | 2335 |
| 246 | Ga0075431_100157785 | 3300006847 | Bacteria | 2334 |
| 247 | Ga0075431_100210498 | 3300006847 | Bacteria | 1986 |
| 248 | Ga0075431_100262609 | 3300006847 | Bacteria | 1752 |
| 249 | Ga0075431_100276559 | 3300006847 | Bacteria | 1700 |
| 250 | Ga0075433_10000466 | 3300006852 | Bacteria | 26360 |
| 251 | Ga0075433_10002058 | 3300006852 | Bacteria | 15205 |
| 252 | Ga0075433_10019190 | 3300006852 | Bacteria | 5691 |
| 253 | Ga0075433_10023220 | 3300006852 | Bacteria | 5217 |
| 254 | Ga0075433_10074202 | 3300006852 | Bacteria | 2993 |
| 255 | Ga0075433_10076422 | 3300006852 | Bacteria | 2949 |
| 256 | Ga0075433_10129411 | 3300006852 | Bacteria | 2243 |
| 257 | Ga0075433_10260049 | 3300006852 | Bacteria | 1539 |
| 258 | Ga0075434_100002389 | 3300006871 | Bacteria | 16482 |
| 259 | Ga0075434_100003880 | 3300006871 | Bacteria | 13384 |
| 260 | Ga0075434_100007789 | 3300006871 | Bacteria | 9919 |
| 261 | Ga0075434_100008078 | 3300006871 | Bacteria | 9759 |
| 262 | Ga0075434_100066673 | 3300006871 | Bacteria | 3586 |
| 263 | Ga0075434_100113047 | 3300006871 | Bacteria | 2727 |
| 264 | Ga0075434_100122761 | 3300006871 | Bacteria | 2613 |
| 265 | Ga0075434_100502109 | 3300006871 | Bacteria | 1234 |
| 266 | Ga0075429_100004353 | 3300006880 | Bacteria | 12164 |
| 267 | Ga0075429_100004861 | 3300006880 | Bacteria | 11576 |
| 268 | Ga0075429_100016395 | 3300006880 | Bacteria | 6422 |
| 269 | Ga0075429_100065379 | 3300006880 | Bacteria | 3166 |
| 270 | Ga0075429_100084831 | 3300006880 | Bacteria | 2761 |
| 271 | Ga0075429_100101360 | 3300006880 | Bacteria | 2513 |
| 272 | Ga0075429_100102932 | 3300006880 | Bacteria | 2493 |
| 273 | Ga0075429_100142044 | 3300006880 | Bacteria | 2102 |
| 274 | Ga0068865_100014782 | 3300006881 | Bacteria | 4967 |
| 275 | Ga0068865_100035023 | 3300006881 | Bacteria | 3373 |
| 276 | Ga0068865_100124263 | 3300006881 | Bacteria | 1924 |
| 277 | Ga0068865_100239219 | 3300006881 | Bacteria | 1428 |
| 278 | Ga0097620_100002081 | 3300006931 | Bacteria | 20395 |
| 279 | Ga0097620_100010866 | 3300006931 | Bacteria | 9162 |
| 280 | Ga0097620_100015676 | 3300006931 | Bacteria | 7615 |
| 281 | Ga0097620_100039202 | 3300006931 | Bacteria | 4752 |
| 282 | Ga0097620_100057246 | 3300006931 | Bacteria | 3927 |
| 283 | Ga0097620_100097829 | 3300006931 | Bacteria | 2988 |
| 284 | Ga0097620_100188616 | 3300006931 | Bacteria | 2146 |
| 285 | Ga0097620_100239573 | 3300006931 | Bacteria | 1903 |
| 286 | Ga0097620_100297207 | 3300006931 | Bacteria | 1708 |
| 287 | Ga0097620_100529226 | 3300006931 | Bacteria | 1273 |
| 288 | Ga0075435_100007984 | 3300007076 | Bacteria | 7575 |
| 289 | Ga0075435_100062458 | 3300007076 | Bacteria | 3023 |
| 290 | Ga0075435_100225688 | 3300007076 | Bacteria | 1591 |
| 291 | Ga0075435_100322856 | 3300007076 | Bacteria | 1321 |
| 292 | Ga0111539_10000065 | 3300009094 | Bacteria | 106698 |
| 293 | Ga0111539_10001128 | 3300009094 | Bacteria | 35328 |
| 294 | Ga0111539_10003505 | 3300009094 | Bacteria | 20690 |
| 295 | Ga0111539_10003820 | 3300009094 | Bacteria | 19828 |
| 296 | Ga0111539_10006236 | 3300009094 | Bacteria | 15389 |
| 297 | Ga0111539_10010818 | 3300009094 | Bacteria | 11487 |
| 298 | Ga0111539_10012997 | 3300009094 | Bacteria | 10418 |
| 299 | Ga0111539_10017744 | 3300009094 | Bacteria | 8811 |
| 300 | Ga0111539_10022546 | 3300009094 | Bacteria | 7735 |
| 301 | Ga0111539_10047854 | 3300009094 | Bacteria | 5110 |
| 302 | Ga0111539_10086035 | 3300009094 | Bacteria | 3695 |
| 303 | Ga0111539_10189151 | 3300009094 | Bacteria | 2403 |
| 304 | Ga0111539_10212449 | 3300009094 | Bacteria | 2254 |
| 305 | Ga0111539_10224771 | 3300009094 | Bacteria | 2186 |
| 306 | Ga0105245_10017804 | 3300009098 | Bacteria | 6202 |
| 307 | Ga0114129_10000076 | 3300009147 | Bacteria | 90985 |
| 308 | Ga0114129_10000476 | 3300009147 | Bacteria | 48332 |
| 309 | Ga0114129_10003827 | 3300009147 | Bacteria | 21202 |
| 310 | Ga0114129_10004740 | 3300009147 | Bacteria | 19213 |
| 311 | Ga0114129_10007052 | 3300009147 | Bacteria | 15997 |
| 312 | Ga0114129_10007774 | 3300009147 | Bacteria | 15254 |
| 313 | Ga0114129_10009630 | 3300009147 | Bacteria | 13785 |
| 314 | Ga0114129_10013579 | 3300009147 | Bacteria | 11604 |
| 315 | Ga0114129_10023144 | 3300009147 | Bacteria | 8812 |
| 316 | Ga0114129_10024852 | 3300009147 | Bacteria | 8493 |
| 317 | Ga0114129_10033236 | 3300009147 | Bacteria | 7289 |
| 318 | Ga0114129_10038106 | 3300009147 | Bacteria | 6783 |
| 319 | Ga0114129_10081605 | 3300009147 | Bacteria | 4495 |
| 320 | Ga0114129_10111384 | 3300009147 | Bacteria | 3777 |
| 321 | Ga0114129_10230902 | 3300009147 | Bacteria | 2492 |
| 322 | Ga0114129_10312292 | 3300009147 | Bacteria | 2092 |
| 323 | Ga0114129_10429864 | 3300009147 | Bacteria | 1735 |
| 324 | Ga0114129_10755950 | 3300009147 | Bacteria | 1244 |
| 325 | Ga0105243_10011752 | 3300009148 | Bacteria | 6621 |
| 326 | Ga0105243_10051889 | 3300009148 | Bacteria | 3246 |
| 327 | Ga0105243_10119671 | 3300009148 | Bacteria | 2218 |
| 328 | Ga0105241_10165763 | 3300009174 | Bacteria | 1820 |
| 329 | Ga0105242_10249531 | 3300009176 | Bacteria | 1599 |
| 330 | Ga0105248_10042462 | 3300009177 | Bacteria | 5100 |
| 331 | Ga0105248_10053293 | 3300009177 | Bacteria | 4539 |
| 332 | Ga0105248_10194501 | 3300009177 | Bacteria | 2285 |
| 333 | Ga0105248_10314497 | 3300009177 | Bacteria | 1764 |
| 334 | Ga0105248_10378264 | 3300009177 | Bacteria | 1594 |
| 335 | Ga0105248_10507875 | 3300009177 | Bacteria | 1359 |
| 336 | Ga0105238_10020278 | 3300009551 | Bacteria | 6768 |
| 337 | Ga0105249_10001042 | 3300009553 | Bacteria | 24508 |
| 338 | Ga0105249_10006074 | 3300009553 | Bacteria | 10466 |
| 339 | Ga0105249_10733592 | 3300009553 | Bacteria | 1049 |
| 340 | Ga0105239_10099330 | 3300010375 | Bacteria | 3218 |
| 341 | Ga0105246_10079894 | 3300011119 | Bacteria | 2327 |
| 342 | Ga0105246_10419471 | 3300011119 | Bacteria | 1116 |
| 343 | Ga0157374_10111515 | 3300013296 | Bacteria | 2631 |
| 344 | Ga0157374_10257857 | 3300013296 | Bacteria | 1717 |
| 345 | Ga0157374_10440266 | 3300013296 | Bacteria | 1304 |
| 346 | Ga0157378_10140615 | 3300013297 | Bacteria | 2241 |
| 347 | Ga0157372_10078064 | 3300013307 | Bacteria | 3741 |
| 348 | Ga0157375_10027735 | 3300013308 | Bacteria | 5298 |
| 349 | Ga0157375_10128242 | 3300013308 | Bacteria | 2654 |
| 350 | Ga0157375_10139857 | 3300013308 | Bacteria | 2547 |
| 351 | Ga0157375_10657291 | 3300013308 | Bacteria | 1204 |
| 352 | Ga0163163_10008937 | 3300014325 | Bacteria | 8924 |
| 353 | Ga0163163_10017509 | 3300014325 | Bacteria | 6684 |
| 354 | Ga0163163_10480951 | 3300014325 | Bacteria | 1303 |
| 355 | Ga0157380_10004723 | 3300014326 | Bacteria | 9481 |
| 356 | Ga0157380_10050857 | 3300014326 | Bacteria | 3274 |
| 357 | Ga0157380_10498434 | 3300014326 | Bacteria | 1182 |
| 358 | Ga0157377_10008061 | 3300014745 | Bacteria | 5123 |
| 359 | Ga0157377_10021608 | 3300014745 | Bacteria | 3387 |
| 360 | Ga0157377_10119378 | 3300014745 | Bacteria | 1596 |
| 361 | Ga0157379_10102966 | 3300014968 | Bacteria | 2562 |
| 362 | Ga0157379_10219446 | 3300014968 | Bacteria | 1723 |
| 363 | Ga0157379_10519658 | 3300014968 | Bacteria | 1105 |
| 364 | Ga0163161_10002282 | 3300017792 | Bacteria | 13761 |
| 365 | Ga0163161_10121374 | 3300017792 | Bacteria | 1964 |
| 366 | Ga0207697_10000085 | 3300025315 | Bacteria | 41401 |
| 367 | Ga0207697_10003472 | 3300025315 | Bacteria | 7780 |
| 368 | Ga0207656_10043530 | 3300025321 | Bacteria | 1915 |
| 369 | Ga0207682_10000133 | 3300025893 | Bacteria | 33689 |
| 370 | Ga0207682_10006805 | 3300025893 | Bacteria | 4587 |
| 371 | Ga0207682_10009032 | 3300025893 | Bacteria | 3939 |
| 372 | Ga0207642_10007752 | 3300025899 | Bacteria | 3640 |
| 373 | Ga0207688_10000477 | 3300025901 | Bacteria | 19238 |
| 374 | Ga0207688_10100576 | 3300025901 | Bacteria | 1669 |
| 375 | Ga0207680_10093887 | 3300025903 | Bacteria | 1915 |
| 376 | Ga0207680_10102491 | 3300025903 | Bacteria | 1841 |
| 377 | Ga0207647_10038289 | 3300025904 | Bacteria | 3033 |
| 378 | Ga0207645_10001684 | 3300025907 | Bacteria | 17968 |
| 379 | Ga0207645_10027536 | 3300025907 | Bacteria | 3669 |
| 380 | Ga0207645_10028344 | 3300025907 | Bacteria | 3615 |
| 381 | Ga0207645_10035538 | 3300025907 | Bacteria | 3199 |
| 382 | Ga0207645_10137273 | 3300025907 | Bacteria | 1593 |
| 383 | Ga0207643_10000665 | 3300025908 | Bacteria | 21379 |
| 384 | Ga0207643_10009824 | 3300025908 | Bacteria | 5139 |
| 385 | Ga0207643_10128591 | 3300025908 | Bacteria | 1505 |
| 386 | Ga0207707_10200486 | 3300025912 | Bacteria | 1740 |
| 387 | Ga0207695_10032358 | 3300025913 | Bacteria | 5723 |
| 388 | Ga0207662_10002216 | 3300025918 | Bacteria | 9690 |
| 389 | Ga0207662_10009162 | 3300025918 | Bacteria | 5440 |
| 390 | Ga0207662_10013731 | 3300025918 | Bacteria | 4533 |
| 391 | Ga0207662_10021443 | 3300025918 | Bacteria | 3693 |
| 392 | Ga0207649_10113239 | 3300025920 | Bacteria | 1817 |
| 393 | Ga0207646_10457023 | 3300025922 | Bacteria | 1152 |
| 394 | Ga0207681_10005692 | 3300025923 | Bacteria | 7653 |
| 395 | Ga0207681_10009866 | 3300025923 | Bacteria | 5841 |
| 396 | Ga0207681_10024146 | 3300025923 | Bacteria | 3899 |
| 397 | Ga0207681_10151808 | 3300025923 | Bacteria | 1737 |
| 398 | Ga0207681_10271051 | 3300025923 | Bacteria | 1332 |
| 399 | Ga0207694_10031751 | 3300025924 | Bacteria | 4037 |
| 400 | Ga0207650_10006792 | 3300025925 | Bacteria | 7804 |
| 401 | Ga0207650_10011126 | 3300025925 | Bacteria | 6188 |
| 402 | Ga0207650_10015265 | 3300025925 | Bacteria | 5346 |
| 403 | Ga0207650_10021754 | 3300025925 | Bacteria | 4534 |
| 404 | Ga0207650_10060762 | 3300025925 | Bacteria | 2820 |
| 405 | Ga0207650_10091165 | 3300025925 | Bacteria | 2329 |
| 406 | Ga0207659_10000547 | 3300025926 | Bacteria | 22456 |
| 407 | Ga0207659_10000692 | 3300025926 | Bacteria | 20033 |
| 408 | Ga0207659_10003019 | 3300025926 | Bacteria | 10036 |
| 409 | Ga0207659_10007084 | 3300025926 | Bacteria | 6886 |
| 410 | Ga0207659_10013082 | 3300025926 | Bacteria | 5304 |
| 411 | Ga0207659_10015463 | 3300025926 | Bacteria | 4946 |
| 412 | Ga0207659_10055621 | 3300025926 | Bacteria | 2831 |
| 413 | Ga0207659_10089287 | 3300025926 | Bacteria | 2298 |
| 414 | Ga0207659_10134758 | 3300025926 | Bacteria | 1911 |
| 415 | Ga0207659_10137045 | 3300025926 | Bacteria | 1896 |
| 416 | Ga0207659_10189204 | 3300025926 | Bacteria | 1637 |
| 417 | Ga0207644_10068482 | 3300025931 | Bacteria | 2589 |
| 418 | Ga0207690_10122424 | 3300025932 | Bacteria | 1892 |
| 419 | Ga0207706_10003174 | 3300025933 | Bacteria | 15790 |
| 420 | Ga0207706_10071856 | 3300025933 | Bacteria | 3044 |
| 421 | Ga0207706_10072049 | 3300025933 | Bacteria | 3039 |
| 422 | Ga0207706_10238746 | 3300025933 | Bacteria | 1589 |
| 423 | Ga0207686_10012255 | 3300025934 | Bacteria | 4712 |
| 424 | Ga0207709_10025886 | 3300025935 | Bacteria | 3364 |
| 425 | Ga0207709_10246249 | 3300025935 | Bacteria | 1303 |
| 426 | Ga0207670_10003124 | 3300025936 | Bacteria | 8763 |
| 427 | Ga0207670_10008107 | 3300025936 | Bacteria | 5911 |
| 428 | Ga0207670_10046326 | 3300025936 | Bacteria | 2888 |
| 429 | Ga0207670_10104909 | 3300025936 | Bacteria | 2025 |
| 430 | Ga0207669_10005428 | 3300025937 | Bacteria | 5718 |
| 431 | Ga0207669_10009972 | 3300025937 | Bacteria | 4552 |
| 432 | Ga0207669_10137316 | 3300025937 | Bacteria | 1691 |
| 433 | Ga0207669_10166218 | 3300025937 | Bacteria | 1565 |
| 434 | Ga0207704_10002475 | 3300025938 | Bacteria | 8318 |
| 435 | Ga0207704_10373227 | 3300025938 | Bacteria | 1117 |
| 436 | Ga0207691_10003154 | 3300025940 | Bacteria | 16120 |
| 437 | Ga0207691_10004842 | 3300025940 | Bacteria | 13016 |
| 438 | Ga0207691_10016461 | 3300025940 | Bacteria | 7020 |
| 439 | Ga0207691_10025047 | 3300025940 | Bacteria | 5606 |
| 440 | Ga0207691_10069827 | 3300025940 | Bacteria | 3173 |
| 441 | Ga0207691_10088454 | 3300025940 | Bacteria | 2778 |
| 442 | Ga0207691_10120381 | 3300025940 | Bacteria | 2327 |
| 443 | Ga0207691_10149675 | 3300025940 | Bacteria | 2053 |
| 444 | Ga0207691_10219210 | 3300025940 | Bacteria | 1650 |
| 445 | Ga0207711_10057855 | 3300025941 | Bacteria | 3333 |
| 446 | Ga0207711_10060750 | 3300025941 | Bacteria | 3257 |
| 447 | Ga0207711_10061542 | 3300025941 | Bacteria | 3237 |
| 448 | Ga0207711_10091612 | 3300025941 | Bacteria | 2674 |
| 449 | Ga0207711_10314411 | 3300025941 | Bacteria | 1446 |
| 450 | Ga0207689_10001141 | 3300025942 | Bacteria | 25628 |
| 451 | Ga0207689_10050149 | 3300025942 | Bacteria | 3442 |
| 452 | Ga0207689_10058190 | 3300025942 | Bacteria | 3179 |
| 453 | Ga0207689_10106745 | 3300025942 | Bacteria | 2301 |
| 454 | Ga0207689_10139896 | 3300025942 | Bacteria | 1994 |
| 455 | Ga0207689_10149033 | 3300025942 | Bacteria | 1928 |
| 456 | Ga0207679_10012954 | 3300025945 | Bacteria | 5457 |
| 457 | Ga0207679_10075106 | 3300025945 | Bacteria | 2563 |
| 458 | Ga0207679_10203848 | 3300025945 | Bacteria | 1654 |
| 459 | Ga0207679_10458307 | 3300025945 | Bacteria | 1132 |
| 460 | Ga0207679_10515724 | 3300025945 | Bacteria | 1068 |
| 461 | Ga0207651_10002774 | 3300025960 | Bacteria | 8413 |
| 462 | Ga0207651_10004970 | 3300025960 | Bacteria | 6776 |
| 463 | Ga0207651_10053131 | 3300025960 | Bacteria | 2767 |
| 464 | Ga0207712_10004342 | 3300025961 | Bacteria | 8956 |
| 465 | Ga0207712_10014252 | 3300025961 | Bacteria | 5108 |
| 466 | Ga0207712_10029660 | 3300025961 | Bacteria | 3672 |
| 467 | Ga0207668_10124693 | 3300025972 | Bacteria | 1956 |
| 468 | Ga0207703_10131414 | 3300026035 | Bacteria | 2162 |
| 469 | Ga0207678_10036825 | 3300026067 | Bacteria | 4259 |
| 470 | Ga0207678_10064557 | 3300026067 | Bacteria | 3145 |
| 471 | Ga0207678_10128323 | 3300026067 | Bacteria | 2163 |
| 472 | Ga0207708_10006210 | 3300026075 | Bacteria | 8855 |
| 473 | Ga0207708_10012471 | 3300026075 | Bacteria | 6335 |
| 474 | Ga0207708_10014730 | 3300026075 | Bacteria | 5852 |
| 475 | Ga0207708_10024546 | 3300026075 | Bacteria | 4561 |
| 476 | Ga0207641_10008578 | 3300026088 | Bacteria | 8441 |
| 477 | Ga0207641_10135896 | 3300026088 | Bacteria | 2213 |
| 478 | Ga0207648_10001255 | 3300026089 | Bacteria | 28363 |
| 479 | Ga0207648_10004031 | 3300026089 | Bacteria | 15246 |
| 480 | Ga0207648_10013384 | 3300026089 | Bacteria | 7634 |
| 481 | Ga0207648_10025141 | 3300026089 | Bacteria | 5309 |
| 482 | Ga0207648_10041422 | 3300026089 | Bacteria | 4044 |
| 483 | Ga0207648_10089442 | 3300026089 | Bacteria | 2690 |
| 484 | Ga0207676_10008322 | 3300026095 | Bacteria | 7373 |
| 485 | Ga0207676_10062615 | 3300026095 | Bacteria | 2951 |
| 486 | Ga0207676_10127604 | 3300026095 | Bacteria | 2157 |
| 487 | Ga0207676_10191049 | 3300026095 | Bacteria | 1802 |
| 488 | Ga0207674_10038394 | 3300026116 | Bacteria | 4971 |
| 489 | Ga0207674_10039518 | 3300026116 | Bacteria | 4890 |
| 490 | Ga0207674_10075303 | 3300026116 | Bacteria | 3385 |
| 491 | Ga0207674_10198604 | 3300026116 | Bacteria | 1955 |
| 492 | Ga0207675_100006796 | 3300026118 | Bacteria | 10827 |
| 493 | Ga0207675_100035929 | 3300026118 | Bacteria | 4622 |
| 494 | Ga0207675_100036318 | 3300026118 | Bacteria | 4597 |
| 495 | Ga0207675_100065217 | 3300026118 | Bacteria | 3404 |
| 496 | Ga0207675_100384152 | 3300026118 | Bacteria | 1381 |
| 497 | Ga0207675_100451654 | 3300026118 | Bacteria | 1274 |
| 498 | Ga0207683_10001698 | 3300026121 | Bacteria | 19704 |
| 499 | Ga0207683_10006182 | 3300026121 | Bacteria | 10259 |
| 500 | Ga0207683_10029838 | 3300026121 | Bacteria | 4723 |
| 501 | Ga0207683_10050609 | 3300026121 | Bacteria | 3640 |
| 502 | Ga0207683_10104562 | 3300026121 | Bacteria | 2530 |
| 503 | Ga0207683_10151620 | 3300026121 | Bacteria | 2092 |
| 504 | Ga0207683_10186613 | 3300026121 | Bacteria | 1881 |
| 505 | Ga0207683_10266143 | 3300026121 | Bacteria | 1566 |
| 506 | Ga0207683_10466440 | 3300026121 | Bacteria | 1165 |
| 507 | Ga0209813_10072410 | 3300027866 | Bacteria | 1123 |
| 508 | Ga0207428_10000345 | 3300027907 | Bacteria | 60424 |
| 509 | Ga0207428_10000442 | 3300027907 | Bacteria | 50837 |
| 510 | Ga0207428_10000797 | 3300027907 | Bacteria | 35667 |
| 511 | Ga0207428_10000936 | 3300027907 | Bacteria | 32455 |
| 512 | Ga0207428_10001419 | 3300027907 | Bacteria | 25210 |
| 513 | Ga0207428_10009368 | 3300027907 | Bacteria | 8783 |
| 514 | Ga0207428_10056404 | 3300027907 | Bacteria | 3122 |
| 515 | Ga0268266_10062006 | 3300028379 | Bacteria | 3226 |
| 516 | Ga0268265_10000237 | 3300028380 | Bacteria | 62935 |
| 517 | Ga0268265_10046338 | 3300028380 | Bacteria | 3249 |
| 518 | Ga0268265_10253096 | 3300028380 | Bacteria | 1561 |
| 519 | Ga0268265_10372315 | 3300028380 | Bacteria | 1311 |
| 520 | Ga0268264_10018583 | 3300028381 | Bacteria | 5684 |
| 521 | Ga0268264_10031761 | 3300028381 | Bacteria | 4330 |
| 522 | Ga0268264_10228114 | 3300028381 | Bacteria | 1718 |
| 523 | Ga0307408_100005249 | 3300031548 | Bacteria | 8683 |
| 524 | Ga0307408_100035572 | 3300031548 | Bacteria | 3496 |
| 525 | Ga0307408_100053869 | 3300031548 | Bacteria | 2907 |
| 526 | Ga0307408_100067524 | 3300031548 | Bacteria | 2630 |
| 527 | Ga0307408_100077153 | 3300031548 | Bacteria | 2481 |
| 528 | Ga0307408_100265426 | 3300031548 | Bacteria | 1423 |
| 529 | Ga0307405_10027142 | 3300031731 | Bacteria | 3315 |
| 530 | Ga0307413_10041280 | 3300031824 | Bacteria | 2700 |
| 531 | Ga0307413_10113587 | 3300031824 | Bacteria | 1818 |
| 532 | Ga0307413_10125422 | 3300031824 | Bacteria | 1747 |
| 533 | Ga0307410_10011774 | 3300031852 | Bacteria | 5021 |
| 534 | Ga0307410_10151072 | 3300031852 | Bacteria | 1729 |
| 535 | Ga0307410_10165951 | 3300031852 | Bacteria | 1659 |
| 536 | Ga0307410_10330013 | 3300031852 | Bacteria | 1213 |
| 537 | Ga0307407_10006608 | 3300031903 | Bacteria | 5176 |
| 538 | Ga0307407_10011965 | 3300031903 | Bacteria | 4154 |
| 539 | Ga0307412_10160733 | 3300031911 | Bacteria | 1668 |
| 540 | Ga0307412_10198103 | 3300031911 | Bacteria | 1523 |
| 541 | Ga0307409_100030573 | 3300031995 | Bacteria | 3871 |
| 542 | Ga0307409_100106260 | 3300031995 | Bacteria | 2342 |
| 543 | Ga0307409_100318872 | 3300031995 | Bacteria | 1454 |
| 544 | Ga0307409_100610455 | 3300031995 | Bacteria | 1079 |
| 545 | Ga0307416_100001676 | 3300032002 | Bacteria | 12247 |
| 546 | Ga0307416_100008926 | 3300032002 | Bacteria | 6515 |
| 547 | Ga0307416_100011349 | 3300032002 | Bacteria | 5933 |
| 548 | Ga0307416_100027563 | 3300032002 | Bacteria | 4210 |
| 549 | Ga0307416_100157619 | 3300032002 | Bacteria | 2093 |
| 550 | Ga0307416_100160896 | 3300032002 | Bacteria | 2075 |
| 551 | Ga0307416_100189115 | 3300032002 | Bacteria | 1939 |
| 552 | Ga0307416_100305580 | 3300032002 | Bacteria | 1584 |
| 553 | Ga0307416_100441539 | 3300032002 | Bacteria | 1351 |
| 554 | Ga0307416_100471192 | 3300032002 | Bacteria | 1313 |
| 555 | Ga0307414_10104991 | 3300032004 | Bacteria | 2135 |
| 556 | Ga0307414_10388833 | 3300032004 | Bacteria | 1208 |
| 557 | Ga0307411_10003321 | 3300032005 | Bacteria | 7442 |
| 558 | Ga0307411_10045425 | 3300032005 | Bacteria | 2825 |
| 559 | Ga0307411_10053902 | 3300032005 | Bacteria | 2638 |
| 560 | Ga0307411_10161525 | 3300032005 | Bacteria | 1679 |
| 561 | Ga0307415_100016964 | 3300032126 | Bacteria | 4355 |
| 562 | Ga0307415_100028857 | 3300032126 | Bacteria | 3537 |
| 563 | Ga0307415_100045124 | 3300032126 | Bacteria | 2953 |
| 564 | Ga0307415_100046191 | 3300032126 | Bacteria | 2924 |
| 565 | Ga0307415_100091555 | 3300032126 | Bacteria | 2203 |
| 566 | Ga0373939_0066331 | 3300035114 | Bacteria | 1163 |
| 567 | Ga0373941_0059513 | 3300035115 | Bacteria | 1239 |
| 568 | Ga0373961_0036695 | 3300035241 | Bacteria | 1397 |
| 569 | Ga0373933_0089143 | 3300035724 | Bacteria | 1901 |
| 570 | Ga0373947_0108679 | 3300035725 | Bacteria | 1750 |
| 571 | Ga0373937_0021608 | 3300036401 | Bacteria | 5775 |
| 572 | Ga0373937_0101730 | 3300036401 | Bacteria | 2667 |
| 573 | Ga0373925_0093933 | 3300037068 | Bacteria | 2296 |
| 574 | Ga0439453_0001566 | 3300041408 | Bacteria | 2970 |
| 575 | Ga0451853_2880251 | 3300041512 | Bacteria | 1131 |
| 576 | Ga0439431_0008887 | 3300041997 | Bacteria | 2264 |
| 577 | Ga0439433_0006623 | 3300041999 | Bacteria | 2496 |
| 578 | Ga0439433_0015476 | 3300041999 | Bacteria | 1684 |
| 579 | Ga0439450_001103 | 3300042008 | Bacteria | 3832 |
| 580 | Ga0439435_0062187 | 3300042436 | Bacteria | 1090 |
| 581 | Ga0439444_0011487 | 3300042437 | Bacteria | 1435 |
| 582 | Ga0439460_0018118 | 3300042461 | Bacteria | 1893 |
| 583 | Ga0453684_0075558 | 3300044712 | Bacteria | 4234 |
| 584 | Ga0451576_0033144 | 3300045051 | Bacteria | 5491 |
| 585 | Ga0451576_0053960 | 3300045051 | Bacteria | 4208 |
| 586 | Ga0451576_0127060 | 3300045051 | Bacteria | 2657 |
| 587 | Ga0451576_0220695 | 3300045051 | Bacteria | 1979 |
| 588 | Ga0451576_0702350 | 3300045051 | Bacteria | 1063 |
| 589 | Ga0495603_0014148 | 3300046455 | Bacteria | 4828 |
| 590 | Ga0495603_0018601 | 3300046455 | Bacteria | 4204 |
| 591 | Ga0495653_0077286 | 3300046463 | Bacteria | 2472 |
| 592 | Ga0495594_0002079 | 3300046499 | Bacteria | 10426 |
| 593 | Ga0495594_0037031 | 3300046499 | Bacteria | 2662 |
| 594 | Ga0495643_0004655 | 3300046522 | Bacteria | 9528 |
| 595 | Ga0495621_0020840 | 3300046539 | Bacteria | 2155 |
| 596 | Ga0495645_0013681 | 3300046543 | Bacteria | 5748 |
| 597 | Ga0495633_0089624 | 3300046558 | Bacteria | 1430 |
| 598 | Ga0495656_0022751 | 3300046615 | Bacteria | 2459 |
| 599 | Ga0495656_0250342 | 3300046615 | Bacteria | 895 |
| 600 | Ga0495635_0227777 | 3300046663 | Bacteria | 1259 |
| 601 | Ga0495659_0008894 | 3300046664 | Bacteria | 3198 |
| 602 | Ga0495647_0199229 | 3300046681 | Bacteria | 878 |
| 603 | Ga0495658_0146396 | 3300046683 | Bacteria | 1448 |
| 604 | Ga0495613_0133006 | 3300046689 | Bacteria | 1781 |
| 605 | Ga0495670_0067914 | 3300046691 | Bacteria | 1800 |
| 606 | Ga0495600_0107423 | 3300046809 | Bacteria | 1818 |
| 607 | Ga0495600_0158676 | 3300046809 | Bacteria | 1463 |
| 608 | Ga0495674_0209246 | 3300047319 | Bacteria | 1616 |
| 609 | Ga0496102_0047284 | 3300048905 | Bacteria | 3909 |
| 610 | Ga0496104_0007007 | 3300048907 | Bacteria | 9941 |
| 611 | Ga0496105_0012323 | 3300048908 | Bacteria | 6770 |
| 612 | Ga0496107_0162973 | 3300048910 | Bacteria | 1653 |
| 613 | Ga0496108_0010549 | 3300048911 | Bacteria | 7504 |
| 614 | Ga0496109_0021884 | 3300048912 | Bacteria | 5660 |
| 615 | Ga0496109_0026200 | 3300048912 | Bacteria | 5198 |
| 616 | Ga0496109_0058835 | 3300048912 | Bacteria | 3511 |
| 617 | Ga0496109_0113111 | 3300048912 | Bacteria | 2525 |
| 618 | Ga0496109_0329736 | 3300048912 | Bacteria | 1441 |
| 619 | Ga0496110_0000173 | 3300048913 | Bacteria | 39810 |
| 620 | Ga0496110_0067830 | 3300048913 | Bacteria | 3157 |
| 621 | Ga0496110_0285082 | 3300048913 | Bacteria | 1504 |
| 622 | Ga0496111_0041471 | 3300048914 | Bacteria | 3303 |
| 623 | Ga0496112_0003067 | 3300048915 | Bacteria | 13686 |
| 624 | Ga0496112_0085075 | 3300048915 | Bacteria | 3129 |
| 625 | Ga0496112_0182858 | 3300048915 | Bacteria | 2060 |
| 626 | Ga0496112_0189538 | 3300048915 | Bacteria | 2019 |
| 627 | Ga0496113_0036162 | 3300048916 | Bacteria | 3617 |
| 628 | Ga0496113_0343094 | 3300048916 | Bacteria | 1198 |
| 629 | Ga0496113_0435909 | 3300048916 | Bacteria | 1053 |
| 630 | Ga0501036_0068929 | 3300049572 | Bacteria | 2993 |
| 631 | Ga0501039_0020851 | 3300049575 | Bacteria | 5024 |
| 632 | Ga0501039_0046303 | 3300049575 | Bacteria | 3360 |
| 633 | Ga0501040_0017841 | 3300049576 | Bacteria | 4712 |
| 634 | Ga0501040_0127394 | 3300049576 | Bacteria | 1789 |
| 635 | Ga0501041_0013579 | 3300049577 | Bacteria | 4831 |
| 636 | Ga0501041_0023123 | 3300049577 | Bacteria | 3727 |
| 637 | Ga0501042_0003074 | 3300049578 | Bacteria | 10391 |
| 638 | Ga0501042_0018746 | 3300049578 | Bacteria | 4796 |
| 639 | Ga0501042_0037051 | 3300049578 | Bacteria | 3461 |
| 640 | Ga0501048_0058327 | 3300049582 | Bacteria | 2736 |
| 641 | Ga0501048_0151841 | 3300049582 | Bacteria | 1639 |
| 642 | Ga0501048_0243475 | 3300049582 | Bacteria | 1276 |
| 643 | Ga0501048_0330636 | 3300049582 | Bacteria | 1086 |
| 644 | Ga0501067_0043410 | 3300049583 | Bacteria | 2497 |
| 645 | Ga0501068_0190066 | 3300049584 | Bacteria | 1300 |
| 646 | Ga0501071_0008790 | 3300049587 | Bacteria | 6692 |
| 647 | Ga0501071_0103724 | 3300049587 | Bacteria | 2098 |
| 648 | Ga0501071_0237121 | 3300049587 | Bacteria | 1375 |
| 649 | Ga0501071_0305292 | 3300049587 | Bacteria | 1207 |
| 650 | Ga0501072_0006979 | 3300049588 | Bacteria | 8572 |
| 651 | Ga0501072_0097558 | 3300049588 | Bacteria | 2336 |
| 652 | Ga0501072_0157426 | 3300049588 | Bacteria | 1811 |
| 653 | Ga0501073_0100339 | 3300049589 | Bacteria | 2010 |
| 654 | Ga0501074_0056623 | 3300049590 | Bacteria | 2826 |
| 655 | Ga0501075_0035734 | 3300049591 | Bacteria | 3707 |
| 656 | Ga0501075_0282174 | 3300049591 | Bacteria | 1265 |
| 657 | Ga0501076_0028332 | 3300049592 | Bacteria | 4349 |
| 658 | Ga0501076_0148221 | 3300049592 | Bacteria | 1908 |
| 659 | Ga0501076_0335314 | 3300049592 | Bacteria | 1241 |
| 660 | Ga0501077_0189974 | 3300049593 | Bacteria | 1305 |
| 661 | Ga0501079_0288910 | 3300049741 | Bacteria | 1282 |
| 662 | Ga0501079_0407715 | 3300049741 | Bacteria | 1066 |
| 663 | Ga0501080_0018993 | 3300049742 | Bacteria | 6366 |
| 664 | Ga0501080_0062506 | 3300049742 | Bacteria | 3466 |
| 665 | Ga0501080_0466970 | 3300049742 | Bacteria | 1130 |
| 666 | Ga0501080_0478582 | 3300049742 | Bacteria | 1114 |
| 667 | Ga0501081_0026342 | 3300049743 | Bacteria | 3920 |
| 668 | Ga0501081_0067955 | 3300049743 | Bacteria | 2480 |
| 669 | Ga0501081_0093961 | 3300049743 | Bacteria | 2112 |
| 670 | Ga0501081_0144939 | 3300049743 | Bacteria | 1704 |
| 671 | Ga0501081_0468481 | 3300049743 | Bacteria | 937 |
| 672 | Ga0501268_006991 | 3300049765 | Bacteria | 1674 |
| 673 | Ga0501273_001709 | 3300049770 | Bacteria | 2142 |
| 674 | Ga0501035_0422357 | 3300049822 | Bacteria | 1107 |
| 675 | Ga0501045_0028998 | 3300049824 | Bacteria | 3996 |
| 676 | Ga0501045_0068909 | 3300049824 | Bacteria | 2600 |
| 677 | Ga0501045_0119983 | 3300049824 | Bacteria | 1952 |
| 678 | Ga0501045_0194399 | 3300049824 | Bacteria | 1512 |
| 679 | Ga0501045_0194645 | 3300049824 | Bacteria | 1511 |
| 680 | nmdc:mga03683_10291_c1 | 3300050489 | Bacteria | 3352 |
| 681 | nmdc:mga00v17_14777_c1 | 3300050491 | Bacteria | 4367 |
| 682 | nmdc:mga0yw44_12660_c1 | 3300050492 | Bacteria | 4407 |
| 683 | nmdc:mga0k408_15222_c1 | 3300050493 | Bacteria | 4250 |
| 684 | nmdc:mga0k408_20477_c2 | 3300050493 | Bacteria | 1785 |
| 685 | nmdc:mga0k408_38272_c1 | 3300050493 | Bacteria | 2753 |
| 686 | nmdc:mga0k408_58872_c1 | 3300050493 | Bacteria | 1439 |
| 687 | nmdc:mga06z11_4815_c1 | 3300050494 | Bacteria | 5342 |
| 688 | nmdc:mga04h51_26461_c1 | 3300050495 | Bacteria | 1794 |
| 689 | nmdc:mga05p37_1008_c1 | 3300050507 | Bacteria | 32087 |
| 690 | nmdc:mga05p37_194947_c1 | 3300050507 | Bacteria | 2457 |
| 691 | nmdc:mga05p37_202218_c1 | 3300050507 | Bacteria | 2405 |
| 692 | nmdc:mga05p37_2349_c1 | 3300050507 | Bacteria | 22009 |
| 693 | nmdc:mga05p37_237136_c1 | 3300050507 | Bacteria | 2195 |
| 694 | nmdc:mga05p37_316534_c1 | 3300050507 | Bacteria | 1848 |
| 695 | nmdc:mga05p37_404899_c1 | 3300050507 | Bacteria | 1592 |
| 696 | nmdc:mga05p37_43213_c1 | 3300050507 | Bacteria | 5542 |
| 697 | nmdc:mga05p37_49784_c1 | 3300050507 | Bacteria | 5154 |
| 698 | nmdc:mga05p37_6039_c1 | 3300050507 | Bacteria | 14258 |
| 699 | nmdc:mga05p37_91_c1 | 3300050507 | Bacteria | 80826 |
| 700 | nmdc:mga09592_19340_c1 | 3300050508 | Bacteria | 5591 |
| 701 | nmdc:mga09592_20433_c1 | 3300050508 | Bacteria | 5443 |
| 702 | nmdc:mga09592_262703_c1 | 3300050508 | Bacteria | 1497 |
| 703 | nmdc:mga09592_26812_c1 | 3300050508 | Bacteria | 4776 |
| 704 | nmdc:mga09592_313784_c1 | 3300050508 | Bacteria | 1359 |
| 705 | nmdc:mga09592_3165_c1 | 3300050508 | Bacteria | 13371 |
| 706 | nmdc:mga09592_32082_c1 | 3300050508 | Bacteria | 4378 |
| 707 | nmdc:mga09592_3756_c1 | 3300050508 | Bacteria | 12236 |
| 708 | nmdc:mga0qj67_11727_c1 | 3300050509 | Bacteria | 6577 |
| 709 | nmdc:mga0qj67_16962_c1 | 3300050509 | Bacteria | 5531 |
| 710 | nmdc:mga0qj67_173725_c1 | 3300050509 | Bacteria | 1750 |
| 711 | nmdc:mga0qj67_191749_c1 | 3300050509 | Bacteria | 1661 |
| 712 | nmdc:mga0qj67_38426_c1 | 3300050509 | Bacteria | 3755 |
| 713 | nmdc:mga0qj67_45051_c1 | 3300050509 | Bacteria | 3480 |
| 714 | nmdc:mga0qj67_519_c1 | 3300050509 | Bacteria | 26189 |
| 715 | nmdc:mga0qj67_60258_c1 | 3300050509 | Bacteria | 3011 |
| 716 | nmdc:mga0qj67_73799_c1 | 3300050509 | Bacteria | 2725 |
| 717 | nmdc:mga06r32_136349_c1 | 3300050510 | Bacteria | 2429 |
| 718 | nmdc:mga06r32_245509_c1 | 3300050510 | Bacteria | 1778 |
| 719 | nmdc:mga06r32_24748_c1 | 3300050510 | Bacteria | 5578 |
| 720 | nmdc:mga06r32_31316_c1 | 3300050510 | Bacteria | 4995 |
| 721 | nmdc:mga06r32_331844_c1 | 3300050510 | Bacteria | 1506 |
| 722 | nmdc:mga06r32_389053_c1 | 3300050510 | Bacteria | 1377 |
| 723 | nmdc:mga06r32_54708_c1 | 3300050510 | Bacteria | 3827 |
| 724 | nmdc:mga06r32_64818_c1 | 3300050510 | Bacteria | 3523 |
| 725 | nmdc:mga06r32_74004_c1 | 3300050510 | Bacteria | 3301 |
| 726 | nmdc:mga08y16_119762_c1 | 3300050511 | Bacteria | 2740 |
| 727 | nmdc:mga08y16_13098_c1 | 3300050511 | Bacteria | 8725 |
| 728 | nmdc:mga08y16_133933_c1 | 3300050511 | Bacteria | 2575 |
| 729 | nmdc:mga08y16_1590_c1 | 3300050511 | Bacteria | 22933 |
| 730 | nmdc:mga08y16_1706_c1 | 3300050511 | Bacteria | 22281 |
| 731 | nmdc:mga08y16_17564_c1 | 3300050511 | Bacteria | 7535 |
| 732 | nmdc:mga08y16_244821_c1 | 3300050511 | Bacteria | 1853 |
| 733 | nmdc:mga08y16_329670_c1 | 3300050511 | Bacteria | 1570 |
| 734 | nmdc:mga08y16_3324_c1 | 3300050511 | Bacteria | 16650 |
| 735 | nmdc:mga08y16_3636_c1 | 3300050511 | Bacteria | 16020 |
| 736 | nmdc:mga08y16_434210_c1 | 3300050511 | Bacteria | 1341 |
| 737 | nmdc:mga08y16_519993_c1 | 3300050511 | Bacteria | 1207 |
| 738 | nmdc:mga08y16_522_c1 | 3300050511 | Bacteria | 35470 |
| 739 | nmdc:mga08y16_82857_c1 | 3300050511 | Bacteria | 3343 |
| 740 | nmdc:mga0n895_100512_c1 | 3300050512 | Bacteria | 2901 |
| 741 | nmdc:mga0n895_10318_c1 | 3300050512 | Bacteria | 8239 |
| 742 | nmdc:mga0n895_410624_c1 | 3300050512 | Bacteria | 1369 |
| 743 | nmdc:mga0n895_77621_c1 | 3300050512 | Bacteria | 3304 |
| 744 | nmdc:mga0n895_9242_c1 | 3300050512 | Bacteria | 8613 |
| 745 | nmdc:mga0rr50_115742_c1 | 3300050513 | Bacteria | 2128 |
| 746 | nmdc:mga0rr50_197449_c1 | 3300050513 | Bacteria | 1652 |
| 747 | nmdc:mga0rr50_47753_c1 | 3300050513 | Bacteria | 3161 |
| 748 | nmdc:mga0rr50_62952_c1 | 3300050513 | Bacteria | 2800 |
| 749 | nmdc:mga0a205_189780_c1 | 3300050515 | Bacteria | 1948 |
| 750 | nmdc:mga0a205_324650_c1 | 3300050515 | Bacteria | 1410 |
| 751 | nmdc:mga0a205_38800_c1 | 3300050515 | Bacteria | 4583 |
| 752 | nmdc:mga0a205_577_c1 | 3300050515 | Bacteria | 29054 |
| 753 | nmdc:mga0a205_74864_c1 | 3300050515 | Bacteria | 3271 |
| 754 | nmdc:mga0a205_91533_c1 | 3300050515 | Bacteria | 2939 |
| 755 | Ga0495619_0065626 | 3300053085 | Bacteria | 2422 |
| 756 | Ga0495619_0097589 | 3300053085 | Bacteria | 1997 |
| 757 | Ga0500628_006964 | 3300053129 | Bacteria | 1925 |
| 758 | Ga0501084_0114762 | 3300054114 | Bacteria | 2264 |
| 759 | Ga0501084_0174835 | 3300054114 | Bacteria | 1812 |
| 760 | Ga0501084_0306243 | 3300054114 | Bacteria | 1342 |
| 761 | Ga0501084_0400122 | 3300054114 | Bacteria | 1161 |
| 762 | Ga0590071_000111 | 3300059421 | Bacteria | 23043 |
| 763 | Ga0590071_000572 | 3300059421 | Bacteria | 10621 |
| 764 | Ga0590071_041812 | 3300059421 | Bacteria | 1104 |
| 765 | Ga0590074_000303 | 3300059423 | Bacteria | 6759 |
| 766 | Ga0590074_004493 | 3300059423 | Bacteria | 2308 |
| 767 | Ga0590074_013846 | 3300059423 | Bacteria | 1364 |
| 768 | Ga0590075_000114 | 3300059424 | Bacteria | 20697 |
| 769 | Ga0590075_000278 | 3300059424 | Bacteria | 14507 |
| 770 | Ga0590075_000873 | 3300059424 | Bacteria | 7888 |
| 771 | Ga0590077_000095 | 3300059426 | Bacteria | 22912 |
| 772 | Ga0590077_000129 | 3300059426 | Bacteria | 20394 |
| 773 | Ga0590077_002077 | 3300059426 | Bacteria | 4385 |
| 774 | Ga0501082_0212131 | 3300060353 | Bacteria | 1684 |
| 775 | Ga0530510_0021824 | 3300061734 | Bacteria | 4557 |
| 776 | Ga0530510_0025071 | 3300061734 | Bacteria | 4263 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049590 | Ga0501074_0056623 | Ga0501074_0056623_17_802 | 261 |
| 2 | 3300049743 | Ga0501081_0468481 | Ga0501081_0468481_132_917 | 261 |
| 3 | 3300046681 | Ga0495647_0199229 | Ga0495647_0199229_70_864 | 264 |
| 4 | 3300048915 | Ga0496112_0182858 | Ga0496112_0182858_13_846 | 277 |
| 5 | 3300046615 | Ga0495656_0250342 | Ga0495656_0250342_23_865 | 280 |
| 6 | 3300049582 | Ga0501048_0330636 | Ga0501048_0330636_183_1049 | 288 |
| 7 | 3300005614 | Ga0068856_100175684 | Ga0068856_1001756842 | 293 |
| 8 | 3300050493 | nmdc:mga0k408_15222_c1 | nmdc:mga0k408_15222_c1_1418_2311 | 296 |
| 9 | 3300049587 | Ga0501071_0008790 | Ga0501071_0008790_40_954 | 304 |
| 10 | 3300005290 | Ga0065712_10130484 | Ga0065712_101304842 | 305 |
| 11 | 3300009147 | Ga0114129_10312292 | Ga0114129_103122921 | 306 |
| 12 | 3300050510 | nmdc:mga06r32_389053_c1 | nmdc:mga06r32_389053_c1_196_1116 | 306 |
| 13 | 3300005617 | Ga0068859_100297212 | Ga0068859_1002972122 | 307 |
| 14 | 3300006931 | Ga0097620_100297207 | Ga0097620_1002972072 | 307 |
| 15 | 3300025941 | Ga0207711_10061542 | Ga0207711_100615423 | 307 |
| 16 | 3300026121 | Ga0207683_10266143 | Ga0207683_102661432 | 307 |
| 17 | 3300005336 | Ga0070680_100370492 | Ga0070680_1003704921 | 308 |
| 18 | 3300049592 | Ga0501076_0148221 | Ga0501076_0148221_96_1034 | 308 |
| 19 | 3300005353 | Ga0070669_100122469 | Ga0070669_1001224692 | 309 |
| 20 | 3300006237 | Ga0097621_100136293 | Ga0097621_1001362932 | 309 |
| 21 | 3300009094 | Ga0111539_10212449 | Ga0111539_102124491 | 309 |
| 22 | 3300025923 | Ga0207681_10151808 | Ga0207681_101518083 | 309 |
| 23 | 3300031548 | Ga0307408_100077153 | Ga0307408_1000771533 | 309 |
| 24 | 3300041999 | Ga0439433_0015476 | Ga0439433_0015476_163_1107 | 309 |
| 25 | 3300046463 | Ga0495653_0077286 | Ga0495653_0077286_1512_2444 | 309 |
| 26 | 3300050511 | nmdc:mga08y16_434210_c1 | nmdc:mga08y16_434210_c1_162_1094 | 309 |
| 27 | 3300006852 | Ga0075433_10129411 | Ga0075433_101294112 | 310 |
| 28 | 3300035724 | Ga0373933_0089143 | Ga0373933_0089143_890_1825 | 311 |
| 29 | 3300036401 | Ga0373937_0021608 | Ga0373937_0021608_4638_5573 | 311 |
| 30 | 3300047319 | Ga0495674_0209246 | Ga0495674_0209246_234_1169 | 311 |
| 31 | 3300049824 | Ga0501045_0194645 | Ga0501045_0194645_337_1275 | 311 |
| 32 | 3300009147 | Ga0114129_10004740 | Ga0114129_1000474014 | 312 |
| 33 | 3300009177 | Ga0105248_10194501 | Ga0105248_101945012 | 312 |
| 34 | 3300025941 | Ga0207711_10091612 | Ga0207711_100916123 | 312 |
| 35 | 3300005618 | Ga0068864_100218930 | Ga0068864_1002189302 | 313 |
| 36 | 3300036401 | Ga0373937_0101730 | Ga0373937_0101730_1368_2315 | 313 |
| 37 | 3300046543 | Ga0495645_0013681 | Ga0495645_0013681_1806_2753 | 313 |
| 38 | 3300046663 | Ga0495635_0227777 | Ga0495635_0227777_192_1139 | 313 |
| 39 | 3300046683 | Ga0495658_0146396 | Ga0495658_0146396_167_1114 | 313 |
| 40 | 3300046689 | Ga0495613_0133006 | Ga0495613_0133006_322_1269 | 313 |
| 41 | 3300046809 | Ga0495600_0107423 | Ga0495600_0107423_167_1114 | 313 |
| 42 | 3300050515 | nmdc:mga0a205_74864_c1 | nmdc:mga0a205_74864_c1_54_998 | 313 |
| 43 | 3300053085 | Ga0495619_0065626 | Ga0495619_0065626_1292_2239 | 313 |
| 44 | 3300006042 | Ga0075368_10092734 | Ga0075368_100927342 | 314 |
| 45 | 3300006178 | Ga0075367_10006522 | Ga0075367_100065226 | 314 |
| 46 | 3300006195 | Ga0075366_10027436 | Ga0075366_100274363 | 314 |
| 47 | 3300048916 | Ga0496113_0435909 | Ga0496113_0435909_26_973 | 314 |
| 48 | 3300042461 | Ga0439460_0018118 | Ga0439460_0018118_116_1063 | 315 |
| 49 | 3300049582 | Ga0501048_0058327 | Ga0501048_0058327_1083_2030 | 315 |
| 50 | 3300049584 | Ga0501068_0190066 | Ga0501068_0190066_335_1282 | 315 |
| 51 | 3300049742 | Ga0501080_0478582 | Ga0501080_0478582_28_975 | 315 |
| 52 | 3300049743 | Ga0501081_0093961 | Ga0501081_0093961_99_1046 | 315 |
| 53 | 3300005329 | Ga0070683_100016062 | Ga0070683_1000160623 | 316 |
| 54 | 3300005455 | Ga0070663_100403407 | Ga0070663_1004034071 | 316 |
| 55 | 3300005547 | Ga0070693_100081703 | Ga0070693_1000817032 | 316 |
| 56 | 3300006846 | Ga0075430_100093115 | Ga0075430_1000931152 | 316 |
| 57 | 3300006847 | Ga0075431_100014360 | Ga0075431_1000143603 | 316 |
| 58 | 3300009147 | Ga0114129_10009630 | Ga0114129_100096306 | 316 |
| 59 | 3300009147 | Ga0114129_10024852 | Ga0114129_100248523 | 316 |
| 60 | 3300027866 | Ga0209813_10072410 | Ga0209813_100724101 | 316 |
| 61 | 3300035725 | Ga0373947_0108679 | Ga0373947_0108679_422_1372 | 316 |
| 62 | 3300041512 | Ga0451853_2880251 | Ga0451853_2880251_113_1063 | 316 |
| 63 | 3300046809 | Ga0495600_0158676 | Ga0495600_0158676_205_1155 | 316 |
| 64 | 3300048915 | Ga0496112_0189538 | Ga0496112_0189538_938_1891 | 316 |
| 65 | 3300050493 | nmdc:mga0k408_58872_c1 | nmdc:mga0k408_58872_c1_394_1344 | 316 |
| 66 | 3300050507 | nmdc:mga05p37_1008_c1 | nmdc:mga05p37_1008_c1_21204_22154 | 316 |
| 67 | 3300050510 | nmdc:mga06r32_136349_c1 | nmdc:mga06r32_136349_c1_1297_2247 | 316 |
| 68 | 3300059421 | Ga0590071_041812 | Ga0590071_041812_124_1074 | 316 |
| 69 | 3300005290 | Ga0065712_10084064 | Ga0065712_100840643 | 317 |
| 70 | 3300005331 | Ga0070670_100019868 | Ga0070670_1000198682 | 317 |
| 71 | 3300005354 | Ga0070675_100042602 | Ga0070675_1000426023 | 317 |
| 72 | 3300005367 | Ga0070667_100149903 | Ga0070667_1001499033 | 317 |
| 73 | 3300005543 | Ga0070672_100484818 | Ga0070672_1004848181 | 317 |
| 74 | 3300005615 | Ga0070702_100136052 | Ga0070702_1001360522 | 317 |
| 75 | 3300006038 | Ga0075365_10039266 | Ga0075365_100392663 | 317 |
| 76 | 3300006358 | Ga0068871_100204475 | Ga0068871_1002044751 | 317 |
| 77 | 3300006846 | Ga0075430_100027691 | Ga0075430_1000276915 | 317 |
| 78 | 3300006847 | Ga0075431_100157670 | Ga0075431_1001576703 | 317 |
| 79 | 3300009177 | Ga0105248_10314497 | Ga0105248_103144971 | 317 |
| 80 | 3300009177 | Ga0105248_10378264 | Ga0105248_103782641 | 317 |
| 81 | 3300013296 | Ga0157374_10440266 | Ga0157374_104402662 | 317 |
| 82 | 3300013307 | Ga0157372_10078064 | Ga0157372_100780643 | 317 |
| 83 | 3300013308 | Ga0157375_10657291 | Ga0157375_106572911 | 317 |
| 84 | 3300014968 | Ga0157379_10519658 | Ga0157379_105196581 | 317 |
| 85 | 3300025315 | Ga0207697_10003472 | Ga0207697_100034727 | 317 |
| 86 | 3300025925 | Ga0207650_10060762 | Ga0207650_100607623 | 317 |
| 87 | 3300025926 | Ga0207659_10089287 | Ga0207659_100892873 | 317 |
| 88 | 3300025926 | Ga0207659_10137045 | Ga0207659_101370452 | 317 |
| 89 | 3300025937 | Ga0207669_10137316 | Ga0207669_101373163 | 317 |
| 90 | 3300025938 | Ga0207704_10373227 | Ga0207704_103732271 | 317 |
| 91 | 3300025942 | Ga0207689_10106745 | Ga0207689_101067451 | 317 |
| 92 | 3300026121 | Ga0207683_10104562 | Ga0207683_101045623 | 317 |
| 93 | 3300028380 | Ga0268265_10372315 | Ga0268265_103723152 | 317 |
| 94 | 3300031548 | Ga0307408_100053869 | Ga0307408_1000538693 | 317 |
| 95 | 3300031824 | Ga0307413_10125422 | Ga0307413_101254222 | 317 |
| 96 | 3300031852 | Ga0307410_10151072 | Ga0307410_101510722 | 317 |
| 97 | 3300032002 | Ga0307416_100011349 | Ga0307416_1000113494 | 317 |
| 98 | 3300032126 | Ga0307415_100045124 | Ga0307415_1000451243 | 317 |
| 99 | 3300032126 | Ga0307415_100046191 | Ga0307415_1000461912 | 317 |
| 100 | 3300042436 | Ga0439435_0062187 | Ga0439435_0062187_20_976 | 317 |
| 101 | 3300045051 | Ga0451576_0127060 | Ga0451576_0127060_1566_2519 | 317 |
| 102 | 3300048905 | Ga0496102_0047284 | Ga0496102_0047284_851_1804 | 317 |
| 103 | 3300048912 | Ga0496109_0058835 | Ga0496109_0058835_1729_2682 | 317 |
| 104 | 3300048912 | Ga0496109_0113111 | Ga0496109_0113111_1158_2111 | 317 |
| 105 | 3300048913 | Ga0496110_0067830 | Ga0496110_0067830_1921_2874 | 317 |
| 106 | 3300048913 | Ga0496110_0285082 | Ga0496110_0285082_23_976 | 317 |
| 107 | 3300048915 | Ga0496112_0085075 | Ga0496112_0085075_18_971 | 317 |
| 108 | 3300048916 | Ga0496113_0036162 | Ga0496113_0036162_2333_3286 | 317 |
| 109 | 3300049572 | Ga0501036_0068929 | Ga0501036_0068929_533_1489 | 317 |
| 110 | 3300049575 | Ga0501039_0046303 | Ga0501039_0046303_591_1547 | 317 |
| 111 | 3300049576 | Ga0501040_0127394 | Ga0501040_0127394_172_1128 | 317 |
| 112 | 3300049577 | Ga0501041_0023123 | Ga0501041_0023123_1762_2718 | 317 |
| 113 | 3300049578 | Ga0501042_0018746 | Ga0501042_0018746_3526_4482 | 317 |
| 114 | 3300049578 | Ga0501042_0037051 | Ga0501042_0037051_438_1394 | 317 |
| 115 | 3300049587 | Ga0501071_0103724 | Ga0501071_0103724_1008_1964 | 317 |
| 116 | 3300049588 | Ga0501072_0097558 | Ga0501072_0097558_10_966 | 317 |
| 117 | 3300049591 | Ga0501075_0035734 | Ga0501075_0035734_740_1696 | 317 |
| 118 | 3300049591 | Ga0501075_0282174 | Ga0501075_0282174_28_984 | 317 |
| 119 | 3300049592 | Ga0501076_0028332 | Ga0501076_0028332_3281_4237 | 317 |
| 120 | 3300049592 | Ga0501076_0335314 | Ga0501076_0335314_99_1055 | 317 |
| 121 | 3300049742 | Ga0501080_0062506 | Ga0501080_0062506_2378_3334 | 317 |
| 122 | 3300049743 | Ga0501081_0144939 | Ga0501081_0144939_122_1075 | 317 |
| 123 | 3300049824 | Ga0501045_0028998 | Ga0501045_0028998_1004_1960 | 317 |
| 124 | 3300049824 | Ga0501045_0068909 | Ga0501045_0068909_479_1435 | 317 |
| 125 | 3300050492 | nmdc:mga0yw44_12660_c1 | nmdc:mga0yw44_12660_c1_2013_2966 | 317 |
| 126 | 3300050509 | nmdc:mga0qj67_191749_c1 | nmdc:mga0qj67_191749_c1_76_1032 | 317 |
| 127 | 3300050510 | nmdc:mga06r32_54708_c1 | nmdc:mga06r32_54708_c1_1128_2084 | 317 |
| 128 | 3300050510 | nmdc:mga06r32_64818_c1 | nmdc:mga06r32_64818_c1_188_1144 | 317 |
| 129 | 3300050510 | nmdc:mga06r32_74004_c1 | nmdc:mga06r32_74004_c1_2152_3108 | 317 |
| 130 | 3300050511 | nmdc:mga08y16_519993_c1 | nmdc:mga08y16_519993_c1_101_1057 | 317 |
| 131 | 3300053085 | Ga0495619_0097589 | Ga0495619_0097589_666_1622 | 317 |
| 132 | 3300053129 | Ga0500628_006964 | Ga0500628_006964_528_1484 | 317 |
| 133 | 3300054114 | Ga0501084_0174835 | Ga0501084_0174835_663_1619 | 317 |
| 134 | 3300054114 | Ga0501084_0306243 | Ga0501084_0306243_87_1043 | 317 |
| 135 | 3300059421 | Ga0590071_000111 | Ga0590071_000111_7920_8876 | 317 |
| 136 | 3300059423 | Ga0590074_004493 | Ga0590074_004493_801_1757 | 317 |
| 137 | 3300059424 | Ga0590075_000278 | Ga0590075_000278_13483_14439 | 317 |
| 138 | 3300059426 | Ga0590077_000095 | Ga0590077_000095_211_1167 | 317 |
| 139 | 3300061734 | Ga0530510_0021824 | Ga0530510_0021824_1657_2613 | 317 |
| 140 | 3300006038 | Ga0075365_10042337 | Ga0075365_100423372 | 318 |
| 141 | 3300006042 | Ga0075368_10042760 | Ga0075368_100427603 | 318 |
| 142 | 3300006177 | Ga0075362_10003939 | Ga0075362_100039394 | 318 |
| 143 | 3300006178 | Ga0075367_10054158 | Ga0075367_100541583 | 318 |
| 144 | 3300006195 | Ga0075366_10005889 | Ga0075366_100058896 | 318 |
| 145 | 3300006195 | Ga0075366_10026146 | Ga0075366_100261463 | 318 |
| 146 | 3300006844 | Ga0075428_100000439 | Ga0075428_1000004399 | 318 |
| 147 | 3300006844 | Ga0075428_100411845 | Ga0075428_1004118451 | 318 |
| 148 | 3300006846 | Ga0075430_100000107 | Ga0075430_10000010711 | 318 |
| 149 | 3300006846 | Ga0075430_100064303 | Ga0075430_1000643033 | 318 |
| 150 | 3300006847 | Ga0075431_100157785 | Ga0075431_1001577851 | 318 |
| 151 | 3300006847 | Ga0075431_100210498 | Ga0075431_1002104982 | 318 |
| 152 | 3300006847 | Ga0075431_100276559 | Ga0075431_1002765592 | 318 |
| 153 | 3300006852 | Ga0075433_10019190 | Ga0075433_100191901 | 318 |
| 154 | 3300006880 | Ga0075429_100004861 | Ga0075429_1000048617 | 318 |
| 155 | 3300006880 | Ga0075429_100065379 | Ga0075429_1000653793 | 318 |
| 156 | 3300009094 | Ga0111539_10003820 | Ga0111539_1000382015 | 318 |
| 157 | 3300009147 | Ga0114129_10000076 | Ga0114129_1000007647 | 318 |
| 158 | 3300009147 | Ga0114129_10013579 | Ga0114129_1001357911 | 318 |
| 159 | 3300009147 | Ga0114129_10033236 | Ga0114129_100332365 | 318 |
| 160 | 3300025912 | Ga0207707_10200486 | Ga0207707_102004863 | 318 |
| 161 | 3300025913 | Ga0207695_10032358 | Ga0207695_100323584 | 318 |
| 162 | 3300027907 | Ga0207428_10000797 | Ga0207428_1000079717 | 318 |
| 163 | 3300031548 | Ga0307408_100005249 | Ga0307408_1000052493 | 318 |
| 164 | 3300031548 | Ga0307408_100035572 | Ga0307408_1000355722 | 318 |
| 165 | 3300031548 | Ga0307408_100067524 | Ga0307408_1000675241 | 318 |
| 166 | 3300031548 | Ga0307408_100265426 | Ga0307408_1002654261 | 318 |
| 167 | 3300031731 | Ga0307405_10027142 | Ga0307405_100271423 | 318 |
| 168 | 3300031824 | Ga0307413_10113587 | Ga0307413_101135873 | 318 |
| 169 | 3300031852 | Ga0307410_10011774 | Ga0307410_100117742 | 318 |
| 170 | 3300031852 | Ga0307410_10330013 | Ga0307410_103300131 | 318 |
| 171 | 3300031903 | Ga0307407_10011965 | Ga0307407_100119652 | 318 |
| 172 | 3300031911 | Ga0307412_10198103 | Ga0307412_101981031 | 318 |
| 173 | 3300031995 | Ga0307409_100030573 | Ga0307409_1000305732 | 318 |
| 174 | 3300032002 | Ga0307416_100027563 | Ga0307416_1000275632 | 318 |
| 175 | 3300032002 | Ga0307416_100160896 | Ga0307416_1001608963 | 318 |
| 176 | 3300032002 | Ga0307416_100441539 | Ga0307416_1004415392 | 318 |
| 177 | 3300032002 | Ga0307416_100471192 | Ga0307416_1004711921 | 318 |
| 178 | 3300032005 | Ga0307411_10045425 | Ga0307411_100454253 | 318 |
| 179 | 3300032126 | Ga0307415_100028857 | Ga0307415_1000288573 | 318 |
| 180 | 3300032126 | Ga0307415_100091555 | Ga0307415_1000915552 | 318 |
| 181 | 3300037068 | Ga0373925_0093933 | Ga0373925_0093933_432_1391 | 318 |
| 182 | 3300042008 | Ga0439450_001103 | Ga0439450_001103_306_1265 | 318 |
| 183 | 3300049582 | Ga0501048_0151841 | Ga0501048_0151841_235_1194 | 318 |
| 184 | 3300049770 | Ga0501273_001709 | Ga0501273_001709_1153_2109 | 318 |
| 185 | 3300050489 | nmdc:mga03683_10291_c1 | nmdc:mga03683_10291_c1_509_1468 | 318 |
| 186 | 3300050491 | nmdc:mga00v17_14777_c1 | nmdc:mga00v17_14777_c1_1969_2928 | 318 |
| 187 | 3300050493 | nmdc:mga0k408_20477_c2 | nmdc:mga0k408_20477_c2_47_1006 | 318 |
| 188 | 3300050493 | nmdc:mga0k408_38272_c1 | nmdc:mga0k408_38272_c1_1152_2111 | 318 |
| 189 | 3300050494 | nmdc:mga06z11_4815_c1 | nmdc:mga06z11_4815_c1_4127_5107 | 318 |
| 190 | 3300050495 | nmdc:mga04h51_26461_c1 | nmdc:mga04h51_26461_c1_95_1075 | 318 |
| 191 | 3300050507 | nmdc:mga05p37_194947_c1 | nmdc:mga05p37_194947_c1_57_1016 | 318 |
| 192 | 3300050507 | nmdc:mga05p37_49784_c1 | nmdc:mga05p37_49784_c1_2302_3261 | 318 |
| 193 | 3300050507 | nmdc:mga05p37_91_c1 | nmdc:mga05p37_91_c1_52354_53313 | 318 |
| 194 | 3300050508 | nmdc:mga09592_20433_c1 | nmdc:mga09592_20433_c1_361_1320 | 318 |
| 195 | 3300050508 | nmdc:mga09592_3165_c1 | nmdc:mga09592_3165_c1_7844_8803 | 318 |
| 196 | 3300050509 | nmdc:mga0qj67_519_c1 | nmdc:mga0qj67_519_c1_19118_20077 | 318 |
| 197 | 3300050511 | nmdc:mga08y16_1590_c1 | nmdc:mga08y16_1590_c1_4089_5048 | 318 |
| 198 | 3300005293 | Ga0065715_10035970 | Ga0065715_100359701 | 319 |
| 199 | 3300005564 | Ga0070664_100512773 | Ga0070664_1005127731 | 319 |
| 200 | 3300005618 | Ga0068864_100264108 | Ga0068864_1002641082 | 319 |
| 201 | 3300005981 | Ga0081538_10064337 | Ga0081538_100643373 | 319 |
| 202 | 3300009147 | Ga0114129_10755950 | Ga0114129_107559502 | 319 |
| 203 | 3300009177 | Ga0105248_10042462 | Ga0105248_100424621 | 319 |
| 204 | 3300025945 | Ga0207679_10458307 | Ga0207679_104583071 | 319 |
| 205 | 3300032002 | Ga0307416_100157619 | Ga0307416_1001576192 | 319 |
| 206 | 3300049741 | Ga0501079_0407715 | Ga0501079_0407715_43_1002 | 319 |
| 207 | 3300050511 | nmdc:mga08y16_329670_c1 | nmdc:mga08y16_329670_c1_499_1458 | 319 |
| 208 | 3300059421 | Ga0590071_000572 | Ga0590071_000572_5510_6481 | 319 |
| 209 | 3300059423 | Ga0590074_000303 | Ga0590074_000303_3793_4764 | 319 |
| 210 | 3300059423 | Ga0590074_013846 | Ga0590074_013846_201_1160 | 319 |
| 211 | 3300059424 | Ga0590075_000114 | Ga0590075_000114_13470_14441 | 319 |
| 212 | 3300059424 | Ga0590075_000873 | Ga0590075_000873_5339_6298 | 319 |
| 213 | 3300059426 | Ga0590077_000129 | Ga0590077_000129_11710_12669 | 319 |
| 214 | 3300059426 | Ga0590077_002077 | Ga0590077_002077_3055_4026 | 319 |
| 215 | 3300005290 | Ga0065712_10092356 | Ga0065712_100923563 | 320 |
| 216 | 3300005328 | Ga0070676_10214393 | Ga0070676_102143932 | 320 |
| 217 | 3300005330 | Ga0070690_100038525 | Ga0070690_1000385253 | 320 |
| 218 | 3300005331 | Ga0070670_100001472 | Ga0070670_1000014727 | 320 |
| 219 | 3300005331 | Ga0070670_100070492 | Ga0070670_1000704922 | 320 |
| 220 | 3300005334 | Ga0068869_100118017 | Ga0068869_1001180172 | 320 |
| 221 | 3300005334 | Ga0068869_100184748 | Ga0068869_1001847481 | 320 |
| 222 | 3300005340 | Ga0070689_100025190 | Ga0070689_1000251905 | 320 |
| 223 | 3300005340 | Ga0070689_100045884 | Ga0070689_1000458842 | 320 |
| 224 | 3300005343 | Ga0070687_100045461 | Ga0070687_1000454612 | 320 |
| 225 | 3300005353 | Ga0070669_100102117 | Ga0070669_1001021172 | 320 |
| 226 | 3300005354 | Ga0070675_100001179 | Ga0070675_1000011795 | 320 |
| 227 | 3300005355 | Ga0070671_100167583 | Ga0070671_1001675833 | 320 |
| 228 | 3300005356 | Ga0070674_100017253 | Ga0070674_1000172532 | 320 |
| 229 | 3300005364 | Ga0070673_100002948 | Ga0070673_1000029488 | 320 |
| 230 | 3300005365 | Ga0070688_100138948 | Ga0070688_1001389483 | 320 |
| 231 | 3300005406 | Ga0070703_10020979 | Ga0070703_100209792 | 320 |
| 232 | 3300005438 | Ga0070701_10022675 | Ga0070701_100226753 | 320 |
| 233 | 3300005441 | Ga0070700_100013263 | Ga0070700_1000132632 | 320 |
| 234 | 3300005445 | Ga0070708_100194395 | Ga0070708_1001943951 | 320 |
| 235 | 3300005459 | Ga0068867_100048676 | Ga0068867_1000486763 | 320 |
| 236 | 3300005543 | Ga0070672_100006792 | Ga0070672_1000067923 | 320 |
| 237 | 3300005545 | Ga0070695_100065489 | Ga0070695_1000654893 | 320 |
| 238 | 3300005547 | Ga0070693_100036407 | Ga0070693_1000364073 | 320 |
| 239 | 3300005549 | Ga0070704_100059701 | Ga0070704_1000597013 | 320 |
| 240 | 3300005564 | Ga0070664_100043148 | Ga0070664_1000431484 | 320 |
| 241 | 3300005564 | Ga0070664_100177679 | Ga0070664_1001776792 | 320 |
| 242 | 3300005578 | Ga0068854_100002999 | Ga0068854_1000029995 | 320 |
| 243 | 3300005618 | Ga0068864_100005332 | Ga0068864_1000053323 | 320 |
| 244 | 3300005841 | Ga0068863_100473802 | Ga0068863_1004738022 | 320 |
| 245 | 3300005843 | Ga0068860_100080168 | Ga0068860_1000801682 | 320 |
| 246 | 3300005844 | Ga0068862_100039327 | Ga0068862_1000393272 | 320 |
| 247 | 3300006844 | Ga0075428_100035169 | Ga0075428_1000351693 | 320 |
| 248 | 3300006844 | Ga0075428_100200251 | Ga0075428_1002002513 | 320 |
| 249 | 3300006846 | Ga0075430_100001499 | Ga0075430_1000014994 | 320 |
| 250 | 3300006846 | Ga0075430_100017890 | Ga0075430_1000178906 | 320 |
| 251 | 3300006847 | Ga0075431_100005881 | Ga0075431_10000588110 | 320 |
| 252 | 3300006852 | Ga0075433_10002058 | Ga0075433_100020585 | 320 |
| 253 | 3300006852 | Ga0075433_10023220 | Ga0075433_100232204 | 320 |
| 254 | 3300006871 | Ga0075434_100002389 | Ga0075434_1000023898 | 320 |
| 255 | 3300006871 | Ga0075434_100007789 | Ga0075434_10000778911 | 320 |
| 256 | 3300006871 | Ga0075434_100066673 | Ga0075434_1000666733 | 320 |
| 257 | 3300007076 | Ga0075435_100062458 | Ga0075435_1000624584 | 320 |
| 258 | 3300007076 | Ga0075435_100322856 | Ga0075435_1003228561 | 320 |
| 259 | 3300009094 | Ga0111539_10001128 | Ga0111539_1000112823 | 320 |
| 260 | 3300009098 | Ga0105245_10017804 | Ga0105245_100178044 | 320 |
| 261 | 3300009147 | Ga0114129_10007774 | Ga0114129_100077743 | 320 |
| 262 | 3300009147 | Ga0114129_10038106 | Ga0114129_100381065 | 320 |
| 263 | 3300009148 | Ga0105243_10119671 | Ga0105243_101196711 | 320 |
| 264 | 3300009174 | Ga0105241_10165763 | Ga0105241_101657631 | 320 |
| 265 | 3300009176 | Ga0105242_10249531 | Ga0105242_102495312 | 320 |
| 266 | 3300010375 | Ga0105239_10099330 | Ga0105239_100993303 | 320 |
| 267 | 3300025907 | Ga0207645_10137273 | Ga0207645_101372732 | 320 |
| 268 | 3300025918 | Ga0207662_10009162 | Ga0207662_100091622 | 320 |
| 269 | 3300025925 | Ga0207650_10011126 | Ga0207650_100111264 | 320 |
| 270 | 3300025925 | Ga0207650_10091165 | Ga0207650_100911653 | 320 |
| 271 | 3300025926 | Ga0207659_10189204 | Ga0207659_101892041 | 320 |
| 272 | 3300025933 | Ga0207706_10071856 | Ga0207706_100718563 | 320 |
| 273 | 3300025934 | Ga0207686_10012255 | Ga0207686_100122553 | 320 |
| 274 | 3300025935 | Ga0207709_10025886 | Ga0207709_100258862 | 320 |
| 275 | 3300025937 | Ga0207669_10166218 | Ga0207669_101662182 | 320 |
| 276 | 3300025940 | Ga0207691_10004842 | Ga0207691_100048425 | 320 |
| 277 | 3300025941 | Ga0207711_10060750 | Ga0207711_100607502 | 320 |
| 278 | 3300025942 | Ga0207689_10058190 | Ga0207689_100581903 | 320 |
| 279 | 3300025942 | Ga0207689_10139896 | Ga0207689_101398963 | 320 |
| 280 | 3300026075 | Ga0207708_10024546 | Ga0207708_100245462 | 320 |
| 281 | 3300026089 | Ga0207648_10025141 | Ga0207648_100251412 | 320 |
| 282 | 3300026095 | Ga0207676_10062615 | Ga0207676_100626153 | 320 |
| 283 | 3300026121 | Ga0207683_10151620 | Ga0207683_101516203 | 320 |
| 284 | 3300027907 | Ga0207428_10001419 | Ga0207428_1000141918 | 320 |
| 285 | 3300028381 | Ga0268264_10031761 | Ga0268264_100317613 | 320 |
| 286 | 3300032005 | Ga0307411_10161525 | Ga0307411_101615251 | 320 |
| 287 | 3300042437 | Ga0439444_0011487 | Ga0439444_0011487_141_1103 | 320 |
| 288 | 3300044712 | Ga0453684_0075558 | Ga0453684_0075558_1694_2659 | 320 |
| 289 | 3300048910 | Ga0496107_0162973 | Ga0496107_0162973_260_1225 | 320 |
| 290 | 3300048912 | Ga0496109_0329736 | Ga0496109_0329736_421_1383 | 320 |
| 291 | 3300049582 | Ga0501048_0243475 | Ga0501048_0243475_122_1084 | 320 |
| 292 | 3300049583 | Ga0501067_0043410 | Ga0501067_0043410_911_1876 | 320 |
| 293 | 3300049587 | Ga0501071_0237121 | Ga0501071_0237121_23_985 | 320 |
| 294 | 3300049588 | Ga0501072_0006979 | Ga0501072_0006979_155_1117 | 320 |
| 295 | 3300049593 | Ga0501077_0189974 | Ga0501077_0189974_277_1239 | 320 |
| 296 | 3300049741 | Ga0501079_0288910 | Ga0501079_0288910_217_1179 | 320 |
| 297 | 3300049742 | Ga0501080_0018993 | Ga0501080_0018993_917_1882 | 320 |
| 298 | 3300049743 | Ga0501081_0026342 | Ga0501081_0026342_2257_3219 | 320 |
| 299 | 3300049765 | Ga0501268_006991 | Ga0501268_006991_83_1045 | 320 |
| 300 | 3300049822 | Ga0501035_0422357 | Ga0501035_0422357_92_1054 | 320 |
| 301 | 3300049824 | Ga0501045_0119983 | Ga0501045_0119983_783_1745 | 320 |
| 302 | 3300050507 | nmdc:mga05p37_6039_c1 | nmdc:mga05p37_6039_c1_1442_2407 | 320 |
| 303 | 3300050508 | nmdc:mga09592_313784_c1 | nmdc:mga09592_313784_c1_183_1145 | 320 |
| 304 | 3300050509 | nmdc:mga0qj67_45051_c1 | nmdc:mga0qj67_45051_c1_443_1405 | 320 |
| 305 | 3300050510 | nmdc:mga06r32_31316_c1 | nmdc:mga06r32_31316_c1_1352_2314 | 320 |
| 306 | 3300050511 | nmdc:mga08y16_1706_c1 | nmdc:mga08y16_1706_c1_11135_12097 | 320 |
| 307 | 3300050512 | nmdc:mga0n895_9242_c1 | nmdc:mga0n895_9242_c1_4925_5887 | 320 |
| 308 | 3300050513 | nmdc:mga0rr50_47753_c1 | nmdc:mga0rr50_47753_c1_534_1496 | 320 |
| 309 | 3300050513 | nmdc:mga0rr50_62952_c1 | nmdc:mga0rr50_62952_c1_1386_2351 | 320 |
| 310 | 3300050515 | nmdc:mga0a205_189780_c1 | nmdc:mga0a205_189780_c1_662_1624 | 320 |
| 311 | 3300050515 | nmdc:mga0a205_577_c1 | nmdc:mga0a205_577_c1_14391_15353 | 320 |
| 312 | 3300061734 | Ga0530510_0025071 | Ga0530510_0025071_2067_3029 | 320 |
| 313 | 3300005290 | Ga0065712_10068502 | Ga0065712_100685023 | 321 |
| 314 | 3300005293 | Ga0065715_10096489 | Ga0065715_100964893 | 321 |
| 315 | 3300005329 | Ga0070683_100013764 | Ga0070683_1000137645 | 321 |
| 316 | 3300005331 | Ga0070670_100035298 | Ga0070670_1000352984 | 321 |
| 317 | 3300005344 | Ga0070661_100057423 | Ga0070661_1000574232 | 321 |
| 318 | 3300005353 | Ga0070669_100001008 | Ga0070669_1000010084 | 321 |
| 319 | 3300005354 | Ga0070675_100032873 | Ga0070675_1000328734 | 321 |
| 320 | 3300005354 | Ga0070675_100253754 | Ga0070675_1002537541 | 321 |
| 321 | 3300005355 | Ga0070671_100459694 | Ga0070671_1004596941 | 321 |
| 322 | 3300005364 | Ga0070673_100016632 | Ga0070673_1000166326 | 321 |
| 323 | 3300005367 | Ga0070667_100138715 | Ga0070667_1001387151 | 321 |
| 324 | 3300005438 | Ga0070701_10069828 | Ga0070701_100698283 | 321 |
| 325 | 3300005455 | Ga0070663_100029234 | Ga0070663_1000292342 | 321 |
| 326 | 3300005456 | Ga0070678_100038752 | Ga0070678_1000387524 | 321 |
| 327 | 3300005456 | Ga0070678_100434272 | Ga0070678_1004342721 | 321 |
| 328 | 3300005457 | Ga0070662_100237636 | Ga0070662_1002376361 | 321 |
| 329 | 3300005535 | Ga0070684_100000069 | Ga0070684_10000006938 | 321 |
| 330 | 3300005543 | Ga0070672_100252510 | Ga0070672_1002525101 | 321 |
| 331 | 3300005564 | Ga0070664_100029842 | Ga0070664_1000298422 | 321 |
| 332 | 3300005577 | Ga0068857_100028553 | Ga0068857_1000285534 | 321 |
| 333 | 3300005617 | Ga0068859_100188619 | Ga0068859_1001886193 | 321 |
| 334 | 3300005841 | Ga0068863_100154643 | Ga0068863_1001546433 | 321 |
| 335 | 3300005844 | Ga0068862_100058781 | Ga0068862_1000587814 | 321 |
| 336 | 3300006237 | Ga0097621_100346097 | Ga0097621_1003460971 | 321 |
| 337 | 3300006844 | Ga0075428_100013447 | Ga0075428_1000134478 | 321 |
| 338 | 3300006880 | Ga0075429_100102932 | Ga0075429_1001029321 | 321 |
| 339 | 3300006881 | Ga0068865_100014782 | Ga0068865_1000147822 | 321 |
| 340 | 3300006881 | Ga0068865_100239219 | Ga0068865_1002392191 | 321 |
| 341 | 3300006931 | Ga0097620_100188616 | Ga0097620_1001886163 | 321 |
| 342 | 3300009094 | Ga0111539_10000065 | Ga0111539_1000006566 | 321 |
| 343 | 3300009094 | Ga0111539_10010818 | Ga0111539_100108187 | 321 |
| 344 | 3300009147 | Ga0114129_10000476 | Ga0114129_100004762 | 321 |
| 345 | 3300009147 | Ga0114129_10111384 | Ga0114129_101113844 | 321 |
| 346 | 3300011119 | Ga0105246_10419471 | Ga0105246_104194711 | 321 |
| 347 | 3300013296 | Ga0157374_10257857 | Ga0157374_102578571 | 321 |
| 348 | 3300014325 | Ga0163163_10008937 | Ga0163163_100089375 | 321 |
| 349 | 3300014968 | Ga0157379_10219446 | Ga0157379_102194461 | 321 |
| 350 | 3300025321 | Ga0207656_10043530 | Ga0207656_100435302 | 321 |
| 351 | 3300025925 | Ga0207650_10021754 | Ga0207650_100217544 | 321 |
| 352 | 3300025926 | Ga0207659_10134758 | Ga0207659_101347583 | 321 |
| 353 | 3300025933 | Ga0207706_10238746 | Ga0207706_102387462 | 321 |
| 354 | 3300025961 | Ga0207712_10029660 | Ga0207712_100296603 | 321 |
| 355 | 3300026067 | Ga0207678_10128323 | Ga0207678_101283233 | 321 |
| 356 | 3300026088 | Ga0207641_10135896 | Ga0207641_101358962 | 321 |
| 357 | 3300026116 | Ga0207674_10039518 | Ga0207674_100395184 | 321 |
| 358 | 3300026118 | Ga0207675_100384152 | Ga0207675_1003841522 | 321 |
| 359 | 3300026121 | Ga0207683_10029838 | Ga0207683_100298385 | 321 |
| 360 | 3300026121 | Ga0207683_10466440 | Ga0207683_104664402 | 321 |
| 361 | 3300027907 | Ga0207428_10000936 | Ga0207428_1000093613 | 321 |
| 362 | 3300027907 | Ga0207428_10056404 | Ga0207428_100564043 | 321 |
| 363 | 3300028380 | Ga0268265_10253096 | Ga0268265_102530961 | 321 |
| 364 | 3300031995 | Ga0307409_100318872 | Ga0307409_1003188722 | 321 |
| 365 | 3300032002 | Ga0307416_100305580 | Ga0307416_1003055802 | 321 |
| 366 | 3300041997 | Ga0439431_0008887 | Ga0439431_0008887_936_1913 | 321 |
| 367 | 3300041999 | Ga0439433_0006623 | Ga0439433_0006623_1042_2019 | 321 |
| 368 | 3300046455 | Ga0495603_0014148 | Ga0495603_0014148_2053_3018 | 321 |
| 369 | 3300046499 | Ga0495594_0037031 | Ga0495594_0037031_115_1080 | 321 |
| 370 | 3300046522 | Ga0495643_0004655 | Ga0495643_0004655_3840_4814 | 321 |
| 371 | 3300048907 | Ga0496104_0007007 | Ga0496104_0007007_7831_8799 | 321 |
| 372 | 3300048908 | Ga0496105_0012323 | Ga0496105_0012323_5395_6363 | 321 |
| 373 | 3300048911 | Ga0496108_0010549 | Ga0496108_0010549_4679_5647 | 321 |
| 374 | 3300048912 | Ga0496109_0026200 | Ga0496109_0026200_2048_3016 | 321 |
| 375 | 3300048913 | Ga0496110_0000173 | Ga0496110_0000173_12530_13498 | 321 |
| 376 | 3300048914 | Ga0496111_0041471 | Ga0496111_0041471_2237_3205 | 321 |
| 377 | 3300048915 | Ga0496112_0003067 | Ga0496112_0003067_10617_11585 | 321 |
| 378 | 3300050507 | nmdc:mga05p37_202218_c1 | nmdc:mga05p37_202218_c1_1350_2315 | 321 |
| 379 | 3300050510 | nmdc:mga06r32_331844_c1 | nmdc:mga06r32_331844_c1_489_1457 | 321 |
| 380 | 3300050511 | nmdc:mga08y16_119762_c1 | nmdc:mga08y16_119762_c1_1566_2534 | 321 |
| 381 | 3300050511 | nmdc:mga08y16_3636_c1 | nmdc:mga08y16_3636_c1_3226_4203 | 321 |
| 382 | 3300005290 | Ga0065712_10004141 | Ga0065712_100041415 | 322 |
| 383 | 3300005328 | Ga0070676_10010170 | Ga0070676_100101706 | 322 |
| 384 | 3300005328 | Ga0070676_10024363 | Ga0070676_100243634 | 322 |
| 385 | 3300005330 | Ga0070690_100011832 | Ga0070690_1000118322 | 322 |
| 386 | 3300005331 | Ga0070670_100011715 | Ga0070670_1000117153 | 322 |
| 387 | 3300005331 | Ga0070670_100051665 | Ga0070670_1000516653 | 322 |
| 388 | 3300005333 | Ga0070677_10079765 | Ga0070677_100797652 | 322 |
| 389 | 3300005334 | Ga0068869_100001451 | Ga0068869_1000014515 | 322 |
| 390 | 3300005334 | Ga0068869_100009316 | Ga0068869_1000093165 | 322 |
| 391 | 3300005334 | Ga0068869_100018614 | Ga0068869_1000186143 | 322 |
| 392 | 3300005335 | Ga0070666_10014202 | Ga0070666_100142025 | 322 |
| 393 | 3300005335 | Ga0070666_10045698 | Ga0070666_100456983 | 322 |
| 394 | 3300005338 | Ga0068868_100011007 | Ga0068868_1000110077 | 322 |
| 395 | 3300005340 | Ga0070689_100270590 | Ga0070689_1002705901 | 322 |
| 396 | 3300005345 | Ga0070692_10067771 | Ga0070692_100677713 | 322 |
| 397 | 3300005353 | Ga0070669_100005330 | Ga0070669_1000053308 | 322 |
| 398 | 3300005353 | Ga0070669_100113179 | Ga0070669_1001131793 | 322 |
| 399 | 3300005354 | Ga0070675_100021012 | Ga0070675_1000210125 | 322 |
| 400 | 3300005354 | Ga0070675_100230552 | Ga0070675_1002305523 | 322 |
| 401 | 3300005354 | Ga0070675_100361768 | Ga0070675_1003617682 | 322 |
| 402 | 3300005355 | Ga0070671_100091343 | Ga0070671_1000913433 | 322 |
| 403 | 3300005356 | Ga0070674_100010787 | Ga0070674_1000107874 | 322 |
| 404 | 3300005364 | Ga0070673_100031521 | Ga0070673_1000315211 | 322 |
| 405 | 3300005364 | Ga0070673_100044100 | Ga0070673_1000441003 | 322 |
| 406 | 3300005365 | Ga0070688_100060756 | Ga0070688_1000607563 | 322 |
| 407 | 3300005367 | Ga0070667_100025919 | Ga0070667_1000259193 | 322 |
| 408 | 3300005367 | Ga0070667_100211711 | Ga0070667_1002117113 | 322 |
| 409 | 3300005367 | Ga0070667_100351882 | Ga0070667_1003518821 | 322 |
| 410 | 3300005438 | Ga0070701_10026649 | Ga0070701_100266494 | 322 |
| 411 | 3300005438 | Ga0070701_10029415 | Ga0070701_100294153 | 322 |
| 412 | 3300005441 | Ga0070700_100052389 | Ga0070700_1000523893 | 322 |
| 413 | 3300005441 | Ga0070700_100092432 | Ga0070700_1000924322 | 322 |
| 414 | 3300005457 | Ga0070662_100027875 | Ga0070662_1000278752 | 322 |
| 415 | 3300005459 | Ga0068867_100002915 | Ga0068867_1000029159 | 322 |
| 416 | 3300005459 | Ga0068867_100015432 | Ga0068867_1000154323 | 322 |
| 417 | 3300005466 | Ga0070685_10006838 | Ga0070685_100068387 | 322 |
| 418 | 3300005466 | Ga0070685_10100115 | Ga0070685_101001152 | 322 |
| 419 | 3300005543 | Ga0070672_100022174 | Ga0070672_1000221742 | 322 |
| 420 | 3300005543 | Ga0070672_100029469 | Ga0070672_1000294693 | 322 |
| 421 | 3300005548 | Ga0070665_100060629 | Ga0070665_1000606294 | 322 |
| 422 | 3300005617 | Ga0068859_100010866 | Ga0068859_1000108664 | 322 |
| 423 | 3300005617 | Ga0068859_100039203 | Ga0068859_1000392033 | 322 |
| 424 | 3300005617 | Ga0068859_100239583 | Ga0068859_1002395833 | 322 |
| 425 | 3300005618 | Ga0068864_100007453 | Ga0068864_1000074533 | 322 |
| 426 | 3300005718 | Ga0068866_10007464 | Ga0068866_100074643 | 322 |
| 427 | 3300005719 | Ga0068861_100011620 | Ga0068861_1000116207 | 322 |
| 428 | 3300005719 | Ga0068861_100080622 | Ga0068861_1000806223 | 322 |
| 429 | 3300005840 | Ga0068870_10000269 | Ga0068870_100002699 | 322 |
| 430 | 3300005841 | Ga0068863_100006562 | Ga0068863_1000065628 | 322 |
| 431 | 3300005841 | Ga0068863_100481960 | Ga0068863_1004819602 | 322 |
| 432 | 3300005844 | Ga0068862_100000662 | Ga0068862_1000006624 | 322 |
| 433 | 3300006237 | Ga0097621_100156079 | Ga0097621_1001560793 | 322 |
| 434 | 3300006844 | Ga0075428_100014410 | Ga0075428_1000144106 | 322 |
| 435 | 3300006844 | Ga0075428_100024526 | Ga0075428_1000245262 | 322 |
| 436 | 3300006846 | Ga0075430_100016781 | Ga0075430_1000167816 | 322 |
| 437 | 3300006847 | Ga0075431_100000506 | Ga0075431_10000050625 | 322 |
| 438 | 3300006847 | Ga0075431_100153812 | Ga0075431_1001538123 | 322 |
| 439 | 3300006852 | Ga0075433_10000466 | Ga0075433_1000046626 | 322 |
| 440 | 3300006852 | Ga0075433_10260049 | Ga0075433_102600492 | 322 |
| 441 | 3300006871 | Ga0075434_100008078 | Ga0075434_1000080789 | 322 |
| 442 | 3300006871 | Ga0075434_100113047 | Ga0075434_1001130473 | 322 |
| 443 | 3300006880 | Ga0075429_100004353 | Ga0075429_1000043534 | 322 |
| 444 | 3300006881 | Ga0068865_100035023 | Ga0068865_1000350233 | 322 |
| 445 | 3300006931 | Ga0097620_100010866 | Ga0097620_1000108664 | 322 |
| 446 | 3300006931 | Ga0097620_100039202 | Ga0097620_1000392024 | 322 |
| 447 | 3300006931 | Ga0097620_100239573 | Ga0097620_1002395731 | 322 |
| 448 | 3300007076 | Ga0075435_100225688 | Ga0075435_1002256882 | 322 |
| 449 | 3300009094 | Ga0111539_10003505 | Ga0111539_1000350516 | 322 |
| 450 | 3300009094 | Ga0111539_10224771 | Ga0111539_102247712 | 322 |
| 451 | 3300009147 | Ga0114129_10230902 | Ga0114129_102309023 | 322 |
| 452 | 3300009148 | Ga0105243_10011752 | Ga0105243_100117522 | 322 |
| 453 | 3300009177 | Ga0105248_10053293 | Ga0105248_100532935 | 322 |
| 454 | 3300009553 | Ga0105249_10001042 | Ga0105249_100010424 | 322 |
| 455 | 3300011119 | Ga0105246_10079894 | Ga0105246_100798943 | 322 |
| 456 | 3300013296 | Ga0157374_10111515 | Ga0157374_101115153 | 322 |
| 457 | 3300014325 | Ga0163163_10017509 | Ga0163163_100175093 | 322 |
| 458 | 3300014326 | Ga0157380_10004723 | Ga0157380_1000472310 | 322 |
| 459 | 3300014326 | Ga0157380_10050857 | Ga0157380_100508572 | 322 |
| 460 | 3300014745 | Ga0157377_10021608 | Ga0157377_100216083 | 322 |
| 461 | 3300017792 | Ga0163161_10002282 | Ga0163161_1000228210 | 322 |
| 462 | 3300017792 | Ga0163161_10121374 | Ga0163161_101213742 | 322 |
| 463 | 3300025315 | Ga0207697_10000085 | Ga0207697_1000008527 | 322 |
| 464 | 3300025893 | Ga0207682_10000133 | Ga0207682_1000013335 | 322 |
| 465 | 3300025893 | Ga0207682_10006805 | Ga0207682_100068055 | 322 |
| 466 | 3300025893 | Ga0207682_10009032 | Ga0207682_100090324 | 322 |
| 467 | 3300025899 | Ga0207642_10007752 | Ga0207642_100077523 | 322 |
| 468 | 3300025901 | Ga0207688_10000477 | Ga0207688_100004778 | 322 |
| 469 | 3300025903 | Ga0207680_10102491 | Ga0207680_101024912 | 322 |
| 470 | 3300025907 | Ga0207645_10001684 | Ga0207645_100016849 | 322 |
| 471 | 3300025907 | Ga0207645_10027536 | Ga0207645_100275363 | 322 |
| 472 | 3300025907 | Ga0207645_10028344 | Ga0207645_100283444 | 322 |
| 473 | 3300025908 | Ga0207643_10000665 | Ga0207643_100006653 | 322 |
| 474 | 3300025918 | Ga0207662_10002216 | Ga0207662_100022168 | 322 |
| 475 | 3300025923 | Ga0207681_10009866 | Ga0207681_100098664 | 322 |
| 476 | 3300025923 | Ga0207681_10024146 | Ga0207681_100241464 | 322 |
| 477 | 3300025923 | Ga0207681_10271051 | Ga0207681_102710512 | 322 |
| 478 | 3300025925 | Ga0207650_10015265 | Ga0207650_100152652 | 322 |
| 479 | 3300025926 | Ga0207659_10055621 | Ga0207659_100556213 | 322 |
| 480 | 3300025931 | Ga0207644_10068482 | Ga0207644_100684823 | 322 |
| 481 | 3300025932 | Ga0207690_10122424 | Ga0207690_101224242 | 322 |
| 482 | 3300025933 | Ga0207706_10003174 | Ga0207706_100031747 | 322 |
| 483 | 3300025935 | Ga0207709_10246249 | Ga0207709_102462491 | 322 |
| 484 | 3300025936 | Ga0207670_10104909 | Ga0207670_101049092 | 322 |
| 485 | 3300025937 | Ga0207669_10009972 | Ga0207669_100099722 | 322 |
| 486 | 3300025938 | Ga0207704_10002475 | Ga0207704_100024758 | 322 |
| 487 | 3300025940 | Ga0207691_10003154 | Ga0207691_100031549 | 322 |
| 488 | 3300025940 | Ga0207691_10219210 | Ga0207691_102192102 | 322 |
| 489 | 3300025941 | Ga0207711_10314411 | Ga0207711_103144112 | 322 |
| 490 | 3300025942 | Ga0207689_10001141 | Ga0207689_1000114118 | 322 |
| 491 | 3300025942 | Ga0207689_10050149 | Ga0207689_100501493 | 322 |
| 492 | 3300025945 | Ga0207679_10075106 | Ga0207679_100751062 | 322 |
| 493 | 3300025960 | Ga0207651_10053131 | Ga0207651_100531313 | 322 |
| 494 | 3300025961 | Ga0207712_10004342 | Ga0207712_100043424 | 322 |
| 495 | 3300026035 | Ga0207703_10131414 | Ga0207703_101314142 | 322 |
| 496 | 3300026067 | Ga0207678_10036825 | Ga0207678_100368254 | 322 |
| 497 | 3300026067 | Ga0207678_10064557 | Ga0207678_100645574 | 322 |
| 498 | 3300026075 | Ga0207708_10006210 | Ga0207708_100062109 | 322 |
| 499 | 3300026075 | Ga0207708_10014730 | Ga0207708_100147303 | 322 |
| 500 | 3300026088 | Ga0207641_10008578 | Ga0207641_100085788 | 322 |
| 501 | 3300026089 | Ga0207648_10004031 | Ga0207648_1000403116 | 322 |
| 502 | 3300026089 | Ga0207648_10041422 | Ga0207648_100414223 | 322 |
| 503 | 3300026095 | Ga0207676_10127604 | Ga0207676_101276043 | 322 |
| 504 | 3300026095 | Ga0207676_10191049 | Ga0207676_101910492 | 322 |
| 505 | 3300026116 | Ga0207674_10198604 | Ga0207674_101986043 | 322 |
| 506 | 3300026118 | Ga0207675_100035929 | Ga0207675_1000359295 | 322 |
| 507 | 3300026118 | Ga0207675_100036318 | Ga0207675_1000363183 | 322 |
| 508 | 3300026118 | Ga0207675_100065217 | Ga0207675_1000652172 | 322 |
| 509 | 3300026121 | Ga0207683_10001698 | Ga0207683_1000169821 | 322 |
| 510 | 3300026121 | Ga0207683_10006182 | Ga0207683_100061828 | 322 |
| 511 | 3300026121 | Ga0207683_10186613 | Ga0207683_101866132 | 322 |
| 512 | 3300027907 | Ga0207428_10000345 | Ga0207428_1000034523 | 322 |
| 513 | 3300028379 | Ga0268266_10062006 | Ga0268266_100620063 | 322 |
| 514 | 3300028380 | Ga0268265_10046338 | Ga0268265_100463383 | 322 |
| 515 | 3300028381 | Ga0268264_10228114 | Ga0268264_102281143 | 322 |
| 516 | 3300031824 | Ga0307413_10041280 | Ga0307413_100412803 | 322 |
| 517 | 3300031852 | Ga0307410_10165951 | Ga0307410_101659513 | 322 |
| 518 | 3300031903 | Ga0307407_10006608 | Ga0307407_100066083 | 322 |
| 519 | 3300031911 | Ga0307412_10160733 | Ga0307412_101607332 | 322 |
| 520 | 3300031995 | Ga0307409_100106260 | Ga0307409_1001062602 | 322 |
| 521 | 3300032002 | Ga0307416_100001676 | Ga0307416_1000016763 | 322 |
| 522 | 3300032004 | Ga0307414_10104991 | Ga0307414_101049911 | 322 |
| 523 | 3300032005 | Ga0307411_10003321 | Ga0307411_100033218 | 322 |
| 524 | 3300032005 | Ga0307411_10053902 | Ga0307411_100539023 | 322 |
| 525 | 3300032126 | Ga0307415_100016964 | Ga0307415_1000169645 | 322 |
| 526 | 3300035115 | Ga0373941_0059513 | Ga0373941_0059513_58_1026 | 322 |
| 527 | 3300049575 | Ga0501039_0020851 | Ga0501039_0020851_311_1282 | 322 |
| 528 | 3300049576 | Ga0501040_0017841 | Ga0501040_0017841_1550_2530 | 322 |
| 529 | 3300049577 | Ga0501041_0013579 | Ga0501041_0013579_2898_3878 | 322 |
| 530 | 3300049578 | Ga0501042_0003074 | Ga0501042_0003074_6573_7553 | 322 |
| 531 | 3300049588 | Ga0501072_0157426 | Ga0501072_0157426_521_1510 | 322 |
| 532 | 3300049589 | Ga0501073_0100339 | Ga0501073_0100339_76_1056 | 322 |
| 533 | 3300049742 | Ga0501080_0466970 | Ga0501080_0466970_108_1088 | 322 |
| 534 | 3300049743 | Ga0501081_0067955 | Ga0501081_0067955_1344_2333 | 322 |
| 535 | 3300049824 | Ga0501045_0194399 | Ga0501045_0194399_330_1310 | 322 |
| 536 | 3300050507 | nmdc:mga05p37_316534_c1 | nmdc:mga05p37_316534_c1_795_1763 | 322 |
| 537 | 3300050508 | nmdc:mga09592_32082_c1 | nmdc:mga09592_32082_c1_2988_3956 | 322 |
| 538 | 3300050508 | nmdc:mga09592_3756_c1 | nmdc:mga09592_3756_c1_2429_3397 | 322 |
| 539 | 3300050509 | nmdc:mga0qj67_11727_c1 | nmdc:mga0qj67_11727_c1_2593_3573 | 322 |
| 540 | 3300050509 | nmdc:mga0qj67_173725_c1 | nmdc:mga0qj67_173725_c1_423_1391 | 322 |
| 541 | 3300050509 | nmdc:mga0qj67_60258_c1 | nmdc:mga0qj67_60258_c1_1252_2220 | 322 |
| 542 | 3300050510 | nmdc:mga06r32_24748_c1 | nmdc:mga06r32_24748_c1_349_1329 | 322 |
| 543 | 3300050511 | nmdc:mga08y16_13098_c1 | nmdc:mga08y16_13098_c1_867_1835 | 322 |
| 544 | 3300050512 | nmdc:mga0n895_10318_c1 | nmdc:mga0n895_10318_c1_5567_6547 | 322 |
| 545 | 3300050513 | nmdc:mga0rr50_115742_c1 | nmdc:mga0rr50_115742_c1_1053_2021 | 322 |
| 546 | 3300050515 | nmdc:mga0a205_324650_c1 | nmdc:mga0a205_324650_c1_325_1293 | 322 |
| 547 | 3300054114 | Ga0501084_0114762 | Ga0501084_0114762_491_1471 | 322 |
| 548 | 3300060353 | Ga0501082_0212131 | Ga0501082_0212131_476_1456 | 322 |
| 549 | 3300005343 | Ga0070687_100043442 | Ga0070687_1000434424 | 323 |
| 550 | 3300005353 | Ga0070669_100039125 | Ga0070669_1000391253 | 323 |
| 551 | 3300005354 | Ga0070675_100019983 | Ga0070675_1000199833 | 323 |
| 552 | 3300005354 | Ga0070675_100028688 | Ga0070675_1000286882 | 323 |
| 553 | 3300005364 | Ga0070673_100019697 | Ga0070673_1000196975 | 323 |
| 554 | 3300005456 | Ga0070678_100050809 | Ga0070678_1000508091 | 323 |
| 555 | 3300005458 | Ga0070681_10317317 | Ga0070681_103173172 | 323 |
| 556 | 3300005459 | Ga0068867_100199013 | Ga0068867_1001990132 | 323 |
| 557 | 3300005546 | Ga0070696_100067266 | Ga0070696_1000672662 | 323 |
| 558 | 3300005617 | Ga0068859_100057245 | Ga0068859_1000572452 | 323 |
| 559 | 3300005617 | Ga0068859_100097828 | Ga0068859_1000978284 | 323 |
| 560 | 3300005719 | Ga0068861_100385923 | Ga0068861_1003859232 | 323 |
| 561 | 3300006844 | Ga0075428_100034518 | Ga0075428_1000345183 | 323 |
| 562 | 3300006846 | Ga0075430_100104309 | Ga0075430_1001043091 | 323 |
| 563 | 3300006852 | Ga0075433_10076422 | Ga0075433_100764222 | 323 |
| 564 | 3300006880 | Ga0075429_100084831 | Ga0075429_1000848314 | 323 |
| 565 | 3300006931 | Ga0097620_100057246 | Ga0097620_1000572462 | 323 |
| 566 | 3300006931 | Ga0097620_100097829 | Ga0097620_1000978292 | 323 |
| 567 | 3300009094 | Ga0111539_10012997 | Ga0111539_100129977 | 323 |
| 568 | 3300009094 | Ga0111539_10022546 | Ga0111539_100225469 | 323 |
| 569 | 3300009094 | Ga0111539_10047854 | Ga0111539_100478545 | 323 |
| 570 | 3300009094 | Ga0111539_10086035 | Ga0111539_100860352 | 323 |
| 571 | 3300009147 | Ga0114129_10429864 | Ga0114129_104298642 | 323 |
| 572 | 3300013308 | Ga0157375_10027735 | Ga0157375_100277353 | 323 |
| 573 | 3300025918 | Ga0207662_10021443 | Ga0207662_100214433 | 323 |
| 574 | 3300025926 | Ga0207659_10007084 | Ga0207659_100070847 | 323 |
| 575 | 3300025926 | Ga0207659_10015463 | Ga0207659_100154633 | 323 |
| 576 | 3300025936 | Ga0207670_10046326 | Ga0207670_100463263 | 323 |
| 577 | 3300025945 | Ga0207679_10515724 | Ga0207679_105157241 | 323 |
| 578 | 3300025960 | Ga0207651_10002774 | Ga0207651_100027747 | 323 |
| 579 | 3300026089 | Ga0207648_10013384 | Ga0207648_100133845 | 323 |
| 580 | 3300026118 | Ga0207675_100451654 | Ga0207675_1004516542 | 323 |
| 581 | 3300027907 | Ga0207428_10009368 | Ga0207428_100093686 | 323 |
| 582 | 3300031995 | Ga0307409_100610455 | Ga0307409_1006104551 | 323 |
| 583 | 3300032002 | Ga0307416_100189115 | Ga0307416_1001891153 | 323 |
| 584 | 3300046615 | Ga0495656_0022751 | Ga0495656_0022751_270_1250 | 323 |
| 585 | 3300048912 | Ga0496109_0021884 | Ga0496109_0021884_127_1110 | 323 |
| 586 | 3300048916 | Ga0496113_0343094 | Ga0496113_0343094_31_1014 | 323 |
| 587 | 3300050507 | nmdc:mga05p37_43213_c1 | nmdc:mga05p37_43213_c1_4119_5099 | 323 |
| 588 | 3300050508 | nmdc:mga09592_26812_c1 | nmdc:mga09592_26812_c1_949_1929 | 323 |
| 589 | 3300050509 | nmdc:mga0qj67_38426_c1 | nmdc:mga0qj67_38426_c1_1075_2046 | 323 |
| 590 | 3300050511 | nmdc:mga08y16_17564_c1 | nmdc:mga08y16_17564_c1_111_1091 | 323 |
| 591 | 3300050511 | nmdc:mga08y16_244821_c1 | nmdc:mga08y16_244821_c1_145_1128 | 323 |
| 592 | 3300050511 | nmdc:mga08y16_3324_c1 | nmdc:mga08y16_3324_c1_11697_12686 | 323 |
| 593 | 3300050515 | nmdc:mga0a205_91533_c1 | nmdc:mga0a205_91533_c1_287_1270 | 323 |
| 594 | 3300005327 | Ga0070658_10143452 | Ga0070658_101434523 | 324 |
| 595 | 3300005331 | Ga0070670_100020776 | Ga0070670_1000207766 | 324 |
| 596 | 3300005340 | Ga0070689_100096588 | Ga0070689_1000965882 | 324 |
| 597 | 3300005354 | Ga0070675_100012936 | Ga0070675_1000129364 | 324 |
| 598 | 3300005365 | Ga0070688_100305117 | Ga0070688_1003051171 | 324 |
| 599 | 3300005543 | Ga0070672_100195611 | Ga0070672_1001956112 | 324 |
| 600 | 3300005564 | Ga0070664_100462565 | Ga0070664_1004625652 | 324 |
| 601 | 3300005617 | Ga0068859_100529208 | Ga0068859_1005292082 | 324 |
| 602 | 3300005618 | Ga0068864_100306959 | Ga0068864_1003069592 | 324 |
| 603 | 3300005719 | Ga0068861_100089158 | Ga0068861_1000891583 | 324 |
| 604 | 3300006844 | Ga0075428_100004439 | Ga0075428_10000443911 | 324 |
| 605 | 3300006846 | Ga0075430_100318834 | Ga0075430_1003188341 | 324 |
| 606 | 3300006847 | Ga0075431_100262609 | Ga0075431_1002626092 | 324 |
| 607 | 3300006880 | Ga0075429_100016395 | Ga0075429_1000163953 | 324 |
| 608 | 3300006931 | Ga0097620_100529226 | Ga0097620_1005292262 | 324 |
| 609 | 3300009094 | Ga0111539_10189151 | Ga0111539_101891513 | 324 |
| 610 | 3300009147 | Ga0114129_10007052 | Ga0114129_1000705215 | 324 |
| 611 | 3300009551 | Ga0105238_10020278 | Ga0105238_100202783 | 324 |
| 612 | 3300009553 | Ga0105249_10733592 | Ga0105249_107335921 | 324 |
| 613 | 3300014325 | Ga0163163_10480951 | Ga0163163_104809511 | 324 |
| 614 | 3300025901 | Ga0207688_10100576 | Ga0207688_101005763 | 324 |
| 615 | 3300025924 | Ga0207694_10031751 | Ga0207694_100317515 | 324 |
| 616 | 3300025926 | Ga0207659_10013082 | Ga0207659_100130823 | 324 |
| 617 | 3300025940 | Ga0207691_10069827 | Ga0207691_100698273 | 324 |
| 618 | 3300032002 | Ga0307416_100008926 | Ga0307416_1000089264 | 324 |
| 619 | 3300032004 | Ga0307414_10388833 | Ga0307414_103888332 | 324 |
| 620 | 3300045051 | Ga0451576_0702350 | Ga0451576_0702350_77_1051 | 324 |
| 621 | 3300050507 | nmdc:mga05p37_237136_c1 | nmdc:mga05p37_237136_c1_59_1033 | 324 |
| 622 | 3300050508 | nmdc:mga09592_19340_c1 | nmdc:mga09592_19340_c1_2578_3552 | 324 |
| 623 | 3300050509 | nmdc:mga0qj67_73799_c1 | nmdc:mga0qj67_73799_c1_813_1787 | 324 |
| 624 | 3300050510 | nmdc:mga06r32_245509_c1 | nmdc:mga06r32_245509_c1_434_1408 | 324 |
| 625 | 3300014326 | Ga0157380_10498434 | Ga0157380_104984341 | 325 |
| 626 | 3300025926 | Ga0207659_10000692 | Ga0207659_1000069216 | 325 |
| 627 | 3300025937 | Ga0207669_10005428 | Ga0207669_100054284 | 325 |
| 628 | 3300050511 | nmdc:mga08y16_82857_c1 | nmdc:mga08y16_82857_c1_1538_2545 | 325 |
| 629 | 3300005331 | Ga0070670_100435109 | Ga0070670_1004351091 | 326 |
| 630 | 3300006237 | Ga0097621_100074644 | Ga0097621_1000746443 | 326 |
| 631 | 3300025903 | Ga0207680_10093887 | Ga0207680_100938872 | 326 |
| 632 | 3300025940 | Ga0207691_10149675 | Ga0207691_101496752 | 326 |
| 633 | 3300041408 | Ga0439453_0001566 | Ga0439453_0001566_1280_2260 | 326 |
| 634 | 3300050509 | nmdc:mga0qj67_16962_c1 | nmdc:mga0qj67_16962_c1_1776_2762 | 326 |
| 635 | 3300005543 | Ga0070672_100111714 | Ga0070672_1001117143 | 327 |
| 636 | 3300025940 | Ga0207691_10120381 | Ga0207691_101203812 | 327 |
| 637 | 3300049587 | Ga0501071_0305292 | Ga0501071_0305292_159_1142 | 327 |
| 638 | 3300054114 | Ga0501084_0400122 | Ga0501084_0400122_66_1079 | 327 |
| 639 | 3300005293 | Ga0065715_10176268 | Ga0065715_101762682 | 328 |
| 640 | 3300005293 | Ga0065715_10203068 | Ga0065715_102030682 | 328 |
| 641 | 3300005295 | Ga0065707_10009461 | Ga0065707_100094612 | 328 |
| 642 | 3300005331 | Ga0070670_100007560 | Ga0070670_1000075604 | 328 |
| 643 | 3300005340 | Ga0070689_100087173 | Ga0070689_1000871733 | 328 |
| 644 | 3300005340 | Ga0070689_100137679 | Ga0070689_1001376792 | 328 |
| 645 | 3300005343 | Ga0070687_100010429 | Ga0070687_1000104293 | 328 |
| 646 | 3300005343 | Ga0070687_100107109 | Ga0070687_1001071092 | 328 |
| 647 | 3300005345 | Ga0070692_10036167 | Ga0070692_100361673 | 328 |
| 648 | 3300005347 | Ga0070668_100256277 | Ga0070668_1002562772 | 328 |
| 649 | 3300005353 | Ga0070669_100003108 | Ga0070669_1000031089 | 328 |
| 650 | 3300005354 | Ga0070675_100009067 | Ga0070675_1000090678 | 328 |
| 651 | 3300005354 | Ga0070675_100019910 | Ga0070675_1000199105 | 328 |
| 652 | 3300005364 | Ga0070673_100092556 | Ga0070673_1000925563 | 328 |
| 653 | 3300005365 | Ga0070688_100025395 | Ga0070688_1000253951 | 328 |
| 654 | 3300005365 | Ga0070688_100260295 | Ga0070688_1002602951 | 328 |
| 655 | 3300005438 | Ga0070701_10054667 | Ga0070701_100546671 | 328 |
| 656 | 3300005441 | Ga0070700_100004623 | Ga0070700_1000046234 | 328 |
| 657 | 3300005444 | Ga0070694_100120839 | Ga0070694_1001208393 | 328 |
| 658 | 3300005445 | Ga0070708_100177462 | Ga0070708_1001774623 | 328 |
| 659 | 3300005457 | Ga0070662_100012018 | Ga0070662_1000120184 | 328 |
| 660 | 3300005458 | Ga0070681_10075385 | Ga0070681_100753853 | 328 |
| 661 | 3300005466 | Ga0070685_10066593 | Ga0070685_100665933 | 328 |
| 662 | 3300005471 | Ga0070698_100000806 | Ga0070698_10000080633 | 328 |
| 663 | 3300005471 | Ga0070698_100025140 | Ga0070698_1000251404 | 328 |
| 664 | 3300005518 | Ga0070699_100000386 | Ga0070699_10000038614 | 328 |
| 665 | 3300005518 | Ga0070699_100006186 | Ga0070699_1000061864 | 328 |
| 666 | 3300005518 | Ga0070699_100068674 | Ga0070699_1000686742 | 328 |
| 667 | 3300005530 | Ga0070679_100295205 | Ga0070679_1002952052 | 328 |
| 668 | 3300005536 | Ga0070697_100037002 | Ga0070697_1000370023 | 328 |
| 669 | 3300005543 | Ga0070672_100030643 | Ga0070672_1000306434 | 328 |
| 670 | 3300005544 | Ga0070686_100033883 | Ga0070686_1000338831 | 328 |
| 671 | 3300005546 | Ga0070696_100064510 | Ga0070696_1000645102 | 328 |
| 672 | 3300005549 | Ga0070704_100006063 | Ga0070704_1000060634 | 328 |
| 673 | 3300005549 | Ga0070704_100028365 | Ga0070704_1000283654 | 328 |
| 674 | 3300005564 | Ga0070664_100035652 | Ga0070664_1000356523 | 328 |
| 675 | 3300005577 | Ga0068857_100012663 | Ga0068857_1000126635 | 328 |
| 676 | 3300005577 | Ga0068857_100060235 | Ga0068857_1000602351 | 328 |
| 677 | 3300005578 | Ga0068854_100031544 | Ga0068854_1000315444 | 328 |
| 678 | 3300005617 | Ga0068859_100002081 | Ga0068859_10000208115 | 328 |
| 679 | 3300005617 | Ga0068859_100015676 | Ga0068859_1000156766 | 328 |
| 680 | 3300005618 | Ga0068864_100005475 | Ga0068864_1000054755 | 328 |
| 681 | 3300005719 | Ga0068861_100001989 | Ga0068861_10000198910 | 328 |
| 682 | 3300005840 | Ga0068870_10003442 | Ga0068870_100034423 | 328 |
| 683 | 3300005840 | Ga0068870_10003674 | Ga0068870_100036742 | 328 |
| 684 | 3300005841 | Ga0068863_100232909 | Ga0068863_1002329093 | 328 |
| 685 | 3300005842 | Ga0068858_100008296 | Ga0068858_10000829610 | 328 |
| 686 | 3300005843 | Ga0068860_100067582 | Ga0068860_1000675823 | 328 |
| 687 | 3300005844 | Ga0068862_100001000 | Ga0068862_10000100013 | 328 |
| 688 | 3300006237 | Ga0097621_100072035 | Ga0097621_1000720353 | 328 |
| 689 | 3300006358 | Ga0068871_100133895 | Ga0068871_1001338952 | 328 |
| 690 | 3300006844 | Ga0075428_100018233 | Ga0075428_1000182335 | 328 |
| 691 | 3300006852 | Ga0075433_10074202 | Ga0075433_100742023 | 328 |
| 692 | 3300006871 | Ga0075434_100003880 | Ga0075434_1000038808 | 328 |
| 693 | 3300006871 | Ga0075434_100122761 | Ga0075434_1001227613 | 328 |
| 694 | 3300006871 | Ga0075434_100502109 | Ga0075434_1005021092 | 328 |
| 695 | 3300006880 | Ga0075429_100101360 | Ga0075429_1001013603 | 328 |
| 696 | 3300006881 | Ga0068865_100124263 | Ga0068865_1001242632 | 328 |
| 697 | 3300006931 | Ga0097620_100002081 | Ga0097620_1000020819 | 328 |
| 698 | 3300006931 | Ga0097620_100015676 | Ga0097620_1000156764 | 328 |
| 699 | 3300007076 | Ga0075435_100007984 | Ga0075435_1000079846 | 328 |
| 700 | 3300009094 | Ga0111539_10017744 | Ga0111539_100177445 | 328 |
| 701 | 3300009147 | Ga0114129_10003827 | Ga0114129_100038274 | 328 |
| 702 | 3300009147 | Ga0114129_10023144 | Ga0114129_100231447 | 328 |
| 703 | 3300009147 | Ga0114129_10081605 | Ga0114129_100816052 | 328 |
| 704 | 3300009148 | Ga0105243_10051889 | Ga0105243_100518893 | 328 |
| 705 | 3300009177 | Ga0105248_10507875 | Ga0105248_105078752 | 328 |
| 706 | 3300009553 | Ga0105249_10006074 | Ga0105249_100060747 | 328 |
| 707 | 3300013297 | Ga0157378_10140615 | Ga0157378_101406152 | 328 |
| 708 | 3300013308 | Ga0157375_10128242 | Ga0157375_101282423 | 328 |
| 709 | 3300014745 | Ga0157377_10119378 | Ga0157377_101193781 | 328 |
| 710 | 3300014968 | Ga0157379_10102966 | Ga0157379_101029663 | 328 |
| 711 | 3300025904 | Ga0207647_10038289 | Ga0207647_100382894 | 328 |
| 712 | 3300025907 | Ga0207645_10035538 | Ga0207645_100355383 | 328 |
| 713 | 3300025908 | Ga0207643_10009824 | Ga0207643_100098241 | 328 |
| 714 | 3300025908 | Ga0207643_10128591 | Ga0207643_101285911 | 328 |
| 715 | 3300025918 | Ga0207662_10013731 | Ga0207662_100137315 | 328 |
| 716 | 3300025920 | Ga0207649_10113239 | Ga0207649_101132392 | 328 |
| 717 | 3300025922 | Ga0207646_10457023 | Ga0207646_104570231 | 328 |
| 718 | 3300025923 | Ga0207681_10005692 | Ga0207681_100056924 | 328 |
| 719 | 3300025925 | Ga0207650_10006792 | Ga0207650_100067924 | 328 |
| 720 | 3300025926 | Ga0207659_10000547 | Ga0207659_100005475 | 328 |
| 721 | 3300025926 | Ga0207659_10003019 | Ga0207659_100030194 | 328 |
| 722 | 3300025933 | Ga0207706_10072049 | Ga0207706_100720492 | 328 |
| 723 | 3300025936 | Ga0207670_10003124 | Ga0207670_100031242 | 328 |
| 724 | 3300025936 | Ga0207670_10008107 | Ga0207670_100081076 | 328 |
| 725 | 3300025940 | Ga0207691_10025047 | Ga0207691_100250473 | 328 |
| 726 | 3300025940 | Ga0207691_10088454 | Ga0207691_100884543 | 328 |
| 727 | 3300025941 | Ga0207711_10057855 | Ga0207711_100578553 | 328 |
| 728 | 3300025942 | Ga0207689_10149033 | Ga0207689_101490332 | 328 |
| 729 | 3300025945 | Ga0207679_10012954 | Ga0207679_100129544 | 328 |
| 730 | 3300025945 | Ga0207679_10203848 | Ga0207679_102038482 | 328 |
| 731 | 3300025961 | Ga0207712_10014252 | Ga0207712_100142523 | 328 |
| 732 | 3300025972 | Ga0207668_10124693 | Ga0207668_101246933 | 328 |
| 733 | 3300026075 | Ga0207708_10012471 | Ga0207708_100124711 | 328 |
| 734 | 3300026089 | Ga0207648_10001255 | Ga0207648_1000125510 | 328 |
| 735 | 3300026089 | Ga0207648_10089442 | Ga0207648_100894422 | 328 |
| 736 | 3300026095 | Ga0207676_10008322 | Ga0207676_100083224 | 328 |
| 737 | 3300026116 | Ga0207674_10038394 | Ga0207674_100383945 | 328 |
| 738 | 3300026116 | Ga0207674_10075303 | Ga0207674_100753034 | 328 |
| 739 | 3300026118 | Ga0207675_100006796 | Ga0207675_10000679610 | 328 |
| 740 | 3300026121 | Ga0207683_10050609 | Ga0207683_100506093 | 328 |
| 741 | 3300027907 | Ga0207428_10000442 | Ga0207428_1000044230 | 328 |
| 742 | 3300028380 | Ga0268265_10000237 | Ga0268265_1000023717 | 328 |
| 743 | 3300028381 | Ga0268264_10018583 | Ga0268264_100185835 | 328 |
| 744 | 3300035114 | Ga0373939_0066331 | Ga0373939_0066331_82_1080 | 328 |
| 745 | 3300035241 | Ga0373961_0036695 | Ga0373961_0036695_36_1034 | 328 |
| 746 | 3300045051 | Ga0451576_0033144 | Ga0451576_0033144_1872_2870 | 328 |
| 747 | 3300045051 | Ga0451576_0053960 | Ga0451576_0053960_1024_2022 | 328 |
| 748 | 3300045051 | Ga0451576_0220695 | Ga0451576_0220695_751_1749 | 328 |
| 749 | 3300046455 | Ga0495603_0018601 | Ga0495603_0018601_1160_2158 | 328 |
| 750 | 3300046499 | Ga0495594_0002079 | Ga0495594_0002079_7545_8543 | 328 |
| 751 | 3300046539 | Ga0495621_0020840 | Ga0495621_0020840_581_1579 | 328 |
| 752 | 3300046558 | Ga0495633_0089624 | Ga0495633_0089624_341_1339 | 328 |
| 753 | 3300046664 | Ga0495659_0008894 | Ga0495659_0008894_1232_2230 | 328 |
| 754 | 3300046691 | Ga0495670_0067914 | Ga0495670_0067914_738_1736 | 328 |
| 755 | 3300050507 | nmdc:mga05p37_2349_c1 | nmdc:mga05p37_2349_c1_8835_9833 | 328 |
| 756 | 3300050507 | nmdc:mga05p37_404899_c1 | nmdc:mga05p37_404899_c1_288_1286 | 328 |
| 757 | 3300050511 | nmdc:mga08y16_522_c1 | nmdc:mga08y16_522_c1_22963_23961 | 328 |
| 758 | 3300050512 | nmdc:mga0n895_100512_c1 | nmdc:mga0n895_100512_c1_427_1425 | 328 |
| 759 | 3300050512 | nmdc:mga0n895_410624_c1 | nmdc:mga0n895_410624_c1_107_1105 | 328 |
| 760 | 3300050512 | nmdc:mga0n895_77621_c1 | nmdc:mga0n895_77621_c1_224_1222 | 328 |
| 761 | 3300050513 | nmdc:mga0rr50_197449_c1 | nmdc:mga0rr50_197449_c1_172_1170 | 328 |
| 762 | 3300050515 | nmdc:mga0a205_38800_c1 | nmdc:mga0a205_38800_c1_3063_4061 | 328 |
| 763 | 3300005293 | Ga0065715_10129688 | Ga0065715_101296883 | 329 |
| 764 | 3300005354 | Ga0070675_100001605 | Ga0070675_1000016058 | 329 |
| 765 | 3300005364 | Ga0070673_100008407 | Ga0070673_1000084073 | 329 |
| 766 | 3300006880 | Ga0075429_100142044 | Ga0075429_1001420443 | 329 |
| 767 | 3300013308 | Ga0157375_10139857 | Ga0157375_101398573 | 329 |
| 768 | 3300014745 | Ga0157377_10008061 | Ga0157377_100080614 | 329 |
| 769 | 3300025940 | Ga0207691_10016461 | Ga0207691_100164612 | 329 |
| 770 | 3300025960 | Ga0207651_10004970 | Ga0207651_100049705 | 329 |
| 771 | 3300050508 | nmdc:mga09592_262703_c1 | nmdc:mga09592_262703_c1_166_1176 | 329 |
| 772 | 3300003203 | JGI25406J46586_10007048 | JGI25406J46586_100070485 | 330 |
| 773 | 3300005985 | Ga0081539_10000034 | Ga0081539_1000003437 | 330 |
| 774 | 3300005985 | Ga0081539_10000190 | Ga0081539_10000190121 | 330 |
| 775 | 3300009094 | Ga0111539_10006236 | Ga0111539_100062366 | 330 |
| 776 | 3300050511 | nmdc:mga08y16_133933_c1 | nmdc:mga08y16_133933_c1_437_1429 | 330 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7jyp-assembly1.cif.gz_A-2 | structure of thioredoxin reductase from the thermophilic eubacterium thermosipho africanus tcf52b | 0.9474 | 4 | 301 |
| 5uth-assembly1.cif.gz_A | crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad | 0.9409 | 1 | 306 |
| 2a87-assembly1.cif.gz_B | crystal structure of m. tuberculosis thioredoxin reductase | 0.9409 | 4 | 306 |
| 5uth-assembly1.cif.gz_A | crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad | 0.932 | 1 | 306 |
| 2a87-assembly1.cif.gz_B | crystal structure of m. tuberculosis thioredoxin reductase | 0.932 | 4 | 306 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5uthA02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.982 | 116 | 240 | 3.50.50.60 |
| 5uthA02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9742 | 116 | 240 | 3.50.50.60 |
| 3f8rD02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9532 | 116 | 240 | 3.50.50.60 |
| 4zn0C02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9517 | 123 | 240 | 3.50.50.60 |
| 4ykgA03 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.95 | 116 | 240 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C0YJU2-F1-model_v4 | deleted | 0.9839 | 134 | 200 |
|
| AF-K1UEN0-F1-model_v4 | Protein containing Pyridine nucleotide-disulfide oxidoreductase, NAD-binding region domain protein (EC 1.-.-.-) | 0.9727 | 139 | 206 |
GO:0016491
|
| AF-A0A6B3EPH4-F1-model_v4 | FAD-dependent oxidoreductase | 0.9705 | 111 | 226 |
GO:0016668
|
| AF-A0A3D5UWY6-F1-model_v4 | Thioredoxin-disulfide reductase | 0.9664 | 141 | 231 |
GO:0016491
|
| AF-A0A3D5M494-F1-model_v4 | Thioredoxin-disulfide reductase | 0.9598 | 58 | 306 |
GO:0016668
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar