F480290

General Info

Members Datasets Scaffolds Average Seq Length
776 247 776 323

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10129688|Ga0065715_101296883
Length 336
Sequence MSVAAHADREVVVIGSGPAGLTAALYAARANLRPLLIEGLEAGGQLMLTTMVENWPGFRDGIMGPDLMGEMRAQAERFGTEVLQGNVTSVDLKDRPFTITLEGGRKITTVALIIATGASARWLDIGSDRKLSGHGVSTCATCDGYFFRGRPIAVVGGGDSAMEEAVYLTKFASKVTVIHRRDTLRASKIMQDKAFANPKIEFVWDSEVIDVADLQKGEVTHLVLRNLKTAQTSHLPVDGVFIAIGHTPNTALFKGQLDLDPTGYIVTNGGTRTNVPGVFAAGDVQDHVYRQAVTAAGSGCMAAIDAERYIEGLPVADRPADGGPADGTVHRGDIAV

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
161 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
162 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
168 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
169 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
170 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
171 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
172 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
173 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
174 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
178 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
179 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
184 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
187 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
210 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
222 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
226 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
227 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
228 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
229 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
230 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
243 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
244 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
245 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
247 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.71
Nodule 0
Rhizoplane 2.71
Rhizosphere 94.46
Stem 0
Stem Tuber 0
Unclassified 0.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10007048 3300003203 Bacteria 5153
2 Ga0065712_10004141 3300005290 Bacteria 4840
3 Ga0065712_10068502 3300005290 Bacteria 10191
4 Ga0065712_10084064 3300005290 Bacteria 2792
5 Ga0065712_10092356 3300005290 Bacteria 2334
6 Ga0065712_10130484 3300005290 Bacteria 1556
7 Ga0065715_10035970 3300005293 Bacteria 1220
8 Ga0065715_10096489 3300005293 Bacteria 3870
9 Ga0065715_10129688 3300005293 Bacteria 2041
10 Ga0065715_10176268 3300005293 Bacteria 1478
11 Ga0065715_10203068 3300005293 Bacteria 1350
12 Ga0065707_10009461 3300005295 Bacteria 3110
13 Ga0070658_10143452 3300005327 Bacteria 1996
14 Ga0070676_10010170 3300005328 Bacteria 5100
15 Ga0070676_10024363 3300005328 Bacteria 3409
16 Ga0070676_10214393 3300005328 Bacteria 1269
17 Ga0070683_100013764 3300005329 Bacteria 7063
18 Ga0070683_100016062 3300005329 Bacteria 6589
19 Ga0070690_100011832 3300005330 Bacteria 5118
20 Ga0070690_100038525 3300005330 Bacteria 3017
21 Ga0070670_100001472 3300005331 Bacteria 18962
22 Ga0070670_100007560 3300005331 Bacteria 9222
23 Ga0070670_100011715 3300005331 Bacteria 7502
24 Ga0070670_100019868 3300005331 Bacteria 5768
25 Ga0070670_100020776 3300005331 Bacteria 5645
26 Ga0070670_100035298 3300005331 Bacteria 4306
27 Ga0070670_100051665 3300005331 Bacteria 3529
28 Ga0070670_100070492 3300005331 Bacteria 3001
29 Ga0070670_100435109 3300005331 Bacteria 1161
30 Ga0070677_10079765 3300005333 Bacteria 1397
31 Ga0068869_100001451 3300005334 Bacteria 14018
32 Ga0068869_100009316 3300005334 Bacteria 6369
33 Ga0068869_100018614 3300005334 Bacteria 4731
34 Ga0068869_100118017 3300005334 Bacteria 2026
35 Ga0068869_100184748 3300005334 Bacteria 1636
36 Ga0070666_10014202 3300005335 Bacteria 5068
37 Ga0070666_10045698 3300005335 Bacteria 2936
38 Ga0070680_100370492 3300005336 Bacteria 1219
39 Ga0068868_100011007 3300005338 Bacteria 6573
40 Ga0070689_100025190 3300005340 Bacteria 4468
41 Ga0070689_100045884 3300005340 Bacteria 3366
42 Ga0070689_100087173 3300005340 Bacteria 2456
43 Ga0070689_100096588 3300005340 Bacteria 2336
44 Ga0070689_100137679 3300005340 Bacteria 1962
45 Ga0070689_100270590 3300005340 Bacteria 1406
46 Ga0070687_100010429 3300005343 Bacteria 4019
47 Ga0070687_100043442 3300005343 Bacteria 2284
48 Ga0070687_100045461 3300005343 Bacteria 2242
49 Ga0070687_100107109 3300005343 Bacteria 1575
50 Ga0070661_100057423 3300005344 Bacteria 2852
51 Ga0070692_10036167 3300005345 Bacteria 2505
52 Ga0070692_10067771 3300005345 Bacteria 1895
53 Ga0070668_100256277 3300005347 Bacteria 1454
54 Ga0070669_100001008 3300005353 Bacteria 20525
55 Ga0070669_100003108 3300005353 Bacteria 11951
56 Ga0070669_100005330 3300005353 Bacteria 9286
57 Ga0070669_100039125 3300005353 Bacteria 3444
58 Ga0070669_100102117 3300005353 Bacteria 2165
59 Ga0070669_100113179 3300005353 Bacteria 2061
60 Ga0070669_100122469 3300005353 Bacteria 1986
61 Ga0070675_100001179 3300005354 Bacteria 18976
62 Ga0070675_100001605 3300005354 Bacteria 16679
63 Ga0070675_100009067 3300005354 Bacteria 7728
64 Ga0070675_100012936 3300005354 Bacteria 6549
65 Ga0070675_100019910 3300005354 Bacteria 5353
66 Ga0070675_100019983 3300005354 Bacteria 5344
67 Ga0070675_100021012 3300005354 Bacteria 5213
68 Ga0070675_100028688 3300005354 Bacteria 4480
69 Ga0070675_100032873 3300005354 Bacteria 4201
70 Ga0070675_100042602 3300005354 Bacteria 3709
71 Ga0070675_100230552 3300005354 Bacteria 1615
72 Ga0070675_100253754 3300005354 Bacteria 1540
73 Ga0070675_100361768 3300005354 Bacteria 1288
74 Ga0070671_100091343 3300005355 Bacteria 2550
75 Ga0070671_100167583 3300005355 Bacteria 1857
76 Ga0070671_100459694 3300005355 Bacteria 1092
77 Ga0070674_100010787 3300005356 Bacteria 5540
78 Ga0070674_100017253 3300005356 Bacteria 4537
79 Ga0070673_100002948 3300005364 Bacteria 10491
80 Ga0070673_100008407 3300005364 Bacteria 6862
81 Ga0070673_100016632 3300005364 Bacteria 5207
82 Ga0070673_100019697 3300005364 Bacteria 4849
83 Ga0070673_100031521 3300005364 Bacteria 3979
84 Ga0070673_100044100 3300005364 Bacteria 3451
85 Ga0070673_100092556 3300005364 Bacteria 2473
86 Ga0070688_100025395 3300005365 Bacteria 3507
87 Ga0070688_100060756 3300005365 Bacteria 2387
88 Ga0070688_100138948 3300005365 Bacteria 1648
89 Ga0070688_100260295 3300005365 Bacteria 1239
90 Ga0070688_100305117 3300005365 Bacteria 1152
91 Ga0070667_100025919 3300005367 Bacteria 4876
92 Ga0070667_100138715 3300005367 Bacteria 2128
93 Ga0070667_100149903 3300005367 Bacteria 2048
94 Ga0070667_100211711 3300005367 Bacteria 1723
95 Ga0070667_100351882 3300005367 Bacteria 1334
96 Ga0070703_10020979 3300005406 Bacteria 1906
97 Ga0070701_10022675 3300005438 Bacteria 3012
98 Ga0070701_10026649 3300005438 Bacteria 2821
99 Ga0070701_10029415 3300005438 Bacteria 2709
100 Ga0070701_10054667 3300005438 Bacteria 2083
101 Ga0070701_10069828 3300005438 Bacteria 1875
102 Ga0070700_100004623 3300005441 Bacteria 7208
103 Ga0070700_100013263 3300005441 Bacteria 4627
104 Ga0070700_100052389 3300005441 Bacteria 2544
105 Ga0070700_100092432 3300005441 Bacteria 1977
106 Ga0070694_100120839 3300005444 Bacteria 1879
107 Ga0070708_100177462 3300005445 Bacteria 1991
108 Ga0070708_100194395 3300005445 Bacteria 1898
109 Ga0070663_100029234 3300005455 Bacteria 3763
110 Ga0070663_100403407 3300005455 Bacteria 1118
111 Ga0070678_100038752 3300005456 Bacteria 3357
112 Ga0070678_100050809 3300005456 Bacteria 3002
113 Ga0070678_100434272 3300005456 Bacteria 1147
114 Ga0070662_100012018 3300005457 Bacteria 5731
115 Ga0070662_100027875 3300005457 Bacteria 3927
116 Ga0070662_100237636 3300005457 Bacteria 1460
117 Ga0070681_10075385 3300005458 Bacteria 3333
118 Ga0070681_10317317 3300005458 Bacteria 1468
119 Ga0068867_100002915 3300005459 Bacteria 12056
120 Ga0068867_100015432 3300005459 Bacteria 5418
121 Ga0068867_100048676 3300005459 Bacteria 3120
122 Ga0068867_100199013 3300005459 Bacteria 1603
123 Ga0070685_10006838 3300005466 Bacteria 5823
124 Ga0070685_10066593 3300005466 Bacteria 2123
125 Ga0070685_10100115 3300005466 Bacteria 1769
126 Ga0070698_100000806 3300005471 Bacteria 34225
127 Ga0070698_100025140 3300005471 Bacteria 6207
128 Ga0070699_100000386 3300005518 Bacteria 42744
129 Ga0070699_100006186 3300005518 Bacteria 10458
130 Ga0070699_100068674 3300005518 Bacteria 3079
131 Ga0070679_100295205 3300005530 Bacteria 1572
132 Ga0070684_100000069 3300005535 Bacteria 65354
133 Ga0070697_100037002 3300005536 Bacteria 3942
134 Ga0070672_100006792 3300005543 Bacteria 7727
135 Ga0070672_100022174 3300005543 Bacteria 4658
136 Ga0070672_100029469 3300005543 Bacteria 4116
137 Ga0070672_100030643 3300005543 Bacteria 4043
138 Ga0070672_100111714 3300005543 Bacteria 2228
139 Ga0070672_100195611 3300005543 Bacteria 1690
140 Ga0070672_100252510 3300005543 Bacteria 1485
141 Ga0070672_100484818 3300005543 Bacteria 1068
142 Ga0070686_100033883 3300005544 Bacteria 3142
143 Ga0070695_100065489 3300005545 Bacteria 2366
144 Ga0070696_100064510 3300005546 Bacteria 2566
145 Ga0070696_100067266 3300005546 Bacteria 2514
146 Ga0070693_100036407 3300005547 Bacteria 2736
147 Ga0070693_100081703 3300005547 Bacteria 1928
148 Ga0070665_100060629 3300005548 Bacteria 3792
149 Ga0070704_100006063 3300005549 Bacteria 7090
150 Ga0070704_100028365 3300005549 Bacteria 3723
151 Ga0070704_100059701 3300005549 Bacteria 2722
152 Ga0070664_100029842 3300005564 Bacteria 4547
153 Ga0070664_100035652 3300005564 Bacteria 4177
154 Ga0070664_100043148 3300005564 Bacteria 3805
155 Ga0070664_100177679 3300005564 Bacteria 1891
156 Ga0070664_100462565 3300005564 Bacteria 1166
157 Ga0070664_100512773 3300005564 Bacteria 1106
158 Ga0068857_100012663 3300005577 Bacteria 7348
159 Ga0068857_100028553 3300005577 Bacteria 4923
160 Ga0068857_100060235 3300005577 Bacteria 3372
161 Ga0068854_100002999 3300005578 Bacteria 10477
162 Ga0068854_100031544 3300005578 Bacteria 3684
163 Ga0068856_100175684 3300005614 Bacteria 2154
164 Ga0070702_100136052 3300005615 Bacteria 1559
165 Ga0068859_100002081 3300005617 Bacteria 20395
166 Ga0068859_100010866 3300005617 Bacteria 9162
167 Ga0068859_100015676 3300005617 Bacteria 7615
168 Ga0068859_100039203 3300005617 Bacteria 4752
169 Ga0068859_100057245 3300005617 Bacteria 3927
170 Ga0068859_100097828 3300005617 Bacteria 2988
171 Ga0068859_100188619 3300005617 Bacteria 2146
172 Ga0068859_100239583 3300005617 Bacteria 1903
173 Ga0068859_100297212 3300005617 Bacteria 1708
174 Ga0068859_100529208 3300005617 Bacteria 1273
175 Ga0068864_100005332 3300005618 Bacteria 10533
176 Ga0068864_100005475 3300005618 Bacteria 10411
177 Ga0068864_100007453 3300005618 Bacteria 9010
178 Ga0068864_100218930 3300005618 Bacteria 1756
179 Ga0068864_100264108 3300005618 Bacteria 1602
180 Ga0068864_100306959 3300005618 Bacteria 1487
181 Ga0068866_10007464 3300005718 Bacteria 4578
182 Ga0068861_100001989 3300005719 Bacteria 13206
183 Ga0068861_100011620 3300005719 Bacteria 6125
184 Ga0068861_100080622 3300005719 Bacteria 2546
185 Ga0068861_100089158 3300005719 Bacteria 2431
186 Ga0068861_100385923 3300005719 Bacteria 1239
187 Ga0068870_10000269 3300005840 Bacteria 19239
188 Ga0068870_10003442 3300005840 Bacteria 6708
189 Ga0068870_10003674 3300005840 Bacteria 6517
190 Ga0068863_100006562 3300005841 Bacteria 11419
191 Ga0068863_100154643 3300005841 Bacteria 2195
192 Ga0068863_100232909 3300005841 Bacteria 1777
193 Ga0068863_100473802 3300005841 Bacteria 1230
194 Ga0068863_100481960 3300005841 Bacteria 1220
195 Ga0068858_100008296 3300005842 Bacteria 9989
196 Ga0068860_100067582 3300005843 Bacteria 3395
197 Ga0068860_100080168 3300005843 Bacteria 3104
198 Ga0068862_100000662 3300005844 Bacteria 35343
199 Ga0068862_100001000 3300005844 Bacteria 27052
200 Ga0068862_100039327 3300005844 Bacteria 4016
201 Ga0068862_100058781 3300005844 Bacteria 3299
202 Ga0081538_10064337 3300005981 Bacteria 2075
203 Ga0081539_10000034 3300005985 Bacteria 307597
204 Ga0081539_10000190 3300005985 Bacteria 142511
205 Ga0075365_10039266 3300006038 Bacteria 3081
206 Ga0075365_10042337 3300006038 Bacteria 2977
207 Ga0075368_10042760 3300006042 Bacteria 1784
208 Ga0075368_10092734 3300006042 Bacteria 1236
209 Ga0075362_10003939 3300006177 Bacteria 5274
210 Ga0075367_10006522 3300006178 Bacteria 5902
211 Ga0075367_10054158 3300006178 Bacteria 2378
212 Ga0075366_10005889 3300006195 Bacteria 6665
213 Ga0075366_10026146 3300006195 Bacteria 3417
214 Ga0075366_10027436 3300006195 Bacteria 3341
215 Ga0097621_100072035 3300006237 Bacteria 2857
216 Ga0097621_100074644 3300006237 Bacteria 2809
217 Ga0097621_100136293 3300006237 Bacteria 2094
218 Ga0097621_100156079 3300006237 Bacteria 1959
219 Ga0097621_100346097 3300006237 Bacteria 1321
220 Ga0068871_100133895 3300006358 Bacteria 2103
221 Ga0068871_100204475 3300006358 Bacteria 1706
222 Ga0075428_100000439 3300006844 Bacteria 41450
223 Ga0075428_100004439 3300006844 Bacteria 15493
224 Ga0075428_100013447 3300006844 Bacteria 9108
225 Ga0075428_100014410 3300006844 Bacteria 8785
226 Ga0075428_100018233 3300006844 Bacteria 7757
227 Ga0075428_100024526 3300006844 Bacteria 6674
228 Ga0075428_100034518 3300006844 Bacteria 5578
229 Ga0075428_100035169 3300006844 Bacteria 5523
230 Ga0075428_100200251 3300006844 Bacteria 2159
231 Ga0075428_100411845 3300006844 Bacteria 1448
232 Ga0075430_100000107 3300006846 Bacteria 49582
233 Ga0075430_100001499 3300006846 Bacteria 19059
234 Ga0075430_100016781 3300006846 Bacteria 6235
235 Ga0075430_100017890 3300006846 Bacteria 6033
236 Ga0075430_100027691 3300006846 Bacteria 4814
237 Ga0075430_100064303 3300006846 Bacteria 3082
238 Ga0075430_100093115 3300006846 Bacteria 2519
239 Ga0075430_100104309 3300006846 Bacteria 2367
240 Ga0075430_100318834 3300006846 Bacteria 1285
241 Ga0075431_100000506 3300006847 Bacteria 32563
242 Ga0075431_100005881 3300006847 Bacteria 12143
243 Ga0075431_100014360 3300006847 Bacteria 8009
244 Ga0075431_100153812 3300006847 Bacteria 2367
245 Ga0075431_100157670 3300006847 Bacteria 2335
246 Ga0075431_100157785 3300006847 Bacteria 2334
247 Ga0075431_100210498 3300006847 Bacteria 1986
248 Ga0075431_100262609 3300006847 Bacteria 1752
249 Ga0075431_100276559 3300006847 Bacteria 1700
250 Ga0075433_10000466 3300006852 Bacteria 26360
251 Ga0075433_10002058 3300006852 Bacteria 15205
252 Ga0075433_10019190 3300006852 Bacteria 5691
253 Ga0075433_10023220 3300006852 Bacteria 5217
254 Ga0075433_10074202 3300006852 Bacteria 2993
255 Ga0075433_10076422 3300006852 Bacteria 2949
256 Ga0075433_10129411 3300006852 Bacteria 2243
257 Ga0075433_10260049 3300006852 Bacteria 1539
258 Ga0075434_100002389 3300006871 Bacteria 16482
259 Ga0075434_100003880 3300006871 Bacteria 13384
260 Ga0075434_100007789 3300006871 Bacteria 9919
261 Ga0075434_100008078 3300006871 Bacteria 9759
262 Ga0075434_100066673 3300006871 Bacteria 3586
263 Ga0075434_100113047 3300006871 Bacteria 2727
264 Ga0075434_100122761 3300006871 Bacteria 2613
265 Ga0075434_100502109 3300006871 Bacteria 1234
266 Ga0075429_100004353 3300006880 Bacteria 12164
267 Ga0075429_100004861 3300006880 Bacteria 11576
268 Ga0075429_100016395 3300006880 Bacteria 6422
269 Ga0075429_100065379 3300006880 Bacteria 3166
270 Ga0075429_100084831 3300006880 Bacteria 2761
271 Ga0075429_100101360 3300006880 Bacteria 2513
272 Ga0075429_100102932 3300006880 Bacteria 2493
273 Ga0075429_100142044 3300006880 Bacteria 2102
274 Ga0068865_100014782 3300006881 Bacteria 4967
275 Ga0068865_100035023 3300006881 Bacteria 3373
276 Ga0068865_100124263 3300006881 Bacteria 1924
277 Ga0068865_100239219 3300006881 Bacteria 1428
278 Ga0097620_100002081 3300006931 Bacteria 20395
279 Ga0097620_100010866 3300006931 Bacteria 9162
280 Ga0097620_100015676 3300006931 Bacteria 7615
281 Ga0097620_100039202 3300006931 Bacteria 4752
282 Ga0097620_100057246 3300006931 Bacteria 3927
283 Ga0097620_100097829 3300006931 Bacteria 2988
284 Ga0097620_100188616 3300006931 Bacteria 2146
285 Ga0097620_100239573 3300006931 Bacteria 1903
286 Ga0097620_100297207 3300006931 Bacteria 1708
287 Ga0097620_100529226 3300006931 Bacteria 1273
288 Ga0075435_100007984 3300007076 Bacteria 7575
289 Ga0075435_100062458 3300007076 Bacteria 3023
290 Ga0075435_100225688 3300007076 Bacteria 1591
291 Ga0075435_100322856 3300007076 Bacteria 1321
292 Ga0111539_10000065 3300009094 Bacteria 106698
293 Ga0111539_10001128 3300009094 Bacteria 35328
294 Ga0111539_10003505 3300009094 Bacteria 20690
295 Ga0111539_10003820 3300009094 Bacteria 19828
296 Ga0111539_10006236 3300009094 Bacteria 15389
297 Ga0111539_10010818 3300009094 Bacteria 11487
298 Ga0111539_10012997 3300009094 Bacteria 10418
299 Ga0111539_10017744 3300009094 Bacteria 8811
300 Ga0111539_10022546 3300009094 Bacteria 7735
301 Ga0111539_10047854 3300009094 Bacteria 5110
302 Ga0111539_10086035 3300009094 Bacteria 3695
303 Ga0111539_10189151 3300009094 Bacteria 2403
304 Ga0111539_10212449 3300009094 Bacteria 2254
305 Ga0111539_10224771 3300009094 Bacteria 2186
306 Ga0105245_10017804 3300009098 Bacteria 6202
307 Ga0114129_10000076 3300009147 Bacteria 90985
308 Ga0114129_10000476 3300009147 Bacteria 48332
309 Ga0114129_10003827 3300009147 Bacteria 21202
310 Ga0114129_10004740 3300009147 Bacteria 19213
311 Ga0114129_10007052 3300009147 Bacteria 15997
312 Ga0114129_10007774 3300009147 Bacteria 15254
313 Ga0114129_10009630 3300009147 Bacteria 13785
314 Ga0114129_10013579 3300009147 Bacteria 11604
315 Ga0114129_10023144 3300009147 Bacteria 8812
316 Ga0114129_10024852 3300009147 Bacteria 8493
317 Ga0114129_10033236 3300009147 Bacteria 7289
318 Ga0114129_10038106 3300009147 Bacteria 6783
319 Ga0114129_10081605 3300009147 Bacteria 4495
320 Ga0114129_10111384 3300009147 Bacteria 3777
321 Ga0114129_10230902 3300009147 Bacteria 2492
322 Ga0114129_10312292 3300009147 Bacteria 2092
323 Ga0114129_10429864 3300009147 Bacteria 1735
324 Ga0114129_10755950 3300009147 Bacteria 1244
325 Ga0105243_10011752 3300009148 Bacteria 6621
326 Ga0105243_10051889 3300009148 Bacteria 3246
327 Ga0105243_10119671 3300009148 Bacteria 2218
328 Ga0105241_10165763 3300009174 Bacteria 1820
329 Ga0105242_10249531 3300009176 Bacteria 1599
330 Ga0105248_10042462 3300009177 Bacteria 5100
331 Ga0105248_10053293 3300009177 Bacteria 4539
332 Ga0105248_10194501 3300009177 Bacteria 2285
333 Ga0105248_10314497 3300009177 Bacteria 1764
334 Ga0105248_10378264 3300009177 Bacteria 1594
335 Ga0105248_10507875 3300009177 Bacteria 1359
336 Ga0105238_10020278 3300009551 Bacteria 6768
337 Ga0105249_10001042 3300009553 Bacteria 24508
338 Ga0105249_10006074 3300009553 Bacteria 10466
339 Ga0105249_10733592 3300009553 Bacteria 1049
340 Ga0105239_10099330 3300010375 Bacteria 3218
341 Ga0105246_10079894 3300011119 Bacteria 2327
342 Ga0105246_10419471 3300011119 Bacteria 1116
343 Ga0157374_10111515 3300013296 Bacteria 2631
344 Ga0157374_10257857 3300013296 Bacteria 1717
345 Ga0157374_10440266 3300013296 Bacteria 1304
346 Ga0157378_10140615 3300013297 Bacteria 2241
347 Ga0157372_10078064 3300013307 Bacteria 3741
348 Ga0157375_10027735 3300013308 Bacteria 5298
349 Ga0157375_10128242 3300013308 Bacteria 2654
350 Ga0157375_10139857 3300013308 Bacteria 2547
351 Ga0157375_10657291 3300013308 Bacteria 1204
352 Ga0163163_10008937 3300014325 Bacteria 8924
353 Ga0163163_10017509 3300014325 Bacteria 6684
354 Ga0163163_10480951 3300014325 Bacteria 1303
355 Ga0157380_10004723 3300014326 Bacteria 9481
356 Ga0157380_10050857 3300014326 Bacteria 3274
357 Ga0157380_10498434 3300014326 Bacteria 1182
358 Ga0157377_10008061 3300014745 Bacteria 5123
359 Ga0157377_10021608 3300014745 Bacteria 3387
360 Ga0157377_10119378 3300014745 Bacteria 1596
361 Ga0157379_10102966 3300014968 Bacteria 2562
362 Ga0157379_10219446 3300014968 Bacteria 1723
363 Ga0157379_10519658 3300014968 Bacteria 1105
364 Ga0163161_10002282 3300017792 Bacteria 13761
365 Ga0163161_10121374 3300017792 Bacteria 1964
366 Ga0207697_10000085 3300025315 Bacteria 41401
367 Ga0207697_10003472 3300025315 Bacteria 7780
368 Ga0207656_10043530 3300025321 Bacteria 1915
369 Ga0207682_10000133 3300025893 Bacteria 33689
370 Ga0207682_10006805 3300025893 Bacteria 4587
371 Ga0207682_10009032 3300025893 Bacteria 3939
372 Ga0207642_10007752 3300025899 Bacteria 3640
373 Ga0207688_10000477 3300025901 Bacteria 19238
374 Ga0207688_10100576 3300025901 Bacteria 1669
375 Ga0207680_10093887 3300025903 Bacteria 1915
376 Ga0207680_10102491 3300025903 Bacteria 1841
377 Ga0207647_10038289 3300025904 Bacteria 3033
378 Ga0207645_10001684 3300025907 Bacteria 17968
379 Ga0207645_10027536 3300025907 Bacteria 3669
380 Ga0207645_10028344 3300025907 Bacteria 3615
381 Ga0207645_10035538 3300025907 Bacteria 3199
382 Ga0207645_10137273 3300025907 Bacteria 1593
383 Ga0207643_10000665 3300025908 Bacteria 21379
384 Ga0207643_10009824 3300025908 Bacteria 5139
385 Ga0207643_10128591 3300025908 Bacteria 1505
386 Ga0207707_10200486 3300025912 Bacteria 1740
387 Ga0207695_10032358 3300025913 Bacteria 5723
388 Ga0207662_10002216 3300025918 Bacteria 9690
389 Ga0207662_10009162 3300025918 Bacteria 5440
390 Ga0207662_10013731 3300025918 Bacteria 4533
391 Ga0207662_10021443 3300025918 Bacteria 3693
392 Ga0207649_10113239 3300025920 Bacteria 1817
393 Ga0207646_10457023 3300025922 Bacteria 1152
394 Ga0207681_10005692 3300025923 Bacteria 7653
395 Ga0207681_10009866 3300025923 Bacteria 5841
396 Ga0207681_10024146 3300025923 Bacteria 3899
397 Ga0207681_10151808 3300025923 Bacteria 1737
398 Ga0207681_10271051 3300025923 Bacteria 1332
399 Ga0207694_10031751 3300025924 Bacteria 4037
400 Ga0207650_10006792 3300025925 Bacteria 7804
401 Ga0207650_10011126 3300025925 Bacteria 6188
402 Ga0207650_10015265 3300025925 Bacteria 5346
403 Ga0207650_10021754 3300025925 Bacteria 4534
404 Ga0207650_10060762 3300025925 Bacteria 2820
405 Ga0207650_10091165 3300025925 Bacteria 2329
406 Ga0207659_10000547 3300025926 Bacteria 22456
407 Ga0207659_10000692 3300025926 Bacteria 20033
408 Ga0207659_10003019 3300025926 Bacteria 10036
409 Ga0207659_10007084 3300025926 Bacteria 6886
410 Ga0207659_10013082 3300025926 Bacteria 5304
411 Ga0207659_10015463 3300025926 Bacteria 4946
412 Ga0207659_10055621 3300025926 Bacteria 2831
413 Ga0207659_10089287 3300025926 Bacteria 2298
414 Ga0207659_10134758 3300025926 Bacteria 1911
415 Ga0207659_10137045 3300025926 Bacteria 1896
416 Ga0207659_10189204 3300025926 Bacteria 1637
417 Ga0207644_10068482 3300025931 Bacteria 2589
418 Ga0207690_10122424 3300025932 Bacteria 1892
419 Ga0207706_10003174 3300025933 Bacteria 15790
420 Ga0207706_10071856 3300025933 Bacteria 3044
421 Ga0207706_10072049 3300025933 Bacteria 3039
422 Ga0207706_10238746 3300025933 Bacteria 1589
423 Ga0207686_10012255 3300025934 Bacteria 4712
424 Ga0207709_10025886 3300025935 Bacteria 3364
425 Ga0207709_10246249 3300025935 Bacteria 1303
426 Ga0207670_10003124 3300025936 Bacteria 8763
427 Ga0207670_10008107 3300025936 Bacteria 5911
428 Ga0207670_10046326 3300025936 Bacteria 2888
429 Ga0207670_10104909 3300025936 Bacteria 2025
430 Ga0207669_10005428 3300025937 Bacteria 5718
431 Ga0207669_10009972 3300025937 Bacteria 4552
432 Ga0207669_10137316 3300025937 Bacteria 1691
433 Ga0207669_10166218 3300025937 Bacteria 1565
434 Ga0207704_10002475 3300025938 Bacteria 8318
435 Ga0207704_10373227 3300025938 Bacteria 1117
436 Ga0207691_10003154 3300025940 Bacteria 16120
437 Ga0207691_10004842 3300025940 Bacteria 13016
438 Ga0207691_10016461 3300025940 Bacteria 7020
439 Ga0207691_10025047 3300025940 Bacteria 5606
440 Ga0207691_10069827 3300025940 Bacteria 3173
441 Ga0207691_10088454 3300025940 Bacteria 2778
442 Ga0207691_10120381 3300025940 Bacteria 2327
443 Ga0207691_10149675 3300025940 Bacteria 2053
444 Ga0207691_10219210 3300025940 Bacteria 1650
445 Ga0207711_10057855 3300025941 Bacteria 3333
446 Ga0207711_10060750 3300025941 Bacteria 3257
447 Ga0207711_10061542 3300025941 Bacteria 3237
448 Ga0207711_10091612 3300025941 Bacteria 2674
449 Ga0207711_10314411 3300025941 Bacteria 1446
450 Ga0207689_10001141 3300025942 Bacteria 25628
451 Ga0207689_10050149 3300025942 Bacteria 3442
452 Ga0207689_10058190 3300025942 Bacteria 3179
453 Ga0207689_10106745 3300025942 Bacteria 2301
454 Ga0207689_10139896 3300025942 Bacteria 1994
455 Ga0207689_10149033 3300025942 Bacteria 1928
456 Ga0207679_10012954 3300025945 Bacteria 5457
457 Ga0207679_10075106 3300025945 Bacteria 2563
458 Ga0207679_10203848 3300025945 Bacteria 1654
459 Ga0207679_10458307 3300025945 Bacteria 1132
460 Ga0207679_10515724 3300025945 Bacteria 1068
461 Ga0207651_10002774 3300025960 Bacteria 8413
462 Ga0207651_10004970 3300025960 Bacteria 6776
463 Ga0207651_10053131 3300025960 Bacteria 2767
464 Ga0207712_10004342 3300025961 Bacteria 8956
465 Ga0207712_10014252 3300025961 Bacteria 5108
466 Ga0207712_10029660 3300025961 Bacteria 3672
467 Ga0207668_10124693 3300025972 Bacteria 1956
468 Ga0207703_10131414 3300026035 Bacteria 2162
469 Ga0207678_10036825 3300026067 Bacteria 4259
470 Ga0207678_10064557 3300026067 Bacteria 3145
471 Ga0207678_10128323 3300026067 Bacteria 2163
472 Ga0207708_10006210 3300026075 Bacteria 8855
473 Ga0207708_10012471 3300026075 Bacteria 6335
474 Ga0207708_10014730 3300026075 Bacteria 5852
475 Ga0207708_10024546 3300026075 Bacteria 4561
476 Ga0207641_10008578 3300026088 Bacteria 8441
477 Ga0207641_10135896 3300026088 Bacteria 2213
478 Ga0207648_10001255 3300026089 Bacteria 28363
479 Ga0207648_10004031 3300026089 Bacteria 15246
480 Ga0207648_10013384 3300026089 Bacteria 7634
481 Ga0207648_10025141 3300026089 Bacteria 5309
482 Ga0207648_10041422 3300026089 Bacteria 4044
483 Ga0207648_10089442 3300026089 Bacteria 2690
484 Ga0207676_10008322 3300026095 Bacteria 7373
485 Ga0207676_10062615 3300026095 Bacteria 2951
486 Ga0207676_10127604 3300026095 Bacteria 2157
487 Ga0207676_10191049 3300026095 Bacteria 1802
488 Ga0207674_10038394 3300026116 Bacteria 4971
489 Ga0207674_10039518 3300026116 Bacteria 4890
490 Ga0207674_10075303 3300026116 Bacteria 3385
491 Ga0207674_10198604 3300026116 Bacteria 1955
492 Ga0207675_100006796 3300026118 Bacteria 10827
493 Ga0207675_100035929 3300026118 Bacteria 4622
494 Ga0207675_100036318 3300026118 Bacteria 4597
495 Ga0207675_100065217 3300026118 Bacteria 3404
496 Ga0207675_100384152 3300026118 Bacteria 1381
497 Ga0207675_100451654 3300026118 Bacteria 1274
498 Ga0207683_10001698 3300026121 Bacteria 19704
499 Ga0207683_10006182 3300026121 Bacteria 10259
500 Ga0207683_10029838 3300026121 Bacteria 4723
501 Ga0207683_10050609 3300026121 Bacteria 3640
502 Ga0207683_10104562 3300026121 Bacteria 2530
503 Ga0207683_10151620 3300026121 Bacteria 2092
504 Ga0207683_10186613 3300026121 Bacteria 1881
505 Ga0207683_10266143 3300026121 Bacteria 1566
506 Ga0207683_10466440 3300026121 Bacteria 1165
507 Ga0209813_10072410 3300027866 Bacteria 1123
508 Ga0207428_10000345 3300027907 Bacteria 60424
509 Ga0207428_10000442 3300027907 Bacteria 50837
510 Ga0207428_10000797 3300027907 Bacteria 35667
511 Ga0207428_10000936 3300027907 Bacteria 32455
512 Ga0207428_10001419 3300027907 Bacteria 25210
513 Ga0207428_10009368 3300027907 Bacteria 8783
514 Ga0207428_10056404 3300027907 Bacteria 3122
515 Ga0268266_10062006 3300028379 Bacteria 3226
516 Ga0268265_10000237 3300028380 Bacteria 62935
517 Ga0268265_10046338 3300028380 Bacteria 3249
518 Ga0268265_10253096 3300028380 Bacteria 1561
519 Ga0268265_10372315 3300028380 Bacteria 1311
520 Ga0268264_10018583 3300028381 Bacteria 5684
521 Ga0268264_10031761 3300028381 Bacteria 4330
522 Ga0268264_10228114 3300028381 Bacteria 1718
523 Ga0307408_100005249 3300031548 Bacteria 8683
524 Ga0307408_100035572 3300031548 Bacteria 3496
525 Ga0307408_100053869 3300031548 Bacteria 2907
526 Ga0307408_100067524 3300031548 Bacteria 2630
527 Ga0307408_100077153 3300031548 Bacteria 2481
528 Ga0307408_100265426 3300031548 Bacteria 1423
529 Ga0307405_10027142 3300031731 Bacteria 3315
530 Ga0307413_10041280 3300031824 Bacteria 2700
531 Ga0307413_10113587 3300031824 Bacteria 1818
532 Ga0307413_10125422 3300031824 Bacteria 1747
533 Ga0307410_10011774 3300031852 Bacteria 5021
534 Ga0307410_10151072 3300031852 Bacteria 1729
535 Ga0307410_10165951 3300031852 Bacteria 1659
536 Ga0307410_10330013 3300031852 Bacteria 1213
537 Ga0307407_10006608 3300031903 Bacteria 5176
538 Ga0307407_10011965 3300031903 Bacteria 4154
539 Ga0307412_10160733 3300031911 Bacteria 1668
540 Ga0307412_10198103 3300031911 Bacteria 1523
541 Ga0307409_100030573 3300031995 Bacteria 3871
542 Ga0307409_100106260 3300031995 Bacteria 2342
543 Ga0307409_100318872 3300031995 Bacteria 1454
544 Ga0307409_100610455 3300031995 Bacteria 1079
545 Ga0307416_100001676 3300032002 Bacteria 12247
546 Ga0307416_100008926 3300032002 Bacteria 6515
547 Ga0307416_100011349 3300032002 Bacteria 5933
548 Ga0307416_100027563 3300032002 Bacteria 4210
549 Ga0307416_100157619 3300032002 Bacteria 2093
550 Ga0307416_100160896 3300032002 Bacteria 2075
551 Ga0307416_100189115 3300032002 Bacteria 1939
552 Ga0307416_100305580 3300032002 Bacteria 1584
553 Ga0307416_100441539 3300032002 Bacteria 1351
554 Ga0307416_100471192 3300032002 Bacteria 1313
555 Ga0307414_10104991 3300032004 Bacteria 2135
556 Ga0307414_10388833 3300032004 Bacteria 1208
557 Ga0307411_10003321 3300032005 Bacteria 7442
558 Ga0307411_10045425 3300032005 Bacteria 2825
559 Ga0307411_10053902 3300032005 Bacteria 2638
560 Ga0307411_10161525 3300032005 Bacteria 1679
561 Ga0307415_100016964 3300032126 Bacteria 4355
562 Ga0307415_100028857 3300032126 Bacteria 3537
563 Ga0307415_100045124 3300032126 Bacteria 2953
564 Ga0307415_100046191 3300032126 Bacteria 2924
565 Ga0307415_100091555 3300032126 Bacteria 2203
566 Ga0373939_0066331 3300035114 Bacteria 1163
567 Ga0373941_0059513 3300035115 Bacteria 1239
568 Ga0373961_0036695 3300035241 Bacteria 1397
569 Ga0373933_0089143 3300035724 Bacteria 1901
570 Ga0373947_0108679 3300035725 Bacteria 1750
571 Ga0373937_0021608 3300036401 Bacteria 5775
572 Ga0373937_0101730 3300036401 Bacteria 2667
573 Ga0373925_0093933 3300037068 Bacteria 2296
574 Ga0439453_0001566 3300041408 Bacteria 2970
575 Ga0451853_2880251 3300041512 Bacteria 1131
576 Ga0439431_0008887 3300041997 Bacteria 2264
577 Ga0439433_0006623 3300041999 Bacteria 2496
578 Ga0439433_0015476 3300041999 Bacteria 1684
579 Ga0439450_001103 3300042008 Bacteria 3832
580 Ga0439435_0062187 3300042436 Bacteria 1090
581 Ga0439444_0011487 3300042437 Bacteria 1435
582 Ga0439460_0018118 3300042461 Bacteria 1893
583 Ga0453684_0075558 3300044712 Bacteria 4234
584 Ga0451576_0033144 3300045051 Bacteria 5491
585 Ga0451576_0053960 3300045051 Bacteria 4208
586 Ga0451576_0127060 3300045051 Bacteria 2657
587 Ga0451576_0220695 3300045051 Bacteria 1979
588 Ga0451576_0702350 3300045051 Bacteria 1063
589 Ga0495603_0014148 3300046455 Bacteria 4828
590 Ga0495603_0018601 3300046455 Bacteria 4204
591 Ga0495653_0077286 3300046463 Bacteria 2472
592 Ga0495594_0002079 3300046499 Bacteria 10426
593 Ga0495594_0037031 3300046499 Bacteria 2662
594 Ga0495643_0004655 3300046522 Bacteria 9528
595 Ga0495621_0020840 3300046539 Bacteria 2155
596 Ga0495645_0013681 3300046543 Bacteria 5748
597 Ga0495633_0089624 3300046558 Bacteria 1430
598 Ga0495656_0022751 3300046615 Bacteria 2459
599 Ga0495656_0250342 3300046615 Bacteria 895
600 Ga0495635_0227777 3300046663 Bacteria 1259
601 Ga0495659_0008894 3300046664 Bacteria 3198
602 Ga0495647_0199229 3300046681 Bacteria 878
603 Ga0495658_0146396 3300046683 Bacteria 1448
604 Ga0495613_0133006 3300046689 Bacteria 1781
605 Ga0495670_0067914 3300046691 Bacteria 1800
606 Ga0495600_0107423 3300046809 Bacteria 1818
607 Ga0495600_0158676 3300046809 Bacteria 1463
608 Ga0495674_0209246 3300047319 Bacteria 1616
609 Ga0496102_0047284 3300048905 Bacteria 3909
610 Ga0496104_0007007 3300048907 Bacteria 9941
611 Ga0496105_0012323 3300048908 Bacteria 6770
612 Ga0496107_0162973 3300048910 Bacteria 1653
613 Ga0496108_0010549 3300048911 Bacteria 7504
614 Ga0496109_0021884 3300048912 Bacteria 5660
615 Ga0496109_0026200 3300048912 Bacteria 5198
616 Ga0496109_0058835 3300048912 Bacteria 3511
617 Ga0496109_0113111 3300048912 Bacteria 2525
618 Ga0496109_0329736 3300048912 Bacteria 1441
619 Ga0496110_0000173 3300048913 Bacteria 39810
620 Ga0496110_0067830 3300048913 Bacteria 3157
621 Ga0496110_0285082 3300048913 Bacteria 1504
622 Ga0496111_0041471 3300048914 Bacteria 3303
623 Ga0496112_0003067 3300048915 Bacteria 13686
624 Ga0496112_0085075 3300048915 Bacteria 3129
625 Ga0496112_0182858 3300048915 Bacteria 2060
626 Ga0496112_0189538 3300048915 Bacteria 2019
627 Ga0496113_0036162 3300048916 Bacteria 3617
628 Ga0496113_0343094 3300048916 Bacteria 1198
629 Ga0496113_0435909 3300048916 Bacteria 1053
630 Ga0501036_0068929 3300049572 Bacteria 2993
631 Ga0501039_0020851 3300049575 Bacteria 5024
632 Ga0501039_0046303 3300049575 Bacteria 3360
633 Ga0501040_0017841 3300049576 Bacteria 4712
634 Ga0501040_0127394 3300049576 Bacteria 1789
635 Ga0501041_0013579 3300049577 Bacteria 4831
636 Ga0501041_0023123 3300049577 Bacteria 3727
637 Ga0501042_0003074 3300049578 Bacteria 10391
638 Ga0501042_0018746 3300049578 Bacteria 4796
639 Ga0501042_0037051 3300049578 Bacteria 3461
640 Ga0501048_0058327 3300049582 Bacteria 2736
641 Ga0501048_0151841 3300049582 Bacteria 1639
642 Ga0501048_0243475 3300049582 Bacteria 1276
643 Ga0501048_0330636 3300049582 Bacteria 1086
644 Ga0501067_0043410 3300049583 Bacteria 2497
645 Ga0501068_0190066 3300049584 Bacteria 1300
646 Ga0501071_0008790 3300049587 Bacteria 6692
647 Ga0501071_0103724 3300049587 Bacteria 2098
648 Ga0501071_0237121 3300049587 Bacteria 1375
649 Ga0501071_0305292 3300049587 Bacteria 1207
650 Ga0501072_0006979 3300049588 Bacteria 8572
651 Ga0501072_0097558 3300049588 Bacteria 2336
652 Ga0501072_0157426 3300049588 Bacteria 1811
653 Ga0501073_0100339 3300049589 Bacteria 2010
654 Ga0501074_0056623 3300049590 Bacteria 2826
655 Ga0501075_0035734 3300049591 Bacteria 3707
656 Ga0501075_0282174 3300049591 Bacteria 1265
657 Ga0501076_0028332 3300049592 Bacteria 4349
658 Ga0501076_0148221 3300049592 Bacteria 1908
659 Ga0501076_0335314 3300049592 Bacteria 1241
660 Ga0501077_0189974 3300049593 Bacteria 1305
661 Ga0501079_0288910 3300049741 Bacteria 1282
662 Ga0501079_0407715 3300049741 Bacteria 1066
663 Ga0501080_0018993 3300049742 Bacteria 6366
664 Ga0501080_0062506 3300049742 Bacteria 3466
665 Ga0501080_0466970 3300049742 Bacteria 1130
666 Ga0501080_0478582 3300049742 Bacteria 1114
667 Ga0501081_0026342 3300049743 Bacteria 3920
668 Ga0501081_0067955 3300049743 Bacteria 2480
669 Ga0501081_0093961 3300049743 Bacteria 2112
670 Ga0501081_0144939 3300049743 Bacteria 1704
671 Ga0501081_0468481 3300049743 Bacteria 937
672 Ga0501268_006991 3300049765 Bacteria 1674
673 Ga0501273_001709 3300049770 Bacteria 2142
674 Ga0501035_0422357 3300049822 Bacteria 1107
675 Ga0501045_0028998 3300049824 Bacteria 3996
676 Ga0501045_0068909 3300049824 Bacteria 2600
677 Ga0501045_0119983 3300049824 Bacteria 1952
678 Ga0501045_0194399 3300049824 Bacteria 1512
679 Ga0501045_0194645 3300049824 Bacteria 1511
680 nmdc:mga03683_10291_c1 3300050489 Bacteria 3352
681 nmdc:mga00v17_14777_c1 3300050491 Bacteria 4367
682 nmdc:mga0yw44_12660_c1 3300050492 Bacteria 4407
683 nmdc:mga0k408_15222_c1 3300050493 Bacteria 4250
684 nmdc:mga0k408_20477_c2 3300050493 Bacteria 1785
685 nmdc:mga0k408_38272_c1 3300050493 Bacteria 2753
686 nmdc:mga0k408_58872_c1 3300050493 Bacteria 1439
687 nmdc:mga06z11_4815_c1 3300050494 Bacteria 5342
688 nmdc:mga04h51_26461_c1 3300050495 Bacteria 1794
689 nmdc:mga05p37_1008_c1 3300050507 Bacteria 32087
690 nmdc:mga05p37_194947_c1 3300050507 Bacteria 2457
691 nmdc:mga05p37_202218_c1 3300050507 Bacteria 2405
692 nmdc:mga05p37_2349_c1 3300050507 Bacteria 22009
693 nmdc:mga05p37_237136_c1 3300050507 Bacteria 2195
694 nmdc:mga05p37_316534_c1 3300050507 Bacteria 1848
695 nmdc:mga05p37_404899_c1 3300050507 Bacteria 1592
696 nmdc:mga05p37_43213_c1 3300050507 Bacteria 5542
697 nmdc:mga05p37_49784_c1 3300050507 Bacteria 5154
698 nmdc:mga05p37_6039_c1 3300050507 Bacteria 14258
699 nmdc:mga05p37_91_c1 3300050507 Bacteria 80826
700 nmdc:mga09592_19340_c1 3300050508 Bacteria 5591
701 nmdc:mga09592_20433_c1 3300050508 Bacteria 5443
702 nmdc:mga09592_262703_c1 3300050508 Bacteria 1497
703 nmdc:mga09592_26812_c1 3300050508 Bacteria 4776
704 nmdc:mga09592_313784_c1 3300050508 Bacteria 1359
705 nmdc:mga09592_3165_c1 3300050508 Bacteria 13371
706 nmdc:mga09592_32082_c1 3300050508 Bacteria 4378
707 nmdc:mga09592_3756_c1 3300050508 Bacteria 12236
708 nmdc:mga0qj67_11727_c1 3300050509 Bacteria 6577
709 nmdc:mga0qj67_16962_c1 3300050509 Bacteria 5531
710 nmdc:mga0qj67_173725_c1 3300050509 Bacteria 1750
711 nmdc:mga0qj67_191749_c1 3300050509 Bacteria 1661
712 nmdc:mga0qj67_38426_c1 3300050509 Bacteria 3755
713 nmdc:mga0qj67_45051_c1 3300050509 Bacteria 3480
714 nmdc:mga0qj67_519_c1 3300050509 Bacteria 26189
715 nmdc:mga0qj67_60258_c1 3300050509 Bacteria 3011
716 nmdc:mga0qj67_73799_c1 3300050509 Bacteria 2725
717 nmdc:mga06r32_136349_c1 3300050510 Bacteria 2429
718 nmdc:mga06r32_245509_c1 3300050510 Bacteria 1778
719 nmdc:mga06r32_24748_c1 3300050510 Bacteria 5578
720 nmdc:mga06r32_31316_c1 3300050510 Bacteria 4995
721 nmdc:mga06r32_331844_c1 3300050510 Bacteria 1506
722 nmdc:mga06r32_389053_c1 3300050510 Bacteria 1377
723 nmdc:mga06r32_54708_c1 3300050510 Bacteria 3827
724 nmdc:mga06r32_64818_c1 3300050510 Bacteria 3523
725 nmdc:mga06r32_74004_c1 3300050510 Bacteria 3301
726 nmdc:mga08y16_119762_c1 3300050511 Bacteria 2740
727 nmdc:mga08y16_13098_c1 3300050511 Bacteria 8725
728 nmdc:mga08y16_133933_c1 3300050511 Bacteria 2575
729 nmdc:mga08y16_1590_c1 3300050511 Bacteria 22933
730 nmdc:mga08y16_1706_c1 3300050511 Bacteria 22281
731 nmdc:mga08y16_17564_c1 3300050511 Bacteria 7535
732 nmdc:mga08y16_244821_c1 3300050511 Bacteria 1853
733 nmdc:mga08y16_329670_c1 3300050511 Bacteria 1570
734 nmdc:mga08y16_3324_c1 3300050511 Bacteria 16650
735 nmdc:mga08y16_3636_c1 3300050511 Bacteria 16020
736 nmdc:mga08y16_434210_c1 3300050511 Bacteria 1341
737 nmdc:mga08y16_519993_c1 3300050511 Bacteria 1207
738 nmdc:mga08y16_522_c1 3300050511 Bacteria 35470
739 nmdc:mga08y16_82857_c1 3300050511 Bacteria 3343
740 nmdc:mga0n895_100512_c1 3300050512 Bacteria 2901
741 nmdc:mga0n895_10318_c1 3300050512 Bacteria 8239
742 nmdc:mga0n895_410624_c1 3300050512 Bacteria 1369
743 nmdc:mga0n895_77621_c1 3300050512 Bacteria 3304
744 nmdc:mga0n895_9242_c1 3300050512 Bacteria 8613
745 nmdc:mga0rr50_115742_c1 3300050513 Bacteria 2128
746 nmdc:mga0rr50_197449_c1 3300050513 Bacteria 1652
747 nmdc:mga0rr50_47753_c1 3300050513 Bacteria 3161
748 nmdc:mga0rr50_62952_c1 3300050513 Bacteria 2800
749 nmdc:mga0a205_189780_c1 3300050515 Bacteria 1948
750 nmdc:mga0a205_324650_c1 3300050515 Bacteria 1410
751 nmdc:mga0a205_38800_c1 3300050515 Bacteria 4583
752 nmdc:mga0a205_577_c1 3300050515 Bacteria 29054
753 nmdc:mga0a205_74864_c1 3300050515 Bacteria 3271
754 nmdc:mga0a205_91533_c1 3300050515 Bacteria 2939
755 Ga0495619_0065626 3300053085 Bacteria 2422
756 Ga0495619_0097589 3300053085 Bacteria 1997
757 Ga0500628_006964 3300053129 Bacteria 1925
758 Ga0501084_0114762 3300054114 Bacteria 2264
759 Ga0501084_0174835 3300054114 Bacteria 1812
760 Ga0501084_0306243 3300054114 Bacteria 1342
761 Ga0501084_0400122 3300054114 Bacteria 1161
762 Ga0590071_000111 3300059421 Bacteria 23043
763 Ga0590071_000572 3300059421 Bacteria 10621
764 Ga0590071_041812 3300059421 Bacteria 1104
765 Ga0590074_000303 3300059423 Bacteria 6759
766 Ga0590074_004493 3300059423 Bacteria 2308
767 Ga0590074_013846 3300059423 Bacteria 1364
768 Ga0590075_000114 3300059424 Bacteria 20697
769 Ga0590075_000278 3300059424 Bacteria 14507
770 Ga0590075_000873 3300059424 Bacteria 7888
771 Ga0590077_000095 3300059426 Bacteria 22912
772 Ga0590077_000129 3300059426 Bacteria 20394
773 Ga0590077_002077 3300059426 Bacteria 4385
774 Ga0501082_0212131 3300060353 Bacteria 1684
775 Ga0530510_0021824 3300061734 Bacteria 4557
776 Ga0530510_0025071 3300061734 Bacteria 4263

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049590 Ga0501074_0056623 Ga0501074_0056623_17_802 261
2 3300049743 Ga0501081_0468481 Ga0501081_0468481_132_917 261
3 3300046681 Ga0495647_0199229 Ga0495647_0199229_70_864 264
4 3300048915 Ga0496112_0182858 Ga0496112_0182858_13_846 277
5 3300046615 Ga0495656_0250342 Ga0495656_0250342_23_865 280
6 3300049582 Ga0501048_0330636 Ga0501048_0330636_183_1049 288
7 3300005614 Ga0068856_100175684 Ga0068856_1001756842 293
8 3300050493 nmdc:mga0k408_15222_c1 nmdc:mga0k408_15222_c1_1418_2311 296
9 3300049587 Ga0501071_0008790 Ga0501071_0008790_40_954 304
10 3300005290 Ga0065712_10130484 Ga0065712_101304842 305
11 3300009147 Ga0114129_10312292 Ga0114129_103122921 306
12 3300050510 nmdc:mga06r32_389053_c1 nmdc:mga06r32_389053_c1_196_1116 306
13 3300005617 Ga0068859_100297212 Ga0068859_1002972122 307
14 3300006931 Ga0097620_100297207 Ga0097620_1002972072 307
15 3300025941 Ga0207711_10061542 Ga0207711_100615423 307
16 3300026121 Ga0207683_10266143 Ga0207683_102661432 307
17 3300005336 Ga0070680_100370492 Ga0070680_1003704921 308
18 3300049592 Ga0501076_0148221 Ga0501076_0148221_96_1034 308
19 3300005353 Ga0070669_100122469 Ga0070669_1001224692 309
20 3300006237 Ga0097621_100136293 Ga0097621_1001362932 309
21 3300009094 Ga0111539_10212449 Ga0111539_102124491 309
22 3300025923 Ga0207681_10151808 Ga0207681_101518083 309
23 3300031548 Ga0307408_100077153 Ga0307408_1000771533 309
24 3300041999 Ga0439433_0015476 Ga0439433_0015476_163_1107 309
25 3300046463 Ga0495653_0077286 Ga0495653_0077286_1512_2444 309
26 3300050511 nmdc:mga08y16_434210_c1 nmdc:mga08y16_434210_c1_162_1094 309
27 3300006852 Ga0075433_10129411 Ga0075433_101294112 310
28 3300035724 Ga0373933_0089143 Ga0373933_0089143_890_1825 311
29 3300036401 Ga0373937_0021608 Ga0373937_0021608_4638_5573 311
30 3300047319 Ga0495674_0209246 Ga0495674_0209246_234_1169 311
31 3300049824 Ga0501045_0194645 Ga0501045_0194645_337_1275 311
32 3300009147 Ga0114129_10004740 Ga0114129_1000474014 312
33 3300009177 Ga0105248_10194501 Ga0105248_101945012 312
34 3300025941 Ga0207711_10091612 Ga0207711_100916123 312
35 3300005618 Ga0068864_100218930 Ga0068864_1002189302 313
36 3300036401 Ga0373937_0101730 Ga0373937_0101730_1368_2315 313
37 3300046543 Ga0495645_0013681 Ga0495645_0013681_1806_2753 313
38 3300046663 Ga0495635_0227777 Ga0495635_0227777_192_1139 313
39 3300046683 Ga0495658_0146396 Ga0495658_0146396_167_1114 313
40 3300046689 Ga0495613_0133006 Ga0495613_0133006_322_1269 313
41 3300046809 Ga0495600_0107423 Ga0495600_0107423_167_1114 313
42 3300050515 nmdc:mga0a205_74864_c1 nmdc:mga0a205_74864_c1_54_998 313
43 3300053085 Ga0495619_0065626 Ga0495619_0065626_1292_2239 313
44 3300006042 Ga0075368_10092734 Ga0075368_100927342 314
45 3300006178 Ga0075367_10006522 Ga0075367_100065226 314
46 3300006195 Ga0075366_10027436 Ga0075366_100274363 314
47 3300048916 Ga0496113_0435909 Ga0496113_0435909_26_973 314
48 3300042461 Ga0439460_0018118 Ga0439460_0018118_116_1063 315
49 3300049582 Ga0501048_0058327 Ga0501048_0058327_1083_2030 315
50 3300049584 Ga0501068_0190066 Ga0501068_0190066_335_1282 315
51 3300049742 Ga0501080_0478582 Ga0501080_0478582_28_975 315
52 3300049743 Ga0501081_0093961 Ga0501081_0093961_99_1046 315
53 3300005329 Ga0070683_100016062 Ga0070683_1000160623 316
54 3300005455 Ga0070663_100403407 Ga0070663_1004034071 316
55 3300005547 Ga0070693_100081703 Ga0070693_1000817032 316
56 3300006846 Ga0075430_100093115 Ga0075430_1000931152 316
57 3300006847 Ga0075431_100014360 Ga0075431_1000143603 316
58 3300009147 Ga0114129_10009630 Ga0114129_100096306 316
59 3300009147 Ga0114129_10024852 Ga0114129_100248523 316
60 3300027866 Ga0209813_10072410 Ga0209813_100724101 316
61 3300035725 Ga0373947_0108679 Ga0373947_0108679_422_1372 316
62 3300041512 Ga0451853_2880251 Ga0451853_2880251_113_1063 316
63 3300046809 Ga0495600_0158676 Ga0495600_0158676_205_1155 316
64 3300048915 Ga0496112_0189538 Ga0496112_0189538_938_1891 316
65 3300050493 nmdc:mga0k408_58872_c1 nmdc:mga0k408_58872_c1_394_1344 316
66 3300050507 nmdc:mga05p37_1008_c1 nmdc:mga05p37_1008_c1_21204_22154 316
67 3300050510 nmdc:mga06r32_136349_c1 nmdc:mga06r32_136349_c1_1297_2247 316
68 3300059421 Ga0590071_041812 Ga0590071_041812_124_1074 316
69 3300005290 Ga0065712_10084064 Ga0065712_100840643 317
70 3300005331 Ga0070670_100019868 Ga0070670_1000198682 317
71 3300005354 Ga0070675_100042602 Ga0070675_1000426023 317
72 3300005367 Ga0070667_100149903 Ga0070667_1001499033 317
73 3300005543 Ga0070672_100484818 Ga0070672_1004848181 317
74 3300005615 Ga0070702_100136052 Ga0070702_1001360522 317
75 3300006038 Ga0075365_10039266 Ga0075365_100392663 317
76 3300006358 Ga0068871_100204475 Ga0068871_1002044751 317
77 3300006846 Ga0075430_100027691 Ga0075430_1000276915 317
78 3300006847 Ga0075431_100157670 Ga0075431_1001576703 317
79 3300009177 Ga0105248_10314497 Ga0105248_103144971 317
80 3300009177 Ga0105248_10378264 Ga0105248_103782641 317
81 3300013296 Ga0157374_10440266 Ga0157374_104402662 317
82 3300013307 Ga0157372_10078064 Ga0157372_100780643 317
83 3300013308 Ga0157375_10657291 Ga0157375_106572911 317
84 3300014968 Ga0157379_10519658 Ga0157379_105196581 317
85 3300025315 Ga0207697_10003472 Ga0207697_100034727 317
86 3300025925 Ga0207650_10060762 Ga0207650_100607623 317
87 3300025926 Ga0207659_10089287 Ga0207659_100892873 317
88 3300025926 Ga0207659_10137045 Ga0207659_101370452 317
89 3300025937 Ga0207669_10137316 Ga0207669_101373163 317
90 3300025938 Ga0207704_10373227 Ga0207704_103732271 317
91 3300025942 Ga0207689_10106745 Ga0207689_101067451 317
92 3300026121 Ga0207683_10104562 Ga0207683_101045623 317
93 3300028380 Ga0268265_10372315 Ga0268265_103723152 317
94 3300031548 Ga0307408_100053869 Ga0307408_1000538693 317
95 3300031824 Ga0307413_10125422 Ga0307413_101254222 317
96 3300031852 Ga0307410_10151072 Ga0307410_101510722 317
97 3300032002 Ga0307416_100011349 Ga0307416_1000113494 317
98 3300032126 Ga0307415_100045124 Ga0307415_1000451243 317
99 3300032126 Ga0307415_100046191 Ga0307415_1000461912 317
100 3300042436 Ga0439435_0062187 Ga0439435_0062187_20_976 317
101 3300045051 Ga0451576_0127060 Ga0451576_0127060_1566_2519 317
102 3300048905 Ga0496102_0047284 Ga0496102_0047284_851_1804 317
103 3300048912 Ga0496109_0058835 Ga0496109_0058835_1729_2682 317
104 3300048912 Ga0496109_0113111 Ga0496109_0113111_1158_2111 317
105 3300048913 Ga0496110_0067830 Ga0496110_0067830_1921_2874 317
106 3300048913 Ga0496110_0285082 Ga0496110_0285082_23_976 317
107 3300048915 Ga0496112_0085075 Ga0496112_0085075_18_971 317
108 3300048916 Ga0496113_0036162 Ga0496113_0036162_2333_3286 317
109 3300049572 Ga0501036_0068929 Ga0501036_0068929_533_1489 317
110 3300049575 Ga0501039_0046303 Ga0501039_0046303_591_1547 317
111 3300049576 Ga0501040_0127394 Ga0501040_0127394_172_1128 317
112 3300049577 Ga0501041_0023123 Ga0501041_0023123_1762_2718 317
113 3300049578 Ga0501042_0018746 Ga0501042_0018746_3526_4482 317
114 3300049578 Ga0501042_0037051 Ga0501042_0037051_438_1394 317
115 3300049587 Ga0501071_0103724 Ga0501071_0103724_1008_1964 317
116 3300049588 Ga0501072_0097558 Ga0501072_0097558_10_966 317
117 3300049591 Ga0501075_0035734 Ga0501075_0035734_740_1696 317
118 3300049591 Ga0501075_0282174 Ga0501075_0282174_28_984 317
119 3300049592 Ga0501076_0028332 Ga0501076_0028332_3281_4237 317
120 3300049592 Ga0501076_0335314 Ga0501076_0335314_99_1055 317
121 3300049742 Ga0501080_0062506 Ga0501080_0062506_2378_3334 317
122 3300049743 Ga0501081_0144939 Ga0501081_0144939_122_1075 317
123 3300049824 Ga0501045_0028998 Ga0501045_0028998_1004_1960 317
124 3300049824 Ga0501045_0068909 Ga0501045_0068909_479_1435 317
125 3300050492 nmdc:mga0yw44_12660_c1 nmdc:mga0yw44_12660_c1_2013_2966 317
126 3300050509 nmdc:mga0qj67_191749_c1 nmdc:mga0qj67_191749_c1_76_1032 317
127 3300050510 nmdc:mga06r32_54708_c1 nmdc:mga06r32_54708_c1_1128_2084 317
128 3300050510 nmdc:mga06r32_64818_c1 nmdc:mga06r32_64818_c1_188_1144 317
129 3300050510 nmdc:mga06r32_74004_c1 nmdc:mga06r32_74004_c1_2152_3108 317
130 3300050511 nmdc:mga08y16_519993_c1 nmdc:mga08y16_519993_c1_101_1057 317
131 3300053085 Ga0495619_0097589 Ga0495619_0097589_666_1622 317
132 3300053129 Ga0500628_006964 Ga0500628_006964_528_1484 317
133 3300054114 Ga0501084_0174835 Ga0501084_0174835_663_1619 317
134 3300054114 Ga0501084_0306243 Ga0501084_0306243_87_1043 317
135 3300059421 Ga0590071_000111 Ga0590071_000111_7920_8876 317
136 3300059423 Ga0590074_004493 Ga0590074_004493_801_1757 317
137 3300059424 Ga0590075_000278 Ga0590075_000278_13483_14439 317
138 3300059426 Ga0590077_000095 Ga0590077_000095_211_1167 317
139 3300061734 Ga0530510_0021824 Ga0530510_0021824_1657_2613 317
140 3300006038 Ga0075365_10042337 Ga0075365_100423372 318
141 3300006042 Ga0075368_10042760 Ga0075368_100427603 318
142 3300006177 Ga0075362_10003939 Ga0075362_100039394 318
143 3300006178 Ga0075367_10054158 Ga0075367_100541583 318
144 3300006195 Ga0075366_10005889 Ga0075366_100058896 318
145 3300006195 Ga0075366_10026146 Ga0075366_100261463 318
146 3300006844 Ga0075428_100000439 Ga0075428_1000004399 318
147 3300006844 Ga0075428_100411845 Ga0075428_1004118451 318
148 3300006846 Ga0075430_100000107 Ga0075430_10000010711 318
149 3300006846 Ga0075430_100064303 Ga0075430_1000643033 318
150 3300006847 Ga0075431_100157785 Ga0075431_1001577851 318
151 3300006847 Ga0075431_100210498 Ga0075431_1002104982 318
152 3300006847 Ga0075431_100276559 Ga0075431_1002765592 318
153 3300006852 Ga0075433_10019190 Ga0075433_100191901 318
154 3300006880 Ga0075429_100004861 Ga0075429_1000048617 318
155 3300006880 Ga0075429_100065379 Ga0075429_1000653793 318
156 3300009094 Ga0111539_10003820 Ga0111539_1000382015 318
157 3300009147 Ga0114129_10000076 Ga0114129_1000007647 318
158 3300009147 Ga0114129_10013579 Ga0114129_1001357911 318
159 3300009147 Ga0114129_10033236 Ga0114129_100332365 318
160 3300025912 Ga0207707_10200486 Ga0207707_102004863 318
161 3300025913 Ga0207695_10032358 Ga0207695_100323584 318
162 3300027907 Ga0207428_10000797 Ga0207428_1000079717 318
163 3300031548 Ga0307408_100005249 Ga0307408_1000052493 318
164 3300031548 Ga0307408_100035572 Ga0307408_1000355722 318
165 3300031548 Ga0307408_100067524 Ga0307408_1000675241 318
166 3300031548 Ga0307408_100265426 Ga0307408_1002654261 318
167 3300031731 Ga0307405_10027142 Ga0307405_100271423 318
168 3300031824 Ga0307413_10113587 Ga0307413_101135873 318
169 3300031852 Ga0307410_10011774 Ga0307410_100117742 318
170 3300031852 Ga0307410_10330013 Ga0307410_103300131 318
171 3300031903 Ga0307407_10011965 Ga0307407_100119652 318
172 3300031911 Ga0307412_10198103 Ga0307412_101981031 318
173 3300031995 Ga0307409_100030573 Ga0307409_1000305732 318
174 3300032002 Ga0307416_100027563 Ga0307416_1000275632 318
175 3300032002 Ga0307416_100160896 Ga0307416_1001608963 318
176 3300032002 Ga0307416_100441539 Ga0307416_1004415392 318
177 3300032002 Ga0307416_100471192 Ga0307416_1004711921 318
178 3300032005 Ga0307411_10045425 Ga0307411_100454253 318
179 3300032126 Ga0307415_100028857 Ga0307415_1000288573 318
180 3300032126 Ga0307415_100091555 Ga0307415_1000915552 318
181 3300037068 Ga0373925_0093933 Ga0373925_0093933_432_1391 318
182 3300042008 Ga0439450_001103 Ga0439450_001103_306_1265 318
183 3300049582 Ga0501048_0151841 Ga0501048_0151841_235_1194 318
184 3300049770 Ga0501273_001709 Ga0501273_001709_1153_2109 318
185 3300050489 nmdc:mga03683_10291_c1 nmdc:mga03683_10291_c1_509_1468 318
186 3300050491 nmdc:mga00v17_14777_c1 nmdc:mga00v17_14777_c1_1969_2928 318
187 3300050493 nmdc:mga0k408_20477_c2 nmdc:mga0k408_20477_c2_47_1006 318
188 3300050493 nmdc:mga0k408_38272_c1 nmdc:mga0k408_38272_c1_1152_2111 318
189 3300050494 nmdc:mga06z11_4815_c1 nmdc:mga06z11_4815_c1_4127_5107 318
190 3300050495 nmdc:mga04h51_26461_c1 nmdc:mga04h51_26461_c1_95_1075 318
191 3300050507 nmdc:mga05p37_194947_c1 nmdc:mga05p37_194947_c1_57_1016 318
192 3300050507 nmdc:mga05p37_49784_c1 nmdc:mga05p37_49784_c1_2302_3261 318
193 3300050507 nmdc:mga05p37_91_c1 nmdc:mga05p37_91_c1_52354_53313 318
194 3300050508 nmdc:mga09592_20433_c1 nmdc:mga09592_20433_c1_361_1320 318
195 3300050508 nmdc:mga09592_3165_c1 nmdc:mga09592_3165_c1_7844_8803 318
196 3300050509 nmdc:mga0qj67_519_c1 nmdc:mga0qj67_519_c1_19118_20077 318
197 3300050511 nmdc:mga08y16_1590_c1 nmdc:mga08y16_1590_c1_4089_5048 318
198 3300005293 Ga0065715_10035970 Ga0065715_100359701 319
199 3300005564 Ga0070664_100512773 Ga0070664_1005127731 319
200 3300005618 Ga0068864_100264108 Ga0068864_1002641082 319
201 3300005981 Ga0081538_10064337 Ga0081538_100643373 319
202 3300009147 Ga0114129_10755950 Ga0114129_107559502 319
203 3300009177 Ga0105248_10042462 Ga0105248_100424621 319
204 3300025945 Ga0207679_10458307 Ga0207679_104583071 319
205 3300032002 Ga0307416_100157619 Ga0307416_1001576192 319
206 3300049741 Ga0501079_0407715 Ga0501079_0407715_43_1002 319
207 3300050511 nmdc:mga08y16_329670_c1 nmdc:mga08y16_329670_c1_499_1458 319
208 3300059421 Ga0590071_000572 Ga0590071_000572_5510_6481 319
209 3300059423 Ga0590074_000303 Ga0590074_000303_3793_4764 319
210 3300059423 Ga0590074_013846 Ga0590074_013846_201_1160 319
211 3300059424 Ga0590075_000114 Ga0590075_000114_13470_14441 319
212 3300059424 Ga0590075_000873 Ga0590075_000873_5339_6298 319
213 3300059426 Ga0590077_000129 Ga0590077_000129_11710_12669 319
214 3300059426 Ga0590077_002077 Ga0590077_002077_3055_4026 319
215 3300005290 Ga0065712_10092356 Ga0065712_100923563 320
216 3300005328 Ga0070676_10214393 Ga0070676_102143932 320
217 3300005330 Ga0070690_100038525 Ga0070690_1000385253 320
218 3300005331 Ga0070670_100001472 Ga0070670_1000014727 320
219 3300005331 Ga0070670_100070492 Ga0070670_1000704922 320
220 3300005334 Ga0068869_100118017 Ga0068869_1001180172 320
221 3300005334 Ga0068869_100184748 Ga0068869_1001847481 320
222 3300005340 Ga0070689_100025190 Ga0070689_1000251905 320
223 3300005340 Ga0070689_100045884 Ga0070689_1000458842 320
224 3300005343 Ga0070687_100045461 Ga0070687_1000454612 320
225 3300005353 Ga0070669_100102117 Ga0070669_1001021172 320
226 3300005354 Ga0070675_100001179 Ga0070675_1000011795 320
227 3300005355 Ga0070671_100167583 Ga0070671_1001675833 320
228 3300005356 Ga0070674_100017253 Ga0070674_1000172532 320
229 3300005364 Ga0070673_100002948 Ga0070673_1000029488 320
230 3300005365 Ga0070688_100138948 Ga0070688_1001389483 320
231 3300005406 Ga0070703_10020979 Ga0070703_100209792 320
232 3300005438 Ga0070701_10022675 Ga0070701_100226753 320
233 3300005441 Ga0070700_100013263 Ga0070700_1000132632 320
234 3300005445 Ga0070708_100194395 Ga0070708_1001943951 320
235 3300005459 Ga0068867_100048676 Ga0068867_1000486763 320
236 3300005543 Ga0070672_100006792 Ga0070672_1000067923 320
237 3300005545 Ga0070695_100065489 Ga0070695_1000654893 320
238 3300005547 Ga0070693_100036407 Ga0070693_1000364073 320
239 3300005549 Ga0070704_100059701 Ga0070704_1000597013 320
240 3300005564 Ga0070664_100043148 Ga0070664_1000431484 320
241 3300005564 Ga0070664_100177679 Ga0070664_1001776792 320
242 3300005578 Ga0068854_100002999 Ga0068854_1000029995 320
243 3300005618 Ga0068864_100005332 Ga0068864_1000053323 320
244 3300005841 Ga0068863_100473802 Ga0068863_1004738022 320
245 3300005843 Ga0068860_100080168 Ga0068860_1000801682 320
246 3300005844 Ga0068862_100039327 Ga0068862_1000393272 320
247 3300006844 Ga0075428_100035169 Ga0075428_1000351693 320
248 3300006844 Ga0075428_100200251 Ga0075428_1002002513 320
249 3300006846 Ga0075430_100001499 Ga0075430_1000014994 320
250 3300006846 Ga0075430_100017890 Ga0075430_1000178906 320
251 3300006847 Ga0075431_100005881 Ga0075431_10000588110 320
252 3300006852 Ga0075433_10002058 Ga0075433_100020585 320
253 3300006852 Ga0075433_10023220 Ga0075433_100232204 320
254 3300006871 Ga0075434_100002389 Ga0075434_1000023898 320
255 3300006871 Ga0075434_100007789 Ga0075434_10000778911 320
256 3300006871 Ga0075434_100066673 Ga0075434_1000666733 320
257 3300007076 Ga0075435_100062458 Ga0075435_1000624584 320
258 3300007076 Ga0075435_100322856 Ga0075435_1003228561 320
259 3300009094 Ga0111539_10001128 Ga0111539_1000112823 320
260 3300009098 Ga0105245_10017804 Ga0105245_100178044 320
261 3300009147 Ga0114129_10007774 Ga0114129_100077743 320
262 3300009147 Ga0114129_10038106 Ga0114129_100381065 320
263 3300009148 Ga0105243_10119671 Ga0105243_101196711 320
264 3300009174 Ga0105241_10165763 Ga0105241_101657631 320
265 3300009176 Ga0105242_10249531 Ga0105242_102495312 320
266 3300010375 Ga0105239_10099330 Ga0105239_100993303 320
267 3300025907 Ga0207645_10137273 Ga0207645_101372732 320
268 3300025918 Ga0207662_10009162 Ga0207662_100091622 320
269 3300025925 Ga0207650_10011126 Ga0207650_100111264 320
270 3300025925 Ga0207650_10091165 Ga0207650_100911653 320
271 3300025926 Ga0207659_10189204 Ga0207659_101892041 320
272 3300025933 Ga0207706_10071856 Ga0207706_100718563 320
273 3300025934 Ga0207686_10012255 Ga0207686_100122553 320
274 3300025935 Ga0207709_10025886 Ga0207709_100258862 320
275 3300025937 Ga0207669_10166218 Ga0207669_101662182 320
276 3300025940 Ga0207691_10004842 Ga0207691_100048425 320
277 3300025941 Ga0207711_10060750 Ga0207711_100607502 320
278 3300025942 Ga0207689_10058190 Ga0207689_100581903 320
279 3300025942 Ga0207689_10139896 Ga0207689_101398963 320
280 3300026075 Ga0207708_10024546 Ga0207708_100245462 320
281 3300026089 Ga0207648_10025141 Ga0207648_100251412 320
282 3300026095 Ga0207676_10062615 Ga0207676_100626153 320
283 3300026121 Ga0207683_10151620 Ga0207683_101516203 320
284 3300027907 Ga0207428_10001419 Ga0207428_1000141918 320
285 3300028381 Ga0268264_10031761 Ga0268264_100317613 320
286 3300032005 Ga0307411_10161525 Ga0307411_101615251 320
287 3300042437 Ga0439444_0011487 Ga0439444_0011487_141_1103 320
288 3300044712 Ga0453684_0075558 Ga0453684_0075558_1694_2659 320
289 3300048910 Ga0496107_0162973 Ga0496107_0162973_260_1225 320
290 3300048912 Ga0496109_0329736 Ga0496109_0329736_421_1383 320
291 3300049582 Ga0501048_0243475 Ga0501048_0243475_122_1084 320
292 3300049583 Ga0501067_0043410 Ga0501067_0043410_911_1876 320
293 3300049587 Ga0501071_0237121 Ga0501071_0237121_23_985 320
294 3300049588 Ga0501072_0006979 Ga0501072_0006979_155_1117 320
295 3300049593 Ga0501077_0189974 Ga0501077_0189974_277_1239 320
296 3300049741 Ga0501079_0288910 Ga0501079_0288910_217_1179 320
297 3300049742 Ga0501080_0018993 Ga0501080_0018993_917_1882 320
298 3300049743 Ga0501081_0026342 Ga0501081_0026342_2257_3219 320
299 3300049765 Ga0501268_006991 Ga0501268_006991_83_1045 320
300 3300049822 Ga0501035_0422357 Ga0501035_0422357_92_1054 320
301 3300049824 Ga0501045_0119983 Ga0501045_0119983_783_1745 320
302 3300050507 nmdc:mga05p37_6039_c1 nmdc:mga05p37_6039_c1_1442_2407 320
303 3300050508 nmdc:mga09592_313784_c1 nmdc:mga09592_313784_c1_183_1145 320
304 3300050509 nmdc:mga0qj67_45051_c1 nmdc:mga0qj67_45051_c1_443_1405 320
305 3300050510 nmdc:mga06r32_31316_c1 nmdc:mga06r32_31316_c1_1352_2314 320
306 3300050511 nmdc:mga08y16_1706_c1 nmdc:mga08y16_1706_c1_11135_12097 320
307 3300050512 nmdc:mga0n895_9242_c1 nmdc:mga0n895_9242_c1_4925_5887 320
308 3300050513 nmdc:mga0rr50_47753_c1 nmdc:mga0rr50_47753_c1_534_1496 320
309 3300050513 nmdc:mga0rr50_62952_c1 nmdc:mga0rr50_62952_c1_1386_2351 320
310 3300050515 nmdc:mga0a205_189780_c1 nmdc:mga0a205_189780_c1_662_1624 320
311 3300050515 nmdc:mga0a205_577_c1 nmdc:mga0a205_577_c1_14391_15353 320
312 3300061734 Ga0530510_0025071 Ga0530510_0025071_2067_3029 320
313 3300005290 Ga0065712_10068502 Ga0065712_100685023 321
314 3300005293 Ga0065715_10096489 Ga0065715_100964893 321
315 3300005329 Ga0070683_100013764 Ga0070683_1000137645 321
316 3300005331 Ga0070670_100035298 Ga0070670_1000352984 321
317 3300005344 Ga0070661_100057423 Ga0070661_1000574232 321
318 3300005353 Ga0070669_100001008 Ga0070669_1000010084 321
319 3300005354 Ga0070675_100032873 Ga0070675_1000328734 321
320 3300005354 Ga0070675_100253754 Ga0070675_1002537541 321
321 3300005355 Ga0070671_100459694 Ga0070671_1004596941 321
322 3300005364 Ga0070673_100016632 Ga0070673_1000166326 321
323 3300005367 Ga0070667_100138715 Ga0070667_1001387151 321
324 3300005438 Ga0070701_10069828 Ga0070701_100698283 321
325 3300005455 Ga0070663_100029234 Ga0070663_1000292342 321
326 3300005456 Ga0070678_100038752 Ga0070678_1000387524 321
327 3300005456 Ga0070678_100434272 Ga0070678_1004342721 321
328 3300005457 Ga0070662_100237636 Ga0070662_1002376361 321
329 3300005535 Ga0070684_100000069 Ga0070684_10000006938 321
330 3300005543 Ga0070672_100252510 Ga0070672_1002525101 321
331 3300005564 Ga0070664_100029842 Ga0070664_1000298422 321
332 3300005577 Ga0068857_100028553 Ga0068857_1000285534 321
333 3300005617 Ga0068859_100188619 Ga0068859_1001886193 321
334 3300005841 Ga0068863_100154643 Ga0068863_1001546433 321
335 3300005844 Ga0068862_100058781 Ga0068862_1000587814 321
336 3300006237 Ga0097621_100346097 Ga0097621_1003460971 321
337 3300006844 Ga0075428_100013447 Ga0075428_1000134478 321
338 3300006880 Ga0075429_100102932 Ga0075429_1001029321 321
339 3300006881 Ga0068865_100014782 Ga0068865_1000147822 321
340 3300006881 Ga0068865_100239219 Ga0068865_1002392191 321
341 3300006931 Ga0097620_100188616 Ga0097620_1001886163 321
342 3300009094 Ga0111539_10000065 Ga0111539_1000006566 321
343 3300009094 Ga0111539_10010818 Ga0111539_100108187 321
344 3300009147 Ga0114129_10000476 Ga0114129_100004762 321
345 3300009147 Ga0114129_10111384 Ga0114129_101113844 321
346 3300011119 Ga0105246_10419471 Ga0105246_104194711 321
347 3300013296 Ga0157374_10257857 Ga0157374_102578571 321
348 3300014325 Ga0163163_10008937 Ga0163163_100089375 321
349 3300014968 Ga0157379_10219446 Ga0157379_102194461 321
350 3300025321 Ga0207656_10043530 Ga0207656_100435302 321
351 3300025925 Ga0207650_10021754 Ga0207650_100217544 321
352 3300025926 Ga0207659_10134758 Ga0207659_101347583 321
353 3300025933 Ga0207706_10238746 Ga0207706_102387462 321
354 3300025961 Ga0207712_10029660 Ga0207712_100296603 321
355 3300026067 Ga0207678_10128323 Ga0207678_101283233 321
356 3300026088 Ga0207641_10135896 Ga0207641_101358962 321
357 3300026116 Ga0207674_10039518 Ga0207674_100395184 321
358 3300026118 Ga0207675_100384152 Ga0207675_1003841522 321
359 3300026121 Ga0207683_10029838 Ga0207683_100298385 321
360 3300026121 Ga0207683_10466440 Ga0207683_104664402 321
361 3300027907 Ga0207428_10000936 Ga0207428_1000093613 321
362 3300027907 Ga0207428_10056404 Ga0207428_100564043 321
363 3300028380 Ga0268265_10253096 Ga0268265_102530961 321
364 3300031995 Ga0307409_100318872 Ga0307409_1003188722 321
365 3300032002 Ga0307416_100305580 Ga0307416_1003055802 321
366 3300041997 Ga0439431_0008887 Ga0439431_0008887_936_1913 321
367 3300041999 Ga0439433_0006623 Ga0439433_0006623_1042_2019 321
368 3300046455 Ga0495603_0014148 Ga0495603_0014148_2053_3018 321
369 3300046499 Ga0495594_0037031 Ga0495594_0037031_115_1080 321
370 3300046522 Ga0495643_0004655 Ga0495643_0004655_3840_4814 321
371 3300048907 Ga0496104_0007007 Ga0496104_0007007_7831_8799 321
372 3300048908 Ga0496105_0012323 Ga0496105_0012323_5395_6363 321
373 3300048911 Ga0496108_0010549 Ga0496108_0010549_4679_5647 321
374 3300048912 Ga0496109_0026200 Ga0496109_0026200_2048_3016 321
375 3300048913 Ga0496110_0000173 Ga0496110_0000173_12530_13498 321
376 3300048914 Ga0496111_0041471 Ga0496111_0041471_2237_3205 321
377 3300048915 Ga0496112_0003067 Ga0496112_0003067_10617_11585 321
378 3300050507 nmdc:mga05p37_202218_c1 nmdc:mga05p37_202218_c1_1350_2315 321
379 3300050510 nmdc:mga06r32_331844_c1 nmdc:mga06r32_331844_c1_489_1457 321
380 3300050511 nmdc:mga08y16_119762_c1 nmdc:mga08y16_119762_c1_1566_2534 321
381 3300050511 nmdc:mga08y16_3636_c1 nmdc:mga08y16_3636_c1_3226_4203 321
382 3300005290 Ga0065712_10004141 Ga0065712_100041415 322
383 3300005328 Ga0070676_10010170 Ga0070676_100101706 322
384 3300005328 Ga0070676_10024363 Ga0070676_100243634 322
385 3300005330 Ga0070690_100011832 Ga0070690_1000118322 322
386 3300005331 Ga0070670_100011715 Ga0070670_1000117153 322
387 3300005331 Ga0070670_100051665 Ga0070670_1000516653 322
388 3300005333 Ga0070677_10079765 Ga0070677_100797652 322
389 3300005334 Ga0068869_100001451 Ga0068869_1000014515 322
390 3300005334 Ga0068869_100009316 Ga0068869_1000093165 322
391 3300005334 Ga0068869_100018614 Ga0068869_1000186143 322
392 3300005335 Ga0070666_10014202 Ga0070666_100142025 322
393 3300005335 Ga0070666_10045698 Ga0070666_100456983 322
394 3300005338 Ga0068868_100011007 Ga0068868_1000110077 322
395 3300005340 Ga0070689_100270590 Ga0070689_1002705901 322
396 3300005345 Ga0070692_10067771 Ga0070692_100677713 322
397 3300005353 Ga0070669_100005330 Ga0070669_1000053308 322
398 3300005353 Ga0070669_100113179 Ga0070669_1001131793 322
399 3300005354 Ga0070675_100021012 Ga0070675_1000210125 322
400 3300005354 Ga0070675_100230552 Ga0070675_1002305523 322
401 3300005354 Ga0070675_100361768 Ga0070675_1003617682 322
402 3300005355 Ga0070671_100091343 Ga0070671_1000913433 322
403 3300005356 Ga0070674_100010787 Ga0070674_1000107874 322
404 3300005364 Ga0070673_100031521 Ga0070673_1000315211 322
405 3300005364 Ga0070673_100044100 Ga0070673_1000441003 322
406 3300005365 Ga0070688_100060756 Ga0070688_1000607563 322
407 3300005367 Ga0070667_100025919 Ga0070667_1000259193 322
408 3300005367 Ga0070667_100211711 Ga0070667_1002117113 322
409 3300005367 Ga0070667_100351882 Ga0070667_1003518821 322
410 3300005438 Ga0070701_10026649 Ga0070701_100266494 322
411 3300005438 Ga0070701_10029415 Ga0070701_100294153 322
412 3300005441 Ga0070700_100052389 Ga0070700_1000523893 322
413 3300005441 Ga0070700_100092432 Ga0070700_1000924322 322
414 3300005457 Ga0070662_100027875 Ga0070662_1000278752 322
415 3300005459 Ga0068867_100002915 Ga0068867_1000029159 322
416 3300005459 Ga0068867_100015432 Ga0068867_1000154323 322
417 3300005466 Ga0070685_10006838 Ga0070685_100068387 322
418 3300005466 Ga0070685_10100115 Ga0070685_101001152 322
419 3300005543 Ga0070672_100022174 Ga0070672_1000221742 322
420 3300005543 Ga0070672_100029469 Ga0070672_1000294693 322
421 3300005548 Ga0070665_100060629 Ga0070665_1000606294 322
422 3300005617 Ga0068859_100010866 Ga0068859_1000108664 322
423 3300005617 Ga0068859_100039203 Ga0068859_1000392033 322
424 3300005617 Ga0068859_100239583 Ga0068859_1002395833 322
425 3300005618 Ga0068864_100007453 Ga0068864_1000074533 322
426 3300005718 Ga0068866_10007464 Ga0068866_100074643 322
427 3300005719 Ga0068861_100011620 Ga0068861_1000116207 322
428 3300005719 Ga0068861_100080622 Ga0068861_1000806223 322
429 3300005840 Ga0068870_10000269 Ga0068870_100002699 322
430 3300005841 Ga0068863_100006562 Ga0068863_1000065628 322
431 3300005841 Ga0068863_100481960 Ga0068863_1004819602 322
432 3300005844 Ga0068862_100000662 Ga0068862_1000006624 322
433 3300006237 Ga0097621_100156079 Ga0097621_1001560793 322
434 3300006844 Ga0075428_100014410 Ga0075428_1000144106 322
435 3300006844 Ga0075428_100024526 Ga0075428_1000245262 322
436 3300006846 Ga0075430_100016781 Ga0075430_1000167816 322
437 3300006847 Ga0075431_100000506 Ga0075431_10000050625 322
438 3300006847 Ga0075431_100153812 Ga0075431_1001538123 322
439 3300006852 Ga0075433_10000466 Ga0075433_1000046626 322
440 3300006852 Ga0075433_10260049 Ga0075433_102600492 322
441 3300006871 Ga0075434_100008078 Ga0075434_1000080789 322
442 3300006871 Ga0075434_100113047 Ga0075434_1001130473 322
443 3300006880 Ga0075429_100004353 Ga0075429_1000043534 322
444 3300006881 Ga0068865_100035023 Ga0068865_1000350233 322
445 3300006931 Ga0097620_100010866 Ga0097620_1000108664 322
446 3300006931 Ga0097620_100039202 Ga0097620_1000392024 322
447 3300006931 Ga0097620_100239573 Ga0097620_1002395731 322
448 3300007076 Ga0075435_100225688 Ga0075435_1002256882 322
449 3300009094 Ga0111539_10003505 Ga0111539_1000350516 322
450 3300009094 Ga0111539_10224771 Ga0111539_102247712 322
451 3300009147 Ga0114129_10230902 Ga0114129_102309023 322
452 3300009148 Ga0105243_10011752 Ga0105243_100117522 322
453 3300009177 Ga0105248_10053293 Ga0105248_100532935 322
454 3300009553 Ga0105249_10001042 Ga0105249_100010424 322
455 3300011119 Ga0105246_10079894 Ga0105246_100798943 322
456 3300013296 Ga0157374_10111515 Ga0157374_101115153 322
457 3300014325 Ga0163163_10017509 Ga0163163_100175093 322
458 3300014326 Ga0157380_10004723 Ga0157380_1000472310 322
459 3300014326 Ga0157380_10050857 Ga0157380_100508572 322
460 3300014745 Ga0157377_10021608 Ga0157377_100216083 322
461 3300017792 Ga0163161_10002282 Ga0163161_1000228210 322
462 3300017792 Ga0163161_10121374 Ga0163161_101213742 322
463 3300025315 Ga0207697_10000085 Ga0207697_1000008527 322
464 3300025893 Ga0207682_10000133 Ga0207682_1000013335 322
465 3300025893 Ga0207682_10006805 Ga0207682_100068055 322
466 3300025893 Ga0207682_10009032 Ga0207682_100090324 322
467 3300025899 Ga0207642_10007752 Ga0207642_100077523 322
468 3300025901 Ga0207688_10000477 Ga0207688_100004778 322
469 3300025903 Ga0207680_10102491 Ga0207680_101024912 322
470 3300025907 Ga0207645_10001684 Ga0207645_100016849 322
471 3300025907 Ga0207645_10027536 Ga0207645_100275363 322
472 3300025907 Ga0207645_10028344 Ga0207645_100283444 322
473 3300025908 Ga0207643_10000665 Ga0207643_100006653 322
474 3300025918 Ga0207662_10002216 Ga0207662_100022168 322
475 3300025923 Ga0207681_10009866 Ga0207681_100098664 322
476 3300025923 Ga0207681_10024146 Ga0207681_100241464 322
477 3300025923 Ga0207681_10271051 Ga0207681_102710512 322
478 3300025925 Ga0207650_10015265 Ga0207650_100152652 322
479 3300025926 Ga0207659_10055621 Ga0207659_100556213 322
480 3300025931 Ga0207644_10068482 Ga0207644_100684823 322
481 3300025932 Ga0207690_10122424 Ga0207690_101224242 322
482 3300025933 Ga0207706_10003174 Ga0207706_100031747 322
483 3300025935 Ga0207709_10246249 Ga0207709_102462491 322
484 3300025936 Ga0207670_10104909 Ga0207670_101049092 322
485 3300025937 Ga0207669_10009972 Ga0207669_100099722 322
486 3300025938 Ga0207704_10002475 Ga0207704_100024758 322
487 3300025940 Ga0207691_10003154 Ga0207691_100031549 322
488 3300025940 Ga0207691_10219210 Ga0207691_102192102 322
489 3300025941 Ga0207711_10314411 Ga0207711_103144112 322
490 3300025942 Ga0207689_10001141 Ga0207689_1000114118 322
491 3300025942 Ga0207689_10050149 Ga0207689_100501493 322
492 3300025945 Ga0207679_10075106 Ga0207679_100751062 322
493 3300025960 Ga0207651_10053131 Ga0207651_100531313 322
494 3300025961 Ga0207712_10004342 Ga0207712_100043424 322
495 3300026035 Ga0207703_10131414 Ga0207703_101314142 322
496 3300026067 Ga0207678_10036825 Ga0207678_100368254 322
497 3300026067 Ga0207678_10064557 Ga0207678_100645574 322
498 3300026075 Ga0207708_10006210 Ga0207708_100062109 322
499 3300026075 Ga0207708_10014730 Ga0207708_100147303 322
500 3300026088 Ga0207641_10008578 Ga0207641_100085788 322
501 3300026089 Ga0207648_10004031 Ga0207648_1000403116 322
502 3300026089 Ga0207648_10041422 Ga0207648_100414223 322
503 3300026095 Ga0207676_10127604 Ga0207676_101276043 322
504 3300026095 Ga0207676_10191049 Ga0207676_101910492 322
505 3300026116 Ga0207674_10198604 Ga0207674_101986043 322
506 3300026118 Ga0207675_100035929 Ga0207675_1000359295 322
507 3300026118 Ga0207675_100036318 Ga0207675_1000363183 322
508 3300026118 Ga0207675_100065217 Ga0207675_1000652172 322
509 3300026121 Ga0207683_10001698 Ga0207683_1000169821 322
510 3300026121 Ga0207683_10006182 Ga0207683_100061828 322
511 3300026121 Ga0207683_10186613 Ga0207683_101866132 322
512 3300027907 Ga0207428_10000345 Ga0207428_1000034523 322
513 3300028379 Ga0268266_10062006 Ga0268266_100620063 322
514 3300028380 Ga0268265_10046338 Ga0268265_100463383 322
515 3300028381 Ga0268264_10228114 Ga0268264_102281143 322
516 3300031824 Ga0307413_10041280 Ga0307413_100412803 322
517 3300031852 Ga0307410_10165951 Ga0307410_101659513 322
518 3300031903 Ga0307407_10006608 Ga0307407_100066083 322
519 3300031911 Ga0307412_10160733 Ga0307412_101607332 322
520 3300031995 Ga0307409_100106260 Ga0307409_1001062602 322
521 3300032002 Ga0307416_100001676 Ga0307416_1000016763 322
522 3300032004 Ga0307414_10104991 Ga0307414_101049911 322
523 3300032005 Ga0307411_10003321 Ga0307411_100033218 322
524 3300032005 Ga0307411_10053902 Ga0307411_100539023 322
525 3300032126 Ga0307415_100016964 Ga0307415_1000169645 322
526 3300035115 Ga0373941_0059513 Ga0373941_0059513_58_1026 322
527 3300049575 Ga0501039_0020851 Ga0501039_0020851_311_1282 322
528 3300049576 Ga0501040_0017841 Ga0501040_0017841_1550_2530 322
529 3300049577 Ga0501041_0013579 Ga0501041_0013579_2898_3878 322
530 3300049578 Ga0501042_0003074 Ga0501042_0003074_6573_7553 322
531 3300049588 Ga0501072_0157426 Ga0501072_0157426_521_1510 322
532 3300049589 Ga0501073_0100339 Ga0501073_0100339_76_1056 322
533 3300049742 Ga0501080_0466970 Ga0501080_0466970_108_1088 322
534 3300049743 Ga0501081_0067955 Ga0501081_0067955_1344_2333 322
535 3300049824 Ga0501045_0194399 Ga0501045_0194399_330_1310 322
536 3300050507 nmdc:mga05p37_316534_c1 nmdc:mga05p37_316534_c1_795_1763 322
537 3300050508 nmdc:mga09592_32082_c1 nmdc:mga09592_32082_c1_2988_3956 322
538 3300050508 nmdc:mga09592_3756_c1 nmdc:mga09592_3756_c1_2429_3397 322
539 3300050509 nmdc:mga0qj67_11727_c1 nmdc:mga0qj67_11727_c1_2593_3573 322
540 3300050509 nmdc:mga0qj67_173725_c1 nmdc:mga0qj67_173725_c1_423_1391 322
541 3300050509 nmdc:mga0qj67_60258_c1 nmdc:mga0qj67_60258_c1_1252_2220 322
542 3300050510 nmdc:mga06r32_24748_c1 nmdc:mga06r32_24748_c1_349_1329 322
543 3300050511 nmdc:mga08y16_13098_c1 nmdc:mga08y16_13098_c1_867_1835 322
544 3300050512 nmdc:mga0n895_10318_c1 nmdc:mga0n895_10318_c1_5567_6547 322
545 3300050513 nmdc:mga0rr50_115742_c1 nmdc:mga0rr50_115742_c1_1053_2021 322
546 3300050515 nmdc:mga0a205_324650_c1 nmdc:mga0a205_324650_c1_325_1293 322
547 3300054114 Ga0501084_0114762 Ga0501084_0114762_491_1471 322
548 3300060353 Ga0501082_0212131 Ga0501082_0212131_476_1456 322
549 3300005343 Ga0070687_100043442 Ga0070687_1000434424 323
550 3300005353 Ga0070669_100039125 Ga0070669_1000391253 323
551 3300005354 Ga0070675_100019983 Ga0070675_1000199833 323
552 3300005354 Ga0070675_100028688 Ga0070675_1000286882 323
553 3300005364 Ga0070673_100019697 Ga0070673_1000196975 323
554 3300005456 Ga0070678_100050809 Ga0070678_1000508091 323
555 3300005458 Ga0070681_10317317 Ga0070681_103173172 323
556 3300005459 Ga0068867_100199013 Ga0068867_1001990132 323
557 3300005546 Ga0070696_100067266 Ga0070696_1000672662 323
558 3300005617 Ga0068859_100057245 Ga0068859_1000572452 323
559 3300005617 Ga0068859_100097828 Ga0068859_1000978284 323
560 3300005719 Ga0068861_100385923 Ga0068861_1003859232 323
561 3300006844 Ga0075428_100034518 Ga0075428_1000345183 323
562 3300006846 Ga0075430_100104309 Ga0075430_1001043091 323
563 3300006852 Ga0075433_10076422 Ga0075433_100764222 323
564 3300006880 Ga0075429_100084831 Ga0075429_1000848314 323
565 3300006931 Ga0097620_100057246 Ga0097620_1000572462 323
566 3300006931 Ga0097620_100097829 Ga0097620_1000978292 323
567 3300009094 Ga0111539_10012997 Ga0111539_100129977 323
568 3300009094 Ga0111539_10022546 Ga0111539_100225469 323
569 3300009094 Ga0111539_10047854 Ga0111539_100478545 323
570 3300009094 Ga0111539_10086035 Ga0111539_100860352 323
571 3300009147 Ga0114129_10429864 Ga0114129_104298642 323
572 3300013308 Ga0157375_10027735 Ga0157375_100277353 323
573 3300025918 Ga0207662_10021443 Ga0207662_100214433 323
574 3300025926 Ga0207659_10007084 Ga0207659_100070847 323
575 3300025926 Ga0207659_10015463 Ga0207659_100154633 323
576 3300025936 Ga0207670_10046326 Ga0207670_100463263 323
577 3300025945 Ga0207679_10515724 Ga0207679_105157241 323
578 3300025960 Ga0207651_10002774 Ga0207651_100027747 323
579 3300026089 Ga0207648_10013384 Ga0207648_100133845 323
580 3300026118 Ga0207675_100451654 Ga0207675_1004516542 323
581 3300027907 Ga0207428_10009368 Ga0207428_100093686 323
582 3300031995 Ga0307409_100610455 Ga0307409_1006104551 323
583 3300032002 Ga0307416_100189115 Ga0307416_1001891153 323
584 3300046615 Ga0495656_0022751 Ga0495656_0022751_270_1250 323
585 3300048912 Ga0496109_0021884 Ga0496109_0021884_127_1110 323
586 3300048916 Ga0496113_0343094 Ga0496113_0343094_31_1014 323
587 3300050507 nmdc:mga05p37_43213_c1 nmdc:mga05p37_43213_c1_4119_5099 323
588 3300050508 nmdc:mga09592_26812_c1 nmdc:mga09592_26812_c1_949_1929 323
589 3300050509 nmdc:mga0qj67_38426_c1 nmdc:mga0qj67_38426_c1_1075_2046 323
590 3300050511 nmdc:mga08y16_17564_c1 nmdc:mga08y16_17564_c1_111_1091 323
591 3300050511 nmdc:mga08y16_244821_c1 nmdc:mga08y16_244821_c1_145_1128 323
592 3300050511 nmdc:mga08y16_3324_c1 nmdc:mga08y16_3324_c1_11697_12686 323
593 3300050515 nmdc:mga0a205_91533_c1 nmdc:mga0a205_91533_c1_287_1270 323
594 3300005327 Ga0070658_10143452 Ga0070658_101434523 324
595 3300005331 Ga0070670_100020776 Ga0070670_1000207766 324
596 3300005340 Ga0070689_100096588 Ga0070689_1000965882 324
597 3300005354 Ga0070675_100012936 Ga0070675_1000129364 324
598 3300005365 Ga0070688_100305117 Ga0070688_1003051171 324
599 3300005543 Ga0070672_100195611 Ga0070672_1001956112 324
600 3300005564 Ga0070664_100462565 Ga0070664_1004625652 324
601 3300005617 Ga0068859_100529208 Ga0068859_1005292082 324
602 3300005618 Ga0068864_100306959 Ga0068864_1003069592 324
603 3300005719 Ga0068861_100089158 Ga0068861_1000891583 324
604 3300006844 Ga0075428_100004439 Ga0075428_10000443911 324
605 3300006846 Ga0075430_100318834 Ga0075430_1003188341 324
606 3300006847 Ga0075431_100262609 Ga0075431_1002626092 324
607 3300006880 Ga0075429_100016395 Ga0075429_1000163953 324
608 3300006931 Ga0097620_100529226 Ga0097620_1005292262 324
609 3300009094 Ga0111539_10189151 Ga0111539_101891513 324
610 3300009147 Ga0114129_10007052 Ga0114129_1000705215 324
611 3300009551 Ga0105238_10020278 Ga0105238_100202783 324
612 3300009553 Ga0105249_10733592 Ga0105249_107335921 324
613 3300014325 Ga0163163_10480951 Ga0163163_104809511 324
614 3300025901 Ga0207688_10100576 Ga0207688_101005763 324
615 3300025924 Ga0207694_10031751 Ga0207694_100317515 324
616 3300025926 Ga0207659_10013082 Ga0207659_100130823 324
617 3300025940 Ga0207691_10069827 Ga0207691_100698273 324
618 3300032002 Ga0307416_100008926 Ga0307416_1000089264 324
619 3300032004 Ga0307414_10388833 Ga0307414_103888332 324
620 3300045051 Ga0451576_0702350 Ga0451576_0702350_77_1051 324
621 3300050507 nmdc:mga05p37_237136_c1 nmdc:mga05p37_237136_c1_59_1033 324
622 3300050508 nmdc:mga09592_19340_c1 nmdc:mga09592_19340_c1_2578_3552 324
623 3300050509 nmdc:mga0qj67_73799_c1 nmdc:mga0qj67_73799_c1_813_1787 324
624 3300050510 nmdc:mga06r32_245509_c1 nmdc:mga06r32_245509_c1_434_1408 324
625 3300014326 Ga0157380_10498434 Ga0157380_104984341 325
626 3300025926 Ga0207659_10000692 Ga0207659_1000069216 325
627 3300025937 Ga0207669_10005428 Ga0207669_100054284 325
628 3300050511 nmdc:mga08y16_82857_c1 nmdc:mga08y16_82857_c1_1538_2545 325
629 3300005331 Ga0070670_100435109 Ga0070670_1004351091 326
630 3300006237 Ga0097621_100074644 Ga0097621_1000746443 326
631 3300025903 Ga0207680_10093887 Ga0207680_100938872 326
632 3300025940 Ga0207691_10149675 Ga0207691_101496752 326
633 3300041408 Ga0439453_0001566 Ga0439453_0001566_1280_2260 326
634 3300050509 nmdc:mga0qj67_16962_c1 nmdc:mga0qj67_16962_c1_1776_2762 326
635 3300005543 Ga0070672_100111714 Ga0070672_1001117143 327
636 3300025940 Ga0207691_10120381 Ga0207691_101203812 327
637 3300049587 Ga0501071_0305292 Ga0501071_0305292_159_1142 327
638 3300054114 Ga0501084_0400122 Ga0501084_0400122_66_1079 327
639 3300005293 Ga0065715_10176268 Ga0065715_101762682 328
640 3300005293 Ga0065715_10203068 Ga0065715_102030682 328
641 3300005295 Ga0065707_10009461 Ga0065707_100094612 328
642 3300005331 Ga0070670_100007560 Ga0070670_1000075604 328
643 3300005340 Ga0070689_100087173 Ga0070689_1000871733 328
644 3300005340 Ga0070689_100137679 Ga0070689_1001376792 328
645 3300005343 Ga0070687_100010429 Ga0070687_1000104293 328
646 3300005343 Ga0070687_100107109 Ga0070687_1001071092 328
647 3300005345 Ga0070692_10036167 Ga0070692_100361673 328
648 3300005347 Ga0070668_100256277 Ga0070668_1002562772 328
649 3300005353 Ga0070669_100003108 Ga0070669_1000031089 328
650 3300005354 Ga0070675_100009067 Ga0070675_1000090678 328
651 3300005354 Ga0070675_100019910 Ga0070675_1000199105 328
652 3300005364 Ga0070673_100092556 Ga0070673_1000925563 328
653 3300005365 Ga0070688_100025395 Ga0070688_1000253951 328
654 3300005365 Ga0070688_100260295 Ga0070688_1002602951 328
655 3300005438 Ga0070701_10054667 Ga0070701_100546671 328
656 3300005441 Ga0070700_100004623 Ga0070700_1000046234 328
657 3300005444 Ga0070694_100120839 Ga0070694_1001208393 328
658 3300005445 Ga0070708_100177462 Ga0070708_1001774623 328
659 3300005457 Ga0070662_100012018 Ga0070662_1000120184 328
660 3300005458 Ga0070681_10075385 Ga0070681_100753853 328
661 3300005466 Ga0070685_10066593 Ga0070685_100665933 328
662 3300005471 Ga0070698_100000806 Ga0070698_10000080633 328
663 3300005471 Ga0070698_100025140 Ga0070698_1000251404 328
664 3300005518 Ga0070699_100000386 Ga0070699_10000038614 328
665 3300005518 Ga0070699_100006186 Ga0070699_1000061864 328
666 3300005518 Ga0070699_100068674 Ga0070699_1000686742 328
667 3300005530 Ga0070679_100295205 Ga0070679_1002952052 328
668 3300005536 Ga0070697_100037002 Ga0070697_1000370023 328
669 3300005543 Ga0070672_100030643 Ga0070672_1000306434 328
670 3300005544 Ga0070686_100033883 Ga0070686_1000338831 328
671 3300005546 Ga0070696_100064510 Ga0070696_1000645102 328
672 3300005549 Ga0070704_100006063 Ga0070704_1000060634 328
673 3300005549 Ga0070704_100028365 Ga0070704_1000283654 328
674 3300005564 Ga0070664_100035652 Ga0070664_1000356523 328
675 3300005577 Ga0068857_100012663 Ga0068857_1000126635 328
676 3300005577 Ga0068857_100060235 Ga0068857_1000602351 328
677 3300005578 Ga0068854_100031544 Ga0068854_1000315444 328
678 3300005617 Ga0068859_100002081 Ga0068859_10000208115 328
679 3300005617 Ga0068859_100015676 Ga0068859_1000156766 328
680 3300005618 Ga0068864_100005475 Ga0068864_1000054755 328
681 3300005719 Ga0068861_100001989 Ga0068861_10000198910 328
682 3300005840 Ga0068870_10003442 Ga0068870_100034423 328
683 3300005840 Ga0068870_10003674 Ga0068870_100036742 328
684 3300005841 Ga0068863_100232909 Ga0068863_1002329093 328
685 3300005842 Ga0068858_100008296 Ga0068858_10000829610 328
686 3300005843 Ga0068860_100067582 Ga0068860_1000675823 328
687 3300005844 Ga0068862_100001000 Ga0068862_10000100013 328
688 3300006237 Ga0097621_100072035 Ga0097621_1000720353 328
689 3300006358 Ga0068871_100133895 Ga0068871_1001338952 328
690 3300006844 Ga0075428_100018233 Ga0075428_1000182335 328
691 3300006852 Ga0075433_10074202 Ga0075433_100742023 328
692 3300006871 Ga0075434_100003880 Ga0075434_1000038808 328
693 3300006871 Ga0075434_100122761 Ga0075434_1001227613 328
694 3300006871 Ga0075434_100502109 Ga0075434_1005021092 328
695 3300006880 Ga0075429_100101360 Ga0075429_1001013603 328
696 3300006881 Ga0068865_100124263 Ga0068865_1001242632 328
697 3300006931 Ga0097620_100002081 Ga0097620_1000020819 328
698 3300006931 Ga0097620_100015676 Ga0097620_1000156764 328
699 3300007076 Ga0075435_100007984 Ga0075435_1000079846 328
700 3300009094 Ga0111539_10017744 Ga0111539_100177445 328
701 3300009147 Ga0114129_10003827 Ga0114129_100038274 328
702 3300009147 Ga0114129_10023144 Ga0114129_100231447 328
703 3300009147 Ga0114129_10081605 Ga0114129_100816052 328
704 3300009148 Ga0105243_10051889 Ga0105243_100518893 328
705 3300009177 Ga0105248_10507875 Ga0105248_105078752 328
706 3300009553 Ga0105249_10006074 Ga0105249_100060747 328
707 3300013297 Ga0157378_10140615 Ga0157378_101406152 328
708 3300013308 Ga0157375_10128242 Ga0157375_101282423 328
709 3300014745 Ga0157377_10119378 Ga0157377_101193781 328
710 3300014968 Ga0157379_10102966 Ga0157379_101029663 328
711 3300025904 Ga0207647_10038289 Ga0207647_100382894 328
712 3300025907 Ga0207645_10035538 Ga0207645_100355383 328
713 3300025908 Ga0207643_10009824 Ga0207643_100098241 328
714 3300025908 Ga0207643_10128591 Ga0207643_101285911 328
715 3300025918 Ga0207662_10013731 Ga0207662_100137315 328
716 3300025920 Ga0207649_10113239 Ga0207649_101132392 328
717 3300025922 Ga0207646_10457023 Ga0207646_104570231 328
718 3300025923 Ga0207681_10005692 Ga0207681_100056924 328
719 3300025925 Ga0207650_10006792 Ga0207650_100067924 328
720 3300025926 Ga0207659_10000547 Ga0207659_100005475 328
721 3300025926 Ga0207659_10003019 Ga0207659_100030194 328
722 3300025933 Ga0207706_10072049 Ga0207706_100720492 328
723 3300025936 Ga0207670_10003124 Ga0207670_100031242 328
724 3300025936 Ga0207670_10008107 Ga0207670_100081076 328
725 3300025940 Ga0207691_10025047 Ga0207691_100250473 328
726 3300025940 Ga0207691_10088454 Ga0207691_100884543 328
727 3300025941 Ga0207711_10057855 Ga0207711_100578553 328
728 3300025942 Ga0207689_10149033 Ga0207689_101490332 328
729 3300025945 Ga0207679_10012954 Ga0207679_100129544 328
730 3300025945 Ga0207679_10203848 Ga0207679_102038482 328
731 3300025961 Ga0207712_10014252 Ga0207712_100142523 328
732 3300025972 Ga0207668_10124693 Ga0207668_101246933 328
733 3300026075 Ga0207708_10012471 Ga0207708_100124711 328
734 3300026089 Ga0207648_10001255 Ga0207648_1000125510 328
735 3300026089 Ga0207648_10089442 Ga0207648_100894422 328
736 3300026095 Ga0207676_10008322 Ga0207676_100083224 328
737 3300026116 Ga0207674_10038394 Ga0207674_100383945 328
738 3300026116 Ga0207674_10075303 Ga0207674_100753034 328
739 3300026118 Ga0207675_100006796 Ga0207675_10000679610 328
740 3300026121 Ga0207683_10050609 Ga0207683_100506093 328
741 3300027907 Ga0207428_10000442 Ga0207428_1000044230 328
742 3300028380 Ga0268265_10000237 Ga0268265_1000023717 328
743 3300028381 Ga0268264_10018583 Ga0268264_100185835 328
744 3300035114 Ga0373939_0066331 Ga0373939_0066331_82_1080 328
745 3300035241 Ga0373961_0036695 Ga0373961_0036695_36_1034 328
746 3300045051 Ga0451576_0033144 Ga0451576_0033144_1872_2870 328
747 3300045051 Ga0451576_0053960 Ga0451576_0053960_1024_2022 328
748 3300045051 Ga0451576_0220695 Ga0451576_0220695_751_1749 328
749 3300046455 Ga0495603_0018601 Ga0495603_0018601_1160_2158 328
750 3300046499 Ga0495594_0002079 Ga0495594_0002079_7545_8543 328
751 3300046539 Ga0495621_0020840 Ga0495621_0020840_581_1579 328
752 3300046558 Ga0495633_0089624 Ga0495633_0089624_341_1339 328
753 3300046664 Ga0495659_0008894 Ga0495659_0008894_1232_2230 328
754 3300046691 Ga0495670_0067914 Ga0495670_0067914_738_1736 328
755 3300050507 nmdc:mga05p37_2349_c1 nmdc:mga05p37_2349_c1_8835_9833 328
756 3300050507 nmdc:mga05p37_404899_c1 nmdc:mga05p37_404899_c1_288_1286 328
757 3300050511 nmdc:mga08y16_522_c1 nmdc:mga08y16_522_c1_22963_23961 328
758 3300050512 nmdc:mga0n895_100512_c1 nmdc:mga0n895_100512_c1_427_1425 328
759 3300050512 nmdc:mga0n895_410624_c1 nmdc:mga0n895_410624_c1_107_1105 328
760 3300050512 nmdc:mga0n895_77621_c1 nmdc:mga0n895_77621_c1_224_1222 328
761 3300050513 nmdc:mga0rr50_197449_c1 nmdc:mga0rr50_197449_c1_172_1170 328
762 3300050515 nmdc:mga0a205_38800_c1 nmdc:mga0a205_38800_c1_3063_4061 328
763 3300005293 Ga0065715_10129688 Ga0065715_101296883 329
764 3300005354 Ga0070675_100001605 Ga0070675_1000016058 329
765 3300005364 Ga0070673_100008407 Ga0070673_1000084073 329
766 3300006880 Ga0075429_100142044 Ga0075429_1001420443 329
767 3300013308 Ga0157375_10139857 Ga0157375_101398573 329
768 3300014745 Ga0157377_10008061 Ga0157377_100080614 329
769 3300025940 Ga0207691_10016461 Ga0207691_100164612 329
770 3300025960 Ga0207651_10004970 Ga0207651_100049705 329
771 3300050508 nmdc:mga09592_262703_c1 nmdc:mga09592_262703_c1_166_1176 329
772 3300003203 JGI25406J46586_10007048 JGI25406J46586_100070485 330
773 3300005985 Ga0081539_10000034 Ga0081539_1000003437 330
774 3300005985 Ga0081539_10000190 Ga0081539_10000190121 330
775 3300009094 Ga0111539_10006236 Ga0111539_100062366 330
776 3300050511 nmdc:mga08y16_133933_c1 nmdc:mga08y16_133933_c1_437_1429 330

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

151

229

0.97

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

9

299

0.92

PF00890

FAD_binding_2

FAD binding domain

10

50

0.9

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

69

282

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jyp-assembly1.cif.gz_A-2 structure of thioredoxin reductase from the thermophilic eubacterium thermosipho africanus tcf52b 0.9474 4 301
5uth-assembly1.cif.gz_A crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad 0.9409 1 306
2a87-assembly1.cif.gz_B crystal structure of m. tuberculosis thioredoxin reductase 0.9409 4 306
5uth-assembly1.cif.gz_A crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad 0.932 1 306
2a87-assembly1.cif.gz_B crystal structure of m. tuberculosis thioredoxin reductase 0.932 4 306
ID Description Score Start End Superfamily
5uthA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.982 116 240 3.50.50.60
5uthA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9742 116 240 3.50.50.60
3f8rD02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9532 116 240 3.50.50.60
4zn0C02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9517 123 240 3.50.50.60
4ykgA03 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.95 116 240 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A3C0YJU2-F1-model_v4 deleted 0.9839 134 200
AF-K1UEN0-F1-model_v4 Protein containing Pyridine nucleotide-disulfide oxidoreductase, NAD-binding region domain protein (EC 1.-.-.-) 0.9727 139 206 GO:0016491
AF-A0A6B3EPH4-F1-model_v4 FAD-dependent oxidoreductase 0.9705 111 226 GO:0016668
AF-A0A3D5UWY6-F1-model_v4 Thioredoxin-disulfide reductase 0.9664 141 231 GO:0016491
AF-A0A3D5M494-F1-model_v4 Thioredoxin-disulfide reductase 0.9598 58 306 GO:0016668

Feature Viewer

pLDDT pTM Quality
83.62 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map