F480295

General Info

Members Datasets Scaffolds Average Seq Length
776 329 1551 506

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100005780|Ga0068855_10000578011
Length 569
Sequence LINNIPIGILSVQGLKSQIAARQKNNKTENDKLPSIAMNKNIPVGILYKQYVMSPLKKQLLIITVIAAAVMELIDTSIVNVALSHMSGNLGATLEDTSWVITSYAIANVIIIPITSFLVARLGRRNYYIGSIILFTLCSLMCGQAGNIWTLVAFRFLQGLGGGALLSVSQAVVFELFPKEKQGVASALFGIGVFTGPTIGXXLGGFITENYSWPWIFYINLPIGIAAAISCYLLLTEPPVKPAVPKVDWTGIALLSIGISTLQTVLERGETEDWFSTPYITWFTVIAIVSLTAFVIWELKIDHPVVNLRVLKSKTLSIAAILTFITGLGLFTSVFLTPVVAQRLLNFTPTQTGLLLLPGAILAIVGLIVSGKLLQNGVSPVIIVGSGFLLFIYFNWRMSQINFDTSSAEITFSLIFRALGIAFLTVPLTALAVSSLQPKDIPQGAALNNMMRQLGGSFGISIINTYTAHRIAVHRTDLISNITINNPLATERLNQYISYFQHIGFTWFNAHDRAVKLIETGVVRQSGMLSYIDAYLLIGLLFVLSLPLLLFVAKRNKDKKQAAVIVSDH

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
67 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
68 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
69 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
97 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
102 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
104 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
105 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
152 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
153 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
157 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
158 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
159 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
160 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
161 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
162 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
165 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
166 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
167 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
168 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
169 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
170 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
171 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
188 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
189 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
197 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
198 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
199 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
200 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
201 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
202 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
203 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
204 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
205 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
206 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
207 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
210 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
211 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
212 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
213 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
214 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
215 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
216 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
221 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
222 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
223 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
224 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
225 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
226 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
227 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
228 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
229 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
239 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
240 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
241 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
242 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
243 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
244 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
248 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
251 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
252 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
253 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
254 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
255 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
256 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
257 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
258 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
259 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
260 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
261 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
262 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
263 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
264 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
265 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
266 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
267 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
268 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
269 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
270 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
271 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
272 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
273 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
274 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
275 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
276 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
277 2738541283 Pedobacter sp. OK701 Isolate Unclassified
278 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
279 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
280 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
281 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
282 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
283 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
284 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
285 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
286 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
287 2818991444 Filimonas endophytica 3197 Isolate Unclassified
288 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
289 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
290 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
291 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
292 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
293 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
294 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
295 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
296 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
297 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
298 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
299 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
300 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
301 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
302 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
303 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
304 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
305 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
306 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
307 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
308 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
309 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
310 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
311 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
312 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
313 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
314 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
315 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
316 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
317 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
318 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
319 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
320 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
321 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
322 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
323 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
324 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
325 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
326 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
327 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
328 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
329 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.98
Metatranscriptomes 0
Isolates 9.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.82
Nodule 0.77
Rhizoplane 0.52
Rhizosphere 73.2
Stem 0
Stem Tuber 0
Unclassified 3.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100005780 3300005563 Bacteria 15095
2 SwRhRL2b_contig_1102694 2162886007 Bacteria 4114
3 SwRhRL2b_contig_2318651 2162886007 Bacteria 3080
4 JGI24740J21852_10004527 3300001979 Bacteria 5981
5 JGI24739J22299_10006887 3300001989 Bacteria 4282
6 JGI24737J22298_10006986 3300001990 Bacteria 3827
7 JGI24735J21928_10000016 3300002067 Bacteria 157028
8 JGI25162J39368_1000005 3300002737 Bacteria 435925
9 JGI25162J39368_1000161 3300002737 Bacteria 74216
10 JGI25162J39368_1001763 3300002737 Bacteria 10299
11 JGI25154J39366_1000003 3300002738 Bacteria 397627
12 JGI25157J39369_1002538 3300002741 Bacteria 4414
13 JGI25406J46586_10015793 3300003203 Bacteria 3171
14 JGI25165J46597_1001210 3300003214 Bacteria 15558
15 rootH1_10011283 3300003316 Bacteria 4874
16 rootH1_10015988 3300003316 Bacteria 11335
17 rootH1_10077136 3300003316 Bacteria 4980
18 rootH1_10093429 3300003316 Bacteria 2689
19 rootH1_10125406 3300003316 Bacteria 2690
20 rootH1_10126974 3300003316 Bacteria 3186
21 rootH1_10134713 3300003316 Bacteria 2299
22 rootH2_10000040 3300003320 Bacteria 68084
23 rootH2_10001435 3300003320 Bacteria 37408
24 rootH2_10001661 3300003320 Bacteria 18662
25 rootH2_10004220 3300003320 Bacteria 52880
26 rootH2_10006439 3300003320 Bacteria 29214
27 rootH2_10007549 3300003320 Bacteria 7795
28 rootH2_10031165 3300003320 Bacteria 16235
29 rootH2_10062478 3300003320 Bacteria 10722
30 rootH2_10090169 3300003320 Bacteria 7657
31 rootH2_10148453 3300003320 Bacteria 3594
32 rootH2_10148753 3300003320 Bacteria 3635
33 rootH2_10230939 3300003320 Bacteria 2789
34 rootL2_10029829 3300003322 Bacteria 12343
35 rootL2_10038171 3300003322 Bacteria 3575
36 rootL2_10060051 3300003322 Bacteria 3395
37 rootL2_10089683 3300003322 Bacteria 13947
38 rootL2_10089752 3300003322 Unclassified 2271
39 rootL2_10224022 3300003322 Bacteria 3353
40 rootL2_10239643 3300003322 Bacteria 2988
41 rootL2_10256246 3300003322 Bacteria 2908
42 rootL2_10288882 3300003322 Bacteria 2789
43 rootH1_10007228 3300003316 Bacteria 1529
44 rootH1_10007228 3300003323 Bacteria 16763
45 rootH1_10009967 3300003323 Bacteria 20514
46 rootH1_10037477 3300003323 Bacteria 9657
47 rootH1_10047628 3300003323 Bacteria 5181
48 rootH1_10060901 3300003323 Bacteria 7978
49 rootH1_10061241 3300003323 Bacteria 15628
50 rootH1_10063750 3300003323 Bacteria 6782
51 rootH1_10063751 3300003323 Bacteria 4684
52 rootH1_10084076 3300003323 Bacteria 2837
53 rootH1_10132616 3300003323 Bacteria 3907
54 rootH1_10156159 3300003323 Bacteria 10208
55 JGI25160J50197_1000733 3300003354 Bacteria 17961
56 JGI25160J50197_1007002 3300003354 Bacteria 4470
57 Ga0055535_1002136 3300003761 Bacteria 7733
58 Ga0055535_1002452 3300003761 Bacteria 6468
59 Ga0055542_1004230 3300003762 Bacteria 3559
60 Ga0055526_1004431 3300003771 Bacteria 8439
61 Ga0055526_1020551 3300003771 Bacteria 2342
62 Ga0055528_1000180 3300003790 Bacteria 53597
63 Ga0055530_10002883 3300003791 Bacteria 10469
64 Ga0055531_10000036 3300003794 Bacteria 147042
65 Ga0055531_10000159 3300003794 Bacteria 77708
66 Ga0055531_10000295 3300003794 Bacteria 49801
67 Ga0065165_1000019 3300005262 Bacteria 271815
68 Ga0065165_1016930 3300005262 Unclassified 2707
69 Ga0065714_10009084 3300005288 Bacteria 3261
70 Ga0065714_10076766 3300005288 Bacteria 2753
71 Ga0065714_10078013 3300005288 Bacteria 2638
72 Ga0065704_10003041 3300005289 Bacteria 4883
73 Ga0065704_10074482 3300005289 Bacteria 6246
74 Ga0065704_10074814 3300005289 Bacteria 5991
75 Ga0065715_10159268 3300005293 Bacteria 1645
76 Ga0070658_10106933 3300005327 Bacteria 2315
77 Ga0070658_10178492 3300005327 Bacteria 1787
78 Ga0070690_100009074 3300005330 Bacteria 5752
79 Ga0070670_100014386 3300005331 Bacteria 6789
80 Ga0070670_100029150 3300005331 Bacteria 4749
81 Ga0068869_100071896 3300005334 Bacteria 2562
82 Ga0070666_10003725 3300005335 Bacteria 9238
83 Ga0070666_10032465 3300005335 Bacteria 3449
84 Ga0070666_10053423 3300005335 Bacteria 2725
85 Ga0070680_100079619 3300005336 Bacteria 2701
86 Ga0068868_100015367 3300005338 Bacteria 5660
87 Ga0070660_100005439 3300005339 Bacteria 8821
88 Ga0070691_10025737 3300005341 Bacteria 2741
89 Ga0070671_100066512 3300005355 Bacteria 3004
90 Ga0070671_100087866 3300005355 Unclassified 2601
91 Ga0070673_100002752 3300005364 Bacteria 10800
92 Ga0070673_100015275 3300005364 Bacteria 5387
93 Ga0070673_100061200 3300005364 Bacteria 2986
94 Ga0070659_100001172 3300005366 Bacteria 19121
95 Ga0070659_100007089 3300005366 Bacteria 8128
96 Ga0070659_100007440 3300005366 Bacteria 7957
97 Ga0070659_100064498 3300005366 Bacteria 2899
98 Ga0070667_100080049 3300005367 Bacteria 2794
99 Ga0070714_100000081 3300005435 Bacteria 82594
100 Ga0070663_100061520 3300005455 Bacteria 2704
101 Ga0070678_100029318 3300005456 Unclassified 3766
102 Ga0070678_100069249 3300005456 Bacteria 2634
103 Ga0070662_100002133 3300005457 Bacteria 12133
104 Ga0070662_100003532 3300005457 Bacteria 9748
105 Ga0070681_10093730 3300005458 Bacteria 2952
106 Ga0068867_100000655 3300005459 Bacteria 22898
107 Ga0068867_100030334 3300005459 Unclassified 3901
108 Ga0068867_100082355 3300005459 Unclassified 2427
109 Ga0070684_100008572 3300005535 Bacteria 8005
110 Ga0068853_100000453 3300005539 Bacteria 27924
111 Ga0068853_100012007 3300005539 Bacteria 7045
112 Ga0068853_100020139 3300005539 Bacteria 5545
113 Ga0068853_100030162 3300005539 Bacteria 4579
114 Ga0068853_100060395 3300005539 Bacteria 3275
115 Ga0068853_100126390 3300005539 Bacteria 2284
116 Ga0068853_100166494 3300005539 Bacteria 1992
117 Ga0070672_100022895 3300005543 Unclassified 4597
118 Ga0070693_100042394 3300005547 Bacteria 2564
119 Ga0070665_100000041 3300005548 Bacteria 297849
120 Ga0070665_100000147 3300005548 Bacteria 129683
121 Ga0068855_100001107 3300005563 Bacteria 33518
122 Ga0068855_100011903 3300005563 Bacteria 10518
123 Ga0068855_100012759 3300005563 Bacteria 10133
124 Ga0068855_100013183 3300005563 Bacteria 9972
125 Ga0068855_100032981 3300005563 Bacteria 6182
126 Ga0068855_100050422 3300005563 Bacteria 4905
127 Ga0068855_100055421 3300005563 Bacteria 4657
128 Ga0068855_100066262 3300005563 Bacteria 4211
129 Ga0068855_100140471 3300005563 Bacteria 2754
130 Ga0070664_100016255 3300005564 Bacteria 6100
131 Ga0070664_100028760 3300005564 Bacteria 4627
132 Ga0068857_100023248 3300005577 Bacteria 5455
133 Ga0068857_100060637 3300005577 Bacteria 3360
134 Ga0068854_100027069 3300005578 Bacteria 3948
135 Ga0068856_100009075 3300005614 Bacteria 9675
136 Ga0068856_100037750 3300005614 Bacteria 4740
137 Ga0068856_100049900 3300005614 Bacteria 4125
138 Ga0068856_100139633 3300005614 Bacteria 2430
139 Ga0068856_100142068 3300005614 Unclassified 2408
140 Ga0068852_100000913 3300005616 Bacteria 19584
141 Ga0068852_100003549 3300005616 Bacteria 10913
142 Ga0068852_100007002 3300005616 Bacteria 8207
143 Ga0068852_100009586 3300005616 Bacteria 7195
144 Ga0068852_100027556 3300005616 Bacteria 4631
145 Ga0068859_100000024 3300005617 Bacteria 217931
146 Ga0068864_100024355 3300005618 Bacteria 5091
147 Ga0068851_10024733 3300005834 Unclassified 2941
148 Ga0068851_10062686 3300005834 Bacteria 1908
149 Ga0068863_100024717 3300005841 Bacteria 5729
150 Ga0068863_100099530 3300005841 Bacteria 2762
151 Ga0068858_100047842 3300005842 Bacteria 3964
152 Ga0068858_100057241 3300005842 Bacteria 3603
153 Ga0068858_100098361 3300005842 Unclassified 2728
154 Ga0068860_100000041 3300005843 Bacteria 227790
155 Ga0068860_100000052 3300005843 Bacteria 207351
156 Ga0068860_100000491 3300005843 Bacteria 48922
157 Ga0068860_100004518 3300005843 Bacteria 14199
158 Ga0068860_100006462 3300005843 Bacteria 11770
159 Ga0068860_100007089 3300005843 Bacteria 11212
160 Ga0068860_100008185 3300005843 Bacteria 10410
161 Ga0068860_100018183 3300005843 Bacteria 6841
162 Ga0097621_100000109 3300006237 Bacteria 46477
163 Ga0097621_100000551 3300006237 Bacteria 26354
164 Ga0097621_100027330 3300006237 Bacteria 4485
165 Ga0097621_100057280 3300006237 Bacteria 3186
166 Ga0068871_100000044 3300006358 Bacteria 67105
167 Ga0068871_100000072 3300006358 Bacteria 56289
168 Ga0068871_100036139 3300006358 Unclassified 3931
169 Ga0068865_100000309 3300006881 Bacteria 26968
170 Ga0097620_100000024 3300006931 Bacteria 217931
171 Ga0099824_1006574 3300006942 Bacteria 15878
172 Ga0079104_1000178 3300006946 Bacteria 90393
173 Ga0099826_10000598 3300006948 Bacteria 18315
174 Ga0105244_10000002 3300009036 Bacteria 495554
175 Ga0105244_10000095 3300009036 Bacteria 93295
176 Ga0105240_10000059 3300009093 Bacteria 219860
177 Ga0105240_10000100 3300009093 Bacteria 176640
178 Ga0105240_10000126 3300009093 Bacteria 157403
179 Ga0105240_10000547 3300009093 Bacteria 69491
180 Ga0105240_10000908 3300009093 Bacteria 52921
181 Ga0105240_10000998 3300009093 Bacteria 50528
182 Ga0105240_10001161 3300009093 Bacteria 46154
183 Ga0105240_10003553 3300009093 Bacteria 24191
184 Ga0105240_10006635 3300009093 Bacteria 16984
185 Ga0105240_10008415 3300009093 Bacteria 14761
186 Ga0105240_10012634 3300009093 Bacteria 11643
187 Ga0105240_10018443 3300009093 Bacteria 9369
188 Ga0105240_10022605 3300009093 Bacteria 8329
189 Ga0105240_10028461 3300009093 Bacteria 7299
190 Ga0105240_10045197 3300009093 Bacteria 5589
191 Ga0105240_10051777 3300009093 Bacteria 5165
192 Ga0105240_10075311 3300009093 Bacteria 4163
193 Ga0105240_10107311 3300009093 Unclassified 3386
194 Ga0105240_10296497 3300009093 Bacteria 1851
195 Ga0111539_10007347 3300009094 Bacteria 14110
196 Ga0105245_10033730 3300009098 Bacteria 4537
197 Ga0105245_10066035 3300009098 Bacteria 3273
198 Ga0105247_10004768 3300009101 Bacteria 8635
199 Ga0105243_10000012 3300009148 Bacteria 300885
200 Ga0105241_10000781 3300009174 Bacteria 24157
201 Ga0105241_10003048 3300009174 Bacteria 12499
202 Ga0105241_10005689 3300009174 Bacteria 9199
203 Ga0105241_10008207 3300009174 Bacteria 7688
204 Ga0105241_10020249 3300009174 Bacteria 4913
205 Ga0105242_10002511 3300009176 Bacteria 14394
206 Ga0105248_10094699 3300009177 Bacteria 3363
207 Ga0105237_10000107 3300009545 Bacteria 117149
208 Ga0105237_10000233 3300009545 Bacteria 79346
209 Ga0105237_10001116 3300009545 Bacteria 35964
210 Ga0105237_10002292 3300009545 Bacteria 23786
211 Ga0105237_10002431 3300009545 Bacteria 23124
212 Ga0105237_10002590 3300009545 Bacteria 22311
213 Ga0105237_10003316 3300009545 Bacteria 19172
214 Ga0105237_10003500 3300009545 Bacteria 18633
215 Ga0105237_10004181 3300009545 Bacteria 16811
216 Ga0105237_10004749 3300009545 Bacteria 15626
217 Ga0105237_10005449 3300009545 Bacteria 14351
218 Ga0105237_10006746 3300009545 Bacteria 12676
219 Ga0105237_10010582 3300009545 Bacteria 9799
220 Ga0105237_10011700 3300009545 Bacteria 9281
221 Ga0105237_10012117 3300009545 Bacteria 9101
222 Ga0105237_10016706 3300009545 Bacteria 7619
223 Ga0105237_10016806 3300009545 Bacteria 7595
224 Ga0105237_10019148 3300009545 Bacteria 7074
225 Ga0105237_10019660 3300009545 Bacteria 6973
226 Ga0105237_10022352 3300009545 Bacteria 6491
227 Ga0105237_10056820 3300009545 Bacteria 3916
228 Ga0105237_10149897 3300009545 Unclassified 2328
229 Ga0105237_10171829 3300009545 Bacteria 2167
230 Ga0105237_10236859 3300009545 Bacteria 1826
231 Ga0105238_10006406 3300009551 Bacteria 11710
232 Ga0105238_10013083 3300009551 Bacteria 8371
233 Ga0105238_10015542 3300009551 Bacteria 7706
234 Ga0105238_10055361 3300009551 Bacteria 3982
235 Ga0105238_10321234 3300009551 Bacteria 1534
236 Ga0105249_10021834 3300009553 Bacteria 5732
237 Ga0105249_10092691 3300009553 Bacteria 2828
238 Ga0105239_10000006 3300010375 Bacteria 442319
239 Ga0105239_10000011 3300010375 Bacteria 337500
240 Ga0105239_10000038 3300010375 Bacteria 205230
241 Ga0105239_10000071 3300010375 Bacteria 143060
242 Ga0105239_10000087 3300010375 Bacteria 129698
243 Ga0105239_10000089 3300010375 Bacteria 129415
244 Ga0105239_10000137 3300010375 Bacteria 102833
245 Ga0105239_10001021 3300010375 Bacteria 39112
246 Ga0105239_10001053 3300010375 Bacteria 38389
247 Ga0105239_10001274 3300010375 Bacteria 34004
248 Ga0105239_10001754 3300010375 Bacteria 28593
249 Ga0105239_10001888 3300010375 Bacteria 27395
250 Ga0105239_10002186 3300010375 Bacteria 25152
251 Ga0105239_10003136 3300010375 Bacteria 20512
252 Ga0105239_10003355 3300010375 Bacteria 19676
253 Ga0105239_10004088 3300010375 Bacteria 17547
254 Ga0105239_10005398 3300010375 Bacteria 15006
255 Ga0105239_10005536 3300010375 Bacteria 14786
256 Ga0105239_10012678 3300010375 Bacteria 9379
257 Ga0105239_10025334 3300010375 Bacteria 6530
258 Ga0105239_10029434 3300010375 Bacteria 6037
259 Ga0105239_10050644 3300010375 Bacteria 4554
260 Ga0105239_10057643 3300010375 Bacteria 4261
261 Ga0105239_10073420 3300010375 Bacteria 3761
262 Ga0105239_10244306 3300010375 Bacteria 2015
263 Ga0157373_10000001 3300013100 Bacteria 864756
264 Ga0157373_10000161 3300013100 Bacteria 54194
265 Ga0157373_10006672 3300013100 Bacteria 8601
266 Ga0157373_10007265 3300013100 Bacteria 8255
267 Ga0157371_10000363 3300013102 Bacteria 57446
268 Ga0157371_10001099 3300013102 Bacteria 29340
269 Ga0157371_10003809 3300013102 Bacteria 13493
270 Ga0157370_10000261 3300013104 Bacteria 66927
271 Ga0157370_10000381 3300013104 Bacteria 55829
272 Ga0157370_10000393 3300013104 Bacteria 54961
273 Ga0157370_10000464 3300013104 Bacteria 50658
274 Ga0157370_10000620 3300013104 Bacteria 44173
275 Ga0157370_10003580 3300013104 Bacteria 18172
276 Ga0157370_10005927 3300013104 Bacteria 13618
277 Ga0157370_10025272 3300013104 Bacteria 5879
278 Ga0157369_10001144 3300013105 Bacteria 33073
279 Ga0157369_10010399 3300013105 Bacteria 10605
280 Ga0157369_10011175 3300013105 Bacteria 10204
281 Ga0157369_10012719 3300013105 Bacteria 9544
282 Ga0157369_10024069 3300013105 Bacteria 6776
283 Ga0157369_10067899 3300013105 Bacteria 3831
284 Ga0157369_10190979 3300013105 Bacteria 2152
285 Ga0157374_10006987 3300013296 Bacteria 9608
286 Ga0157374_10009510 3300013296 Bacteria 8348
287 Ga0157374_10013535 3300013296 Bacteria 7122
288 Ga0157374_10034391 3300013296 Bacteria 4628
289 Ga0157374_10183848 3300013296 Unclassified 2043
290 Ga0157378_10001706 3300013297 Bacteria 19763
291 Ga0157378_10003365 3300013297 Bacteria 14220
292 Ga0157378_10005761 3300013297 Bacteria 10851
293 Ga0157378_10007635 3300013297 Bacteria 9439
294 Ga0157378_10013940 3300013297 Bacteria 7032
295 Ga0157378_10059904 3300013297 Bacteria 3397
296 Ga0157378_10076737 3300013297 Unclassified 3011
297 Ga0157378_10093338 3300013297 Bacteria 2739
298 Ga0163162_10000088 3300013306 Bacteria 85462
299 Ga0163162_10000154 3300013306 Bacteria 63581
300 Ga0163162_10000189 3300013306 Bacteria 56954
301 Ga0163162_10000446 3300013306 Bacteria 38191
302 Ga0163162_10000989 3300013306 Bacteria 26455
303 Ga0163162_10001715 3300013306 Bacteria 20533
304 Ga0163162_10010159 3300013306 Bacteria 9145
305 Ga0163162_10012102 3300013306 Bacteria 8418
306 Ga0157372_10000001 3300013307 Bacteria 791349
307 Ga0157372_10000894 3300013307 Bacteria 32388
308 Ga0157372_10001149 3300013307 Bacteria 28728
309 Ga0157372_10003311 3300013307 Bacteria 17404
310 Ga0157372_10003461 3300013307 Bacteria 17033
311 Ga0157372_10005758 3300013307 Bacteria 13205
312 Ga0157372_10019705 3300013307 Bacteria 7271
313 Ga0157372_10058939 3300013307 Bacteria 4293
314 Ga0157372_10081162 3300013307 Bacteria 3670
315 Ga0157372_10085157 3300013307 Bacteria 3584
316 Ga0157372_10203173 3300013307 Bacteria 2295
317 Ga0157375_10000212 3300013308 Bacteria 54441
318 Ga0157375_10013643 3300013308 Bacteria 7242
319 Ga0157375_10078808 3300013308 Bacteria 3329
320 Ga0157375_10264594 3300013308 Bacteria 1881
321 Ga0157375_10280974 3300013308 Bacteria 1828
322 Ga0163163_10000401 3300014325 Bacteria 40925
323 Ga0163163_10072488 3300014325 Unclassified 3433
324 Ga0163163_10125353 3300014325 Bacteria 2606
325 Ga0182008_10000100 3300014497 Bacteria 66862
326 Ga0157377_10021023 3300014745 Bacteria 3427
327 Ga0157379_10006200 3300014968 Bacteria 10298
328 Ga0157379_10019403 3300014968 Bacteria 6004
329 Ga0157379_10050872 3300014968 Bacteria 3699
330 Ga0157376_10001721 3300014969 Bacteria 14551
331 Ga0157376_10013206 3300014969 Bacteria 6155
332 Ga0182006_1001422 3300015261 Bacteria 14483
333 Ga0182005_1000458 3300015265 Bacteria 21410
334 Ga0163161_10000015 3300017792 Bacteria 250785
335 Ga0163161_10000016 3300017792 Bacteria 235591
336 Ga0163161_10000129 3300017792 Bacteria 70623
337 Ga0163161_10001424 3300017792 Bacteria 17655
338 Ga0163161_10005198 3300017792 Bacteria 9053
339 Ga0163161_10005491 3300017792 Bacteria 8792
340 Ga0163161_10053124 3300017792 Bacteria 2938
341 Ga0213876_10001314 3300021384 Bacteria 15620
342 Ga0207427_100323 3300025231 Bacteria 32232
343 Ga0209437_100030 3300025233 Bacteria 532466
344 Ga0209437_100043 3300025233 Bacteria 440454
345 Ga0209437_100077 3300025233 Bacteria 286656
346 Ga0209437_100093 3300025233 Bacteria 239733
347 Ga0209258_100029 3300025242 Bacteria 490648
348 Ga0209258_100036 3300025242 Bacteria 428859
349 Ga0209646_1000004 3300025246 Bacteria 786587
350 Ga0209646_1001113 3300025246 Bacteria 7929
351 Ga0209026_1000132 3300025250 Bacteria 119048
352 Ga0209026_1002237 3300025250 Bacteria 7445
353 Ga0209148_1000089 3300025254 Bacteria 253548
354 Ga0209148_1000139 3300025254 Bacteria 167011
355 Ga0209233_1000486 3300025261 Bacteria 24139
356 Ga0209233_1001892 3300025261 Bacteria 8030
357 Ga0209673_1000042 3300025273 Bacteria 300704
358 Ga0209564_1000840 3300025295 Bacteria 41373
359 Ga0209564_1004230 3300025295 Bacteria 8928
360 Ga0209758_1001003 3300025297 Bacteria 37543
361 Ga0209758_1003437 3300025297 Bacteria 14408
362 Ga0209758_1026375 3300025297 Bacteria 2516
363 Ga0209050_1000308 3300025298 Bacteria 99516
364 Ga0209050_1001642 3300025298 Bacteria 22859
365 Ga0207426_1000170 3300025302 Bacteria 164216
366 Ga0207426_1000192 3300025302 Bacteria 151680
367 Ga0207426_1000310 3300025302 Bacteria 96036
368 Ga0207426_1000316 3300025302 Bacteria 94148
369 Ga0207426_1006631 3300025302 Bacteria 4982
370 Ga0207426_1013256 3300025302 Bacteria 3061
371 Ga0209051_1036254 3300025303 Bacteria 1824
372 Ga0209257_1000006 3300025304 Bacteria 1570111
373 Ga0209257_1000008 3300025304 Bacteria 1294570
374 Ga0209257_1000077 3300025304 Bacteria 317964
375 Ga0209257_1001059 3300025304 Bacteria 36382
376 Ga0207656_10004894 3300025321 Bacteria 4701
377 Ga0207655_1000012 3300025728 Bacteria 640488
378 Ga0207680_10000455 3300025903 Bacteria 19322
379 Ga0207680_10099756 3300025903 Bacteria 1864
380 Ga0207647_10000082 3300025904 Bacteria 71437
381 Ga0207647_10000258 3300025904 Bacteria 43440
382 Ga0207647_10003046 3300025904 Bacteria 12596
383 Ga0207647_10025668 3300025904 Bacteria 3867
384 Ga0207645_10001313 3300025907 Bacteria 20428
385 Ga0207645_10004307 3300025907 Bacteria 10558
386 Ga0207705_10058257 3300025909 Bacteria 2787
387 Ga0207705_10089064 3300025909 Bacteria 2258
388 Ga0207654_10000944 3300025911 Bacteria 15963
389 Ga0207654_10060572 3300025911 Bacteria 2211
390 Ga0207654_10064360 3300025911 Unclassified 2156
391 Ga0207695_10000013 3300025913 Bacteria 821265
392 Ga0207695_10000027 3300025913 Bacteria 612456
393 Ga0207695_10000039 3300025913 Bacteria 454801
394 Ga0207695_10000067 3300025913 Bacteria 330915
395 Ga0207695_10000462 3300025913 Bacteria 88318
396 Ga0207695_10000636 3300025913 Bacteria 70234
397 Ga0207695_10001344 3300025913 Bacteria 41706
398 Ga0207695_10007657 3300025913 Bacteria 13682
399 Ga0207695_10010350 3300025913 Bacteria 11416
400 Ga0207695_10015824 3300025913 Bacteria 8860
401 Ga0207695_10019331 3300025913 Bacteria 7844
402 Ga0207695_10045756 3300025913 Bacteria 4643
403 Ga0207695_10055876 3300025913 Bacteria 4111
404 Ga0207695_10056712 3300025913 Bacteria 4075
405 Ga0207695_10124522 3300025913 Bacteria 2541
406 Ga0207671_10000904 3300025914 Bacteria 37479
407 Ga0207671_10001299 3300025914 Bacteria 29321
408 Ga0207671_10002877 3300025914 Bacteria 17823
409 Ga0207671_10003140 3300025914 Bacteria 16767
410 Ga0207671_10003329 3300025914 Bacteria 16151
411 Ga0207671_10003615 3300025914 Bacteria 15272
412 Ga0207671_10003994 3300025914 Bacteria 14339
413 Ga0207671_10008032 3300025914 Bacteria 9022
414 Ga0207671_10008692 3300025914 Bacteria 8571
415 Ga0207671_10010120 3300025914 Bacteria 7816
416 Ga0207671_10012711 3300025914 Bacteria 6752
417 Ga0207671_10013534 3300025914 Bacteria 6497
418 Ga0207671_10019677 3300025914 Bacteria 5156
419 Ga0207671_10019941 3300025914 Bacteria 5115
420 Ga0207671_10105088 3300025914 Unclassified 2142
421 Ga0207660_10055191 3300025917 Bacteria 2838
422 Ga0207657_10013025 3300025919 Bacteria 8171
423 Ga0207652_10015401 3300025921 Bacteria 6211
424 Ga0207694_10021422 3300025924 Bacteria 4898
425 Ga0207694_10117866 3300025924 Bacteria 2117
426 Ga0207650_10091479 3300025925 Bacteria 2325
427 Ga0207664_10000042 3300025929 Bacteria 154793
428 Ga0207644_10049573 3300025931 Bacteria 3007
429 Ga0207690_10027064 3300025932 Unclassified 3621
430 Ga0207690_10030606 3300025932 Bacteria 3435
431 Ga0207690_10078667 3300025932 Bacteria 2296
432 Ga0207706_10001583 3300025933 Bacteria 22590
433 Ga0207706_10007140 3300025933 Bacteria 10333
434 Ga0207686_10101551 3300025934 Bacteria 1922
435 Ga0207709_10000006 3300025935 Bacteria 800946
436 Ga0207704_10000220 3300025938 Bacteria 28668
437 Ga0207691_10003968 3300025940 Bacteria 14366
438 Ga0207691_10042786 3300025940 Bacteria 4174
439 Ga0207691_10053050 3300025940 Bacteria 3703
440 Ga0207689_10001522 3300025942 Bacteria 22065
441 Ga0207661_10042475 3300025944 Bacteria 3584
442 Ga0207679_10017412 3300025945 Bacteria 4794
443 Ga0207679_10102303 3300025945 Unclassified 2243
444 Ga0207667_10002393 3300025949 Bacteria 23487
445 Ga0207667_10003062 3300025949 Bacteria 20722
446 Ga0207667_10018573 3300025949 Bacteria 7793
447 Ga0207667_10020708 3300025949 Bacteria 7308
448 Ga0207667_10027149 3300025949 Bacteria 6240
449 Ga0207667_10067152 3300025949 Bacteria 3736
450 Ga0207667_10071267 3300025949 Bacteria 3614
451 Ga0207667_10102159 3300025949 Bacteria 2957
452 Ga0207667_10111978 3300025949 Bacteria 2815
453 Ga0207658_10038530 3300025986 Bacteria 3444
454 Ga0207677_10012512 3300026023 Bacteria 4882
455 Ga0207677_10108634 3300026023 Bacteria 2060
456 Ga0207703_10005373 3300026035 Bacteria 10318
457 Ga0207703_10076912 3300026035 Unclassified 2769
458 Ga0207639_10009010 3300026041 Bacteria 6871
459 Ga0207639_10021511 3300026041 Bacteria 4634
460 Ga0207639_10043781 3300026041 Bacteria 3363
461 Ga0207639_10068389 3300026041 Bacteria 2768
462 Ga0207639_10094247 3300026041 Bacteria 2403
463 Ga0207639_10162556 3300026041 Bacteria 1883
464 Ga0207678_10032459 3300026067 Bacteria 4550
465 Ga0207702_10002046 3300026078 Bacteria 19526
466 Ga0207702_10010352 3300026078 Bacteria 7810
467 Ga0207702_10047968 3300026078 Bacteria 3600
468 Ga0207702_10053235 3300026078 Bacteria 3426
469 Ga0207641_10000058 3300026088 Bacteria 166385
470 Ga0207641_10039984 3300026088 Unclassified 3923
471 Ga0207648_10001785 3300026089 Bacteria 23566
472 Ga0207648_10072778 3300026089 Unclassified 2995
473 Ga0207648_10137387 3300026089 Bacteria 2153
474 Ga0207674_10006611 3300026116 Bacteria 13626
475 Ga0207674_10076297 3300026116 Bacteria 3360
476 Ga0207683_10023502 3300026121 Bacteria 5303
477 Ga0207683_10031871 3300026121 Unclassified 4577
478 Ga0207683_10096155 3300026121 Bacteria 2641
479 Ga0207683_10129738 3300026121 Unclassified 2267
480 Ga0207698_10000512 3300026142 Bacteria 22530
481 Ga0207698_10024806 3300026142 Bacteria 4214
482 Ga0207698_10029005 3300026142 Bacteria 3956
483 Ga0207698_10033668 3300026142 Bacteria 3726
484 Ga0209281_1000299 3300027111 Bacteria 90106
485 Ga0209489_109017 3300027361 Bacteria 12906
486 Ga0209282_1020548 3300027666 Bacteria 4183
487 Ga0268266_10000014 3300028379 Bacteria 644033
488 Ga0268266_10000030 3300028379 Bacteria 417120
489 Ga0268266_10017463 3300028379 Bacteria 6119
490 Ga0268264_10000252 3300028381 Bacteria 99533
491 Ga0268264_10000327 3300028381 Bacteria 75326
492 Ga0268264_10000831 3300028381 Bacteria 33127
493 Ga0268264_10001298 3300028381 Bacteria 23546
494 Ga0268264_10002782 3300028381 Bacteria 15265
495 Ga0268264_10003965 3300028381 Bacteria 12669
496 Ga0268264_10014460 3300028381 Bacteria 6486
497 Ga0265337_1001402 3300028556 Bacteria 11832
498 Ga0265319_1000420 3300028563 Bacteria 30501
499 Ga0265319_1000467 3300028563 Bacteria 28640
500 Ga0265319_1003941 3300028563 Bacteria 7542
501 Ga0265319_1009624 3300028563 Bacteria 4097
502 Ga0265319_1009830 3300028563 Bacteria 4037
503 Ga0265318_10000515 3300028577 Bacteria 27834
504 Ga0265318_10002652 3300028577 Bacteria 9424
505 Ga0265318_10003776 3300028577 Bacteria 7524
506 Ga0265318_10008173 3300028577 Bacteria 4675
507 Ga0265322_10001539 3300028654 Bacteria 7422
508 Ga0265336_10000401 3300028666 Bacteria 27229
509 Ga0307517_10027990 3300028786 Bacteria 6742
510 Ga0307515_10000007 3300028794 Bacteria 719669
511 Ga0307515_10000059 3300028794 Bacteria 257520
512 Ga0307515_10001574 3300028794 Bacteria 50970
513 Ga0307515_10002884 3300028794 Bacteria 36561
514 Ga0265338_10000098 3300028800 Bacteria 159918
515 Ga0265338_10000301 3300028800 Bacteria 89146
516 Ga0265338_10078937 3300028800 Bacteria 2773
517 Ga0265324_10000039 3300029957 Bacteria 118772
518 Ga0265324_10009147 3300029957 Bacteria 3885
519 Ga0307511_10000264 3300030521 Bacteria 54303
520 Ga0265332_10024684 3300031238 Bacteria 2643
521 Ga0265320_10000211 3300031240 Bacteria 47112
522 Ga0265320_10002240 3300031240 Bacteria 13578
523 Ga0265320_10003659 3300031240 Bacteria 10262
524 Ga0265320_10004566 3300031240 Bacteria 9057
525 Ga0265320_10010814 3300031240 Bacteria 5407
526 Ga0265320_10017082 3300031240 Bacteria 4041
527 Ga0265325_10001472 3300031241 Bacteria 16577
528 Ga0265331_10013378 3300031250 Bacteria 4415
529 Ga0265327_10000055 3300031251 Bacteria 247188
530 Ga0265327_10000389 3300031251 Bacteria 82772
531 Ga0265327_10003823 3300031251 Bacteria 13917
532 Ga0265327_10006116 3300031251 Bacteria 9746
533 Ga0265316_10000749 3300031344 Bacteria 35852
534 Ga0265316_10047171 3300031344 Bacteria 3409
535 Ga0307408_100001985 3300031548 Bacteria 14769
536 Ga0265313_10000633 3300031595 Bacteria 36277
537 Ga0265313_10001548 3300031595 Bacteria 21373
538 Ga0265313_10004840 3300031595 Bacteria 10119
539 Ga0265313_10005787 3300031595 Bacteria 8980
540 Ga0265313_10013227 3300031595 Bacteria 4968
541 Ga0265314_10000072 3300031711 Bacteria 149041
542 Ga0265342_10020640 3300031712 Bacteria 4220
543 Ga0307410_10003514 3300031852 Bacteria 7872
544 Ga0307406_10000055 3300031901 Bacteria 62544
545 Ga0307406_10006654 3300031901 Bacteria 6389
546 Ga0307407_10000130 3300031903 Bacteria 23045
547 Ga0307416_100003315 3300032002 Bacteria 9415
548 Ga0307414_10000012 3300032004 Bacteria 322675
549 Ga0307414_10050702 3300032004 Bacteria 2876
550 Ga0307411_10000008 3300032005 Bacteria 321575
551 Ga0307510_10000190 3300033180 Bacteria 53134
552 Ga0307510_10022235 3300033180 Bacteria 7369
553 Ga0373927_0103772 3300035695 Unclassified 1850
554 Ga0395899_0000001 3300037312 Bacteria 1750322
555 Ga0395899_0000676 3300037312 Bacteria 34533
556 Ga0395905_0000001 3300037471 Bacteria 2037079
557 Ga0395905_0008047 3300037471 Bacteria 10416
558 Ga0436365_0473715 3300039437 Bacteria 54513
559 Ga0436365_1374220 3300039437 Bacteria 5891
560 Ga0439431_0000737 3300041997 Bacteria 7068
561 Ga0466969_0020515 3300044656 Bacteria 3421
562 Ga0466972_0000055 3300044658 Bacteria 111338
563 Ga0466972_0000064 3300044658 Bacteria 104558
564 Ga0466972_0006983 3300044658 Bacteria 5664
565 Ga0466972_0053648 3300044658 Bacteria 1941
566 Ga0466966_0000030 3300044684 Bacteria 103300
567 Ga0466961_0044859 3300044693 Bacteria 2829
568 Ga0453684_0007525 3300044712 Bacteria 19979
569 Ga0453684_0242806 3300044712 Bacteria 2072
570 Ga0466970_0004697 3300044765 Bacteria 6747
571 Ga0466970_0007538 3300044765 Bacteria 5458
572 Ga0466970_0031721 3300044765 Bacteria 2791
573 Ga0466957_0004583 3300044842 Bacteria 7723
574 Ga0466957_0005287 3300044842 Bacteria 7233
575 Ga0466957_0010945 3300044842 Bacteria 5217
576 Ga0466957_0027203 3300044842 Bacteria 3397
577 Ga0466959_0000009 3300045049 Bacteria 176964
578 Ga0466959_0002393 3300045049 Bacteria 11965
579 Ga0495627_011886 3300046453 Unclassified 3106
580 Ga0495638_0000006 3300046460 Bacteria 668846
581 Ga0495650_0000127 3300046471 Bacteria 177276
582 Ga0495585_0000088 3300046492 Bacteria 96490
583 Ga0495585_0009559 3300046492 Bacteria 5804
584 Ga0495606_0000033 3300046507 Bacteria 247739
585 Ga0495606_0011985 3300046507 Bacteria 7003
586 Ga0495606_0020200 3300046507 Bacteria 4922
587 Ga0495606_0023809 3300046507 Bacteria 4428
588 Ga0495606_0059733 3300046507 Bacteria 2445
589 Ga0495606_0061665 3300046507 Bacteria 2397
590 Ga0495610_0000350 3300046512 Bacteria 48523
591 Ga0495610_0001633 3300046512 Bacteria 19730
592 Ga0495631_0002396 3300046518 Bacteria 10595
593 Ga0495632_0055057 3300046519 Bacteria 1948
594 Ga0495643_0000357 3300046522 Bacteria 62250
595 Ga0495643_0000542 3300046522 Bacteria 46816
596 Ga0495643_0031212 3300046522 Bacteria 2967
597 Ga0495663_0007878 3300046525 Bacteria 2944
598 Ga0495609_0002951 3300046538 Bacteria 10058
599 Ga0495609_0015316 3300046538 Bacteria 3590
600 Ga0495633_0000067 3300046558 Bacteria 139122
601 Ga0495633_0000869 3300046558 Bacteria 26201
602 Ga0495633_0003779 3300046558 Bacteria 9930
603 Ga0495668_0000069 3300046616 Bacteria 174287
604 Ga0495668_0001902 3300046616 Bacteria 18682
605 Ga0495611_0000046 3300046648 Bacteria 88300
606 Ga0495611_0000106 3300046648 Bacteria 58129
607 Ga0495625_0000048 3300046660 Bacteria 198976
608 Ga0495625_0000419 3300046660 Bacteria 63844
609 Ga0495625_0002288 3300046660 Bacteria 20992
610 Ga0495625_0019975 3300046660 Bacteria 5182
611 Ga0495661_0002260 3300046665 Bacteria 14910
612 Ga0495661_0007898 3300046665 Bacteria 7391
613 Ga0495661_0055728 3300046665 Bacteria 2368
614 Ga0495649_0000146 3300046694 Bacteria 61862
615 Ga0495660_0012841 3300046810 Bacteria 4859
616 Ga0495683_0068468 3300047323 Bacteria 1746
617 Ga0495687_000144 3300047443 Bacteria 108217
618 Ga0495687_001622 3300047443 Bacteria 20265
619 Ga0495686_0000040 3300047472 Bacteria 301210
620 Ga0495686_0000041 3300047472 Bacteria 297599
621 Ga0495686_0000058 3300047472 Bacteria 240089
622 Ga0495686_0000454 3300047472 Bacteria 61738
623 Ga0495686_0000938 3300047472 Bacteria 36167
624 Ga0495686_0001041 3300047472 Bacteria 33277
625 Ga0496101_0064240 3300048904 Unclassified 2673
626 Ga0496114_0080679 3300048917 Unclassified 2748
627 Ga0496115_0006177 3300048918 Bacteria 8762
628 Ga0496116_0000004 3300048919 Bacteria 839841
629 Ga0496116_0000047 3300048919 Bacteria 315121
630 Ga0496116_0001943 3300048919 Bacteria 22262
631 Ga0496117_0003199 3300048920 Bacteria 19389
632 Ga0496121_0000007 3300048924 Bacteria 942516
633 Ga0496121_0024856 3300048924 Bacteria 5712
634 Ga0496121_0100184 3300048924 Bacteria 2237
635 Ga0496122_0002274 3300048925 Bacteria 27798
636 Ga0496122_0002475 3300048925 Bacteria 26106
637 Ga0496123_0033280 3300048926 Bacteria 3712
638 Ga0496124_0015640 3300048927 Bacteria 7262
639 Ga0496125_0000012 3300048928 Bacteria 651142
640 Ga0496125_0000050 3300048928 Bacteria 286703
641 Ga0496125_0000483 3300048928 Bacteria 70302
642 Ga0496126_0004174 3300048929 Bacteria 17438
643 Ga0496126_0022098 3300048929 Bacteria 6196
644 Ga0495678_003658 3300049459 Bacteria 9334
645 Ga0501031_0029530 3300049568 Bacteria 3576
646 Ga0501033_0058914 3300049570 Bacteria 2836
647 Ga0501034_0036525 3300049571 Bacteria 4977
648 Ga0501034_0041531 3300049571 Bacteria 4654
649 Ga0501036_0072346 3300049572 Bacteria 2914
650 Ga0501037_0008518 3300049573 Bacteria 7523
651 Ga0501038_0010723 3300049574 Bacteria 8377
652 Ga0501043_0081596 3300049579 Bacteria 2541
653 Ga0501046_0082021 3300049580 Bacteria 2491
654 Ga0501047_0075165 3300049581 Bacteria 3251
655 Ga0501047_0186317 3300049581 Bacteria 1941
656 Ga0501238_000216 3300049671 Bacteria 8280
657 Ga0501247_000051 3300049677 Bacteria 6402
658 Ga0501249_000027 3300049679 Bacteria 87387
659 Ga0501219_000280 3300049703 Bacteria 9053
660 Ga0501241_000127 3300049758 Bacteria 16544
661 Ga0501241_001897 3300049758 Bacteria 4108
662 Ga0501241_001963 3300049758 Bacteria 4037
663 Ga0501241_003329 3300049758 Bacteria 3038
664 Ga0501266_000004 3300049763 Bacteria 356286
665 Ga0501280_000632 3300049776 Bacteria 8001
666 Ga0501035_0186598 3300049822 Bacteria 1784
667 Ga0501044_0080680 3300049823 Bacteria 3295
668 Ga0501284_00002 3300050005 Bacteria 220402
669 nmdc:mga0k408_497_c1 3300050493 Bacteria 21567
670 nmdc:mga0k408_7085_c1 3300050493 Bacteria 5989
671 nmdc:mga08y16_99331_c1 3300050511 Bacteria 3030
672 Ga0500578_0000029 3300053086 Bacteria 140078
673 Ga0500578_0021871 3300053086 Bacteria 4108
674 Ga0500644_0000071 3300053088 Bacteria 60641
675 Ga0500644_0000155 3300053088 Bacteria 42910
676 Ga0500644_0001116 3300053088 Bacteria 7906
677 Ga0500644_0001528 3300053088 Bacteria 6079
678 Ga0500644_0006229 3300053088 Bacteria 3048
679 Ga0500583_0000053 3300053092 Bacteria 74724
680 Ga0500651_0011345 3300053093 Bacteria 5370
681 Ga0500651_0049750 3300053093 Bacteria 2632
682 Ga0500641_0000020 3300053096 Bacteria 119591
683 Ga0500641_0000025 3300053096 Bacteria 108050
684 Ga0500641_0000553 3300053096 Bacteria 13499
685 Ga0500641_0001693 3300053096 Bacteria 7842
686 Ga0500562_000029 3300053108 Bacteria 94705
687 Ga0500569_012683 3300053109 Bacteria 2044
688 Ga0500618_000073 3300053125 Bacteria 81706
689 Ga0500618_006949 3300053125 Bacteria 3272
690 Ga0500652_005048 3300053131 Bacteria 4125
691 Ga0500652_014800 3300053131 Bacteria 2799
692 Ga0500658_0000010 3300053134 Bacteria 248149
693 Ga0500658_0000895 3300053134 Bacteria 12204
694 Ga0500568_0046215 3300053139 Bacteria 1729
695 Ga0500577_0001383 3300053142 Bacteria 6199
696 Ga0500577_0001852 3300053142 Bacteria 5417
697 Ga0500616_0000044 3300053153 Bacteria 339611
698 Ga0500616_0031602 3300053153 Bacteria 2898
699 Ga0500622_0000304 3300053156 Bacteria 50299
700 Ga0500622_0000305 3300053156 Bacteria 50294
701 Ga0500622_0001510 3300053156 Bacteria 18461
702 Ga0500622_0003237 3300053156 Bacteria 11063
703 Ga0500624_000231 3300053157 Bacteria 20263
704 Ga0500633_0003732 3300053160 Bacteria 3372
705 Ga0500633_0015264 3300053160 Bacteria 2200
706 Ga0466962_0058894 3300061719 Bacteria 1833
707 2513232265 2513020052 Bacteria 5120511
708 2520881906 2519899754 Bacteria 5336938
709 2599478882 2599185184 Bacteria 6430550
710 2644009813 2643221600 Bacteria 5530138
711 2644369742 2643221667 Bacteria 5627472
712 2644374230 2643221667 Bacteria 5627472
713 2644640559 2643221716 Bacteria 4986332
714 2644683704 2643221725 Bacteria 5087956
715 2722729286 2721755487 Bacteria 6357185
716 2738698586 2738541273 Bacteria 4048577
717 2738733205 2738541279 Bacteria 6149495
718 2738733289 2738541279 Bacteria 6149495
719 2738754220 2738541283 Bacteria 7222293
720 2738765743 2738541285 Bacteria 6150075
721 2738765827 2738541285 Bacteria 6150075
722 2739214786 2738543007 Bacteria 6149845
723 2739214870 2738543007 Bacteria 6149845
724 2739252912 2738543014 Bacteria 4048139
725 2740002472 2739367857 Bacteria 5433684
726 2740007288 2739367858 Bacteria 5432813
727 2740032287 2739367866 Bacteria 4215900
728 2802652409 2802428842 Bacteria 4926114
729 2817417410 2816332280 Bacteria 5109718
730 2819578119 2818991442 Bacteria 8318214
731 2819588678 2818991444 Bacteria 6968812
732 2819682133 2818991460 Bacteria 7595395
733 2821139235 2821136567 Bacteria 8080116
734 2840677970 2840677318 Bacteria 2664183
735 2857615883 2857613821 Bacteria 4917088
736 2857620372 2857618242 Bacteria 5635925
737 2881250788 2881247448 Bacteria 3717788
738 2881362653 2881359912 Bacteria 4935907
739 2883070862 2883068021 Bacteria 6192739
740 2884795105 2884791551 Bacteria 8511252
741 2896085787 2896085136 Bacteria 6129793
742 2896114037 2896109856 Bacteria 7140722
743 2898715959 2898713307 Bacteria 4110805
744 2903897856 2903895155 Bacteria 5258610
745 2904422078 2904419702 Bacteria 5166287
746 2904473200 2904467357 Bacteria 8057758
747 2904559086 2904555929 Bacteria 5218588
748 2904780961 2904780799 Bacteria 5840761
749 2911138966 2911138879 Bacteria 5811561
750 2919180575 2919177583 Bacteria 5641607
751 2919192114 2919191525 Bacteria 5765973
752 2919438673 2919437846 Bacteria 6199444
753 2919511724 2919509842 Bacteria 4104664
754 2919686032 2919683626 Bacteria 5534354
755 2928082892 2928078545 Bacteria 6534839
756 2928149910 2928147474 Bacteria 6512076
757 2929154674 2929150217 Bacteria 5462483
758 2929157637 2929154850 Bacteria 6753285
759 2929182520 2929177148 Bacteria 7883697
760 2929242294 2929239360 Bacteria 7745570
761 2929244161 2929239360 Bacteria 7745570
762 2929922266 2929921140 Bacteria 8649150
763 2929925867 2929921140 Bacteria 8649150
764 2932086213 2932082852 Bacteria 6563563
765 2945978445 2945977869 Bacteria 7777518
766 2946015691 2946013367 Bacteria 7766675
767 2958459085 2958458903 Bacteria 5301041
768 2958512674 2958512119 Bacteria 4528530
769 2965320533 2965320100 Bacteria 3975600
770 2965323318 2965320100 Bacteria 3975600
771 2977271507 2977268062 Bacteria 5243061
772 8003154777 8003151029 Bacteria 8187759
773 8054310538 8054307821 Bacteria 5212224
774 8055423034 8055419101 Bacteria 5289643
775 8055596614 8055592153 Bacteria 5961247
776 8056442064 8056440228 Bacteria 4946504
777 Ga0068855_100005780
778 SwRhRL2b_contig_1102694
779 SwRhRL2b_contig_2318651
780 JGI24740J21852_10004527
781 JGI24739J22299_10006887
782 JGI24737J22298_10006986
783 JGI24735J21928_10000016
784 JGI25162J39368_1000005
785 JGI25162J39368_1000161
786 JGI25162J39368_1001763
787 JGI25154J39366_1000003
788 JGI25157J39369_1002538
789 JGI25406J46586_10015793
790 JGI25165J46597_1001210
791 rootH1_10011283
792 rootH1_10015988
793 rootH1_10077136
794 rootH1_10093429
795 rootH1_10125406
796 rootH1_10126974
797 rootH1_10134713
798 rootH2_10000040
799 rootH2_10001435
800 rootH2_10001661
801 rootH2_10004220
802 rootH2_10006439
803 rootH2_10007549
804 rootH2_10031165
805 rootH2_10062478
806 rootH2_10090169
807 rootH2_10148453
808 rootH2_10148753
809 rootH2_10230939
810 rootL2_10029829
811 rootL2_10038171
812 rootL2_10060051
813 rootL2_10089683
814 rootL2_10089752
815 rootL2_10224022
816 rootL2_10239643
817 rootL2_10256246
818 rootL2_10288882
819 rootH1_10007228
820 rootH1_10009967
821 rootH1_10037477
822 rootH1_10047628
823 rootH1_10060901
824 rootH1_10061241
825 rootH1_10063750
826 rootH1_10063751
827 rootH1_10084076
828 rootH1_10132616
829 rootH1_10156159
830 JGI25160J50197_1000733
831 JGI25160J50197_1007002
832 Ga0055535_1002136
833 Ga0055535_1002452
834 Ga0055542_1004230
835 Ga0055526_1004431
836 Ga0055526_1020551
837 Ga0055528_1000180
838 Ga0055530_10002883
839 Ga0055531_10000036
840 Ga0055531_10000159
841 Ga0055531_10000295
842 Ga0065165_1000019
843 Ga0065165_1016930
844 Ga0065714_10009084
845 Ga0065714_10076766
846 Ga0065714_10078013
847 Ga0065704_10003041
848 Ga0065704_10074482
849 Ga0065704_10074814
850 Ga0065715_10159268
851 Ga0070658_10106933
852 Ga0070658_10178492
853 Ga0070690_100009074
854 Ga0070670_100014386
855 Ga0070670_100029150
856 Ga0068869_100071896
857 Ga0070666_10003725
858 Ga0070666_10032465
859 Ga0070666_10053423
860 Ga0070680_100079619
861 Ga0068868_100015367
862 Ga0070660_100005439
863 Ga0070691_10025737
864 Ga0070671_100066512
865 Ga0070671_100087866
866 Ga0070673_100002752
867 Ga0070673_100015275
868 Ga0070673_100061200
869 Ga0070659_100001172
870 Ga0070659_100007089
871 Ga0070659_100007440
872 Ga0070659_100064498
873 Ga0070667_100080049
874 Ga0070714_100000081
875 Ga0070663_100061520
876 Ga0070678_100029318
877 Ga0070678_100069249
878 Ga0070662_100002133
879 Ga0070662_100003532
880 Ga0070681_10093730
881 Ga0068867_100000655
882 Ga0068867_100030334
883 Ga0068867_100082355
884 Ga0070684_100008572
885 Ga0068853_100000453
886 Ga0068853_100012007
887 Ga0068853_100020139
888 Ga0068853_100030162
889 Ga0068853_100060395
890 Ga0068853_100126390
891 Ga0068853_100166494
892 Ga0070672_100022895
893 Ga0070693_100042394
894 Ga0070665_100000041
895 Ga0070665_100000147
896 Ga0068855_100001107
897 Ga0068855_100011903
898 Ga0068855_100012759
899 Ga0068855_100013183
900 Ga0068855_100032981
901 Ga0068855_100050422
902 Ga0068855_100055421
903 Ga0068855_100066262
904 Ga0068855_100140471
905 Ga0070664_100016255
906 Ga0070664_100028760
907 Ga0068857_100023248
908 Ga0068857_100060637
909 Ga0068854_100027069
910 Ga0068856_100009075
911 Ga0068856_100037750
912 Ga0068856_100049900
913 Ga0068856_100139633
914 Ga0068856_100142068
915 Ga0068852_100000913
916 Ga0068852_100003549
917 Ga0068852_100007002
918 Ga0068852_100009586
919 Ga0068852_100027556
920 Ga0068859_100000024
921 Ga0068864_100024355
922 Ga0068851_10024733
923 Ga0068851_10062686
924 Ga0068863_100024717
925 Ga0068863_100099530
926 Ga0068858_100047842
927 Ga0068858_100057241
928 Ga0068858_100098361
929 Ga0068860_100000041
930 Ga0068860_100000052
931 Ga0068860_100000491
932 Ga0068860_100004518
933 Ga0068860_100006462
934 Ga0068860_100007089
935 Ga0068860_100008185
936 Ga0068860_100018183
937 Ga0097621_100000109
938 Ga0097621_100000551
939 Ga0097621_100027330
940 Ga0097621_100057280
941 Ga0068871_100000044
942 Ga0068871_100000072
943 Ga0068871_100036139
944 Ga0068865_100000309
945 Ga0097620_100000024
946 Ga0099824_1006574
947 Ga0079104_1000178
948 Ga0099826_10000598
949 Ga0105244_10000002
950 Ga0105244_10000095
951 Ga0105240_10000059
952 Ga0105240_10000100
953 Ga0105240_10000126
954 Ga0105240_10000547
955 Ga0105240_10000908
956 Ga0105240_10000998
957 Ga0105240_10001161
958 Ga0105240_10003553
959 Ga0105240_10006635
960 Ga0105240_10008415
961 Ga0105240_10012634
962 Ga0105240_10018443
963 Ga0105240_10022605
964 Ga0105240_10028461
965 Ga0105240_10045197
966 Ga0105240_10051777
967 Ga0105240_10075311
968 Ga0105240_10107311
969 Ga0105240_10296497
970 Ga0111539_10007347
971 Ga0105245_10033730
972 Ga0105245_10066035
973 Ga0105247_10004768
974 Ga0105243_10000012
975 Ga0105241_10000781
976 Ga0105241_10003048
977 Ga0105241_10005689
978 Ga0105241_10008207
979 Ga0105241_10020249
980 Ga0105242_10002511
981 Ga0105248_10094699
982 Ga0105237_10000107
983 Ga0105237_10000233
984 Ga0105237_10001116
985 Ga0105237_10002292
986 Ga0105237_10002431
987 Ga0105237_10002590
988 Ga0105237_10003316
989 Ga0105237_10003500
990 Ga0105237_10004181
991 Ga0105237_10004749
992 Ga0105237_10005449
993 Ga0105237_10006746
994 Ga0105237_10010582
995 Ga0105237_10011700
996 Ga0105237_10012117
997 Ga0105237_10016706
998 Ga0105237_10016806
999 Ga0105237_10019148
1000 Ga0105237_10019660
1001 Ga0105237_10022352
1002 Ga0105237_10056820
1003 Ga0105237_10149897
1004 Ga0105237_10171829
1005 Ga0105237_10236859
1006 Ga0105238_10006406
1007 Ga0105238_10013083
1008 Ga0105238_10015542
1009 Ga0105238_10055361
1010 Ga0105238_10321234
1011 Ga0105249_10021834
1012 Ga0105249_10092691
1013 Ga0105239_10000006
1014 Ga0105239_10000011
1015 Ga0105239_10000038
1016 Ga0105239_10000071
1017 Ga0105239_10000087
1018 Ga0105239_10000089
1019 Ga0105239_10000137
1020 Ga0105239_10001021
1021 Ga0105239_10001053
1022 Ga0105239_10001274
1023 Ga0105239_10001754
1024 Ga0105239_10001888
1025 Ga0105239_10002186
1026 Ga0105239_10003136
1027 Ga0105239_10003355
1028 Ga0105239_10004088
1029 Ga0105239_10005398
1030 Ga0105239_10005536
1031 Ga0105239_10012678
1032 Ga0105239_10025334
1033 Ga0105239_10029434
1034 Ga0105239_10050644
1035 Ga0105239_10057643
1036 Ga0105239_10073420
1037 Ga0105239_10244306
1038 Ga0157373_10000001
1039 Ga0157373_10000161
1040 Ga0157373_10006672
1041 Ga0157373_10007265
1042 Ga0157371_10000363
1043 Ga0157371_10001099
1044 Ga0157371_10003809
1045 Ga0157370_10000261
1046 Ga0157370_10000381
1047 Ga0157370_10000393
1048 Ga0157370_10000464
1049 Ga0157370_10000620
1050 Ga0157370_10003580
1051 Ga0157370_10005927
1052 Ga0157370_10025272
1053 Ga0157369_10001144
1054 Ga0157369_10010399
1055 Ga0157369_10011175
1056 Ga0157369_10012719
1057 Ga0157369_10024069
1058 Ga0157369_10067899
1059 Ga0157369_10190979
1060 Ga0157374_10006987
1061 Ga0157374_10009510
1062 Ga0157374_10013535
1063 Ga0157374_10034391
1064 Ga0157374_10183848
1065 Ga0157378_10001706
1066 Ga0157378_10003365
1067 Ga0157378_10005761
1068 Ga0157378_10007635
1069 Ga0157378_10013940
1070 Ga0157378_10059904
1071 Ga0157378_10076737
1072 Ga0157378_10093338
1073 Ga0163162_10000088
1074 Ga0163162_10000154
1075 Ga0163162_10000189
1076 Ga0163162_10000446
1077 Ga0163162_10000989
1078 Ga0163162_10001715
1079 Ga0163162_10010159
1080 Ga0163162_10012102
1081 Ga0157372_10000001
1082 Ga0157372_10000894
1083 Ga0157372_10001149
1084 Ga0157372_10003311
1085 Ga0157372_10003461
1086 Ga0157372_10005758
1087 Ga0157372_10019705
1088 Ga0157372_10058939
1089 Ga0157372_10081162
1090 Ga0157372_10085157
1091 Ga0157372_10203173
1092 Ga0157375_10000212
1093 Ga0157375_10013643
1094 Ga0157375_10078808
1095 Ga0157375_10264594
1096 Ga0157375_10280974
1097 Ga0163163_10000401
1098 Ga0163163_10072488
1099 Ga0163163_10125353
1100 Ga0182008_10000100
1101 Ga0157377_10021023
1102 Ga0157379_10006200
1103 Ga0157379_10019403
1104 Ga0157379_10050872
1105 Ga0157376_10001721
1106 Ga0157376_10013206
1107 Ga0182006_1001422
1108 Ga0182005_1000458
1109 Ga0163161_10000015
1110 Ga0163161_10000016
1111 Ga0163161_10000129
1112 Ga0163161_10001424
1113 Ga0163161_10005198
1114 Ga0163161_10005491
1115 Ga0163161_10053124
1116 Ga0213876_10001314
1117 Ga0207427_100323
1118 Ga0209437_100030
1119 Ga0209437_100043
1120 Ga0209437_100077
1121 Ga0209437_100093
1122 Ga0209258_100029
1123 Ga0209258_100036
1124 Ga0209646_1000004
1125 Ga0209646_1001113
1126 Ga0209026_1000132
1127 Ga0209026_1002237
1128 Ga0209148_1000089
1129 Ga0209148_1000139
1130 Ga0209233_1000486
1131 Ga0209233_1001892
1132 Ga0209673_1000042
1133 Ga0209564_1000840
1134 Ga0209564_1004230
1135 Ga0209758_1001003
1136 Ga0209758_1003437
1137 Ga0209758_1026375
1138 Ga0209050_1000308
1139 Ga0209050_1001642
1140 Ga0207426_1000170
1141 Ga0207426_1000192
1142 Ga0207426_1000310
1143 Ga0207426_1000316
1144 Ga0207426_1006631
1145 Ga0207426_1013256
1146 Ga0209051_1036254
1147 Ga0209257_1000006
1148 Ga0209257_1000008
1149 Ga0209257_1000077
1150 Ga0209257_1001059
1151 Ga0207656_10004894
1152 Ga0207655_1000012
1153 Ga0207680_10000455
1154 Ga0207680_10099756
1155 Ga0207647_10000082
1156 Ga0207647_10000258
1157 Ga0207647_10003046
1158 Ga0207647_10025668
1159 Ga0207645_10001313
1160 Ga0207645_10004307
1161 Ga0207705_10058257
1162 Ga0207705_10089064
1163 Ga0207654_10000944
1164 Ga0207654_10060572
1165 Ga0207654_10064360
1166 Ga0207695_10000013
1167 Ga0207695_10000027
1168 Ga0207695_10000039
1169 Ga0207695_10000067
1170 Ga0207695_10000462
1171 Ga0207695_10000636
1172 Ga0207695_10001344
1173 Ga0207695_10007657
1174 Ga0207695_10010350
1175 Ga0207695_10015824
1176 Ga0207695_10019331
1177 Ga0207695_10045756
1178 Ga0207695_10055876
1179 Ga0207695_10056712
1180 Ga0207695_10124522
1181 Ga0207671_10000904
1182 Ga0207671_10001299
1183 Ga0207671_10002877
1184 Ga0207671_10003140
1185 Ga0207671_10003329
1186 Ga0207671_10003615
1187 Ga0207671_10003994
1188 Ga0207671_10008032
1189 Ga0207671_10008692
1190 Ga0207671_10010120
1191 Ga0207671_10012711
1192 Ga0207671_10013534
1193 Ga0207671_10019677
1194 Ga0207671_10019941
1195 Ga0207671_10105088
1196 Ga0207660_10055191
1197 Ga0207657_10013025
1198 Ga0207652_10015401
1199 Ga0207694_10021422
1200 Ga0207694_10117866
1201 Ga0207650_10091479
1202 Ga0207664_10000042
1203 Ga0207644_10049573
1204 Ga0207690_10027064
1205 Ga0207690_10030606
1206 Ga0207690_10078667
1207 Ga0207706_10001583
1208 Ga0207706_10007140
1209 Ga0207686_10101551
1210 Ga0207709_10000006
1211 Ga0207704_10000220
1212 Ga0207691_10003968
1213 Ga0207691_10042786
1214 Ga0207691_10053050
1215 Ga0207689_10001522
1216 Ga0207661_10042475
1217 Ga0207679_10017412
1218 Ga0207679_10102303
1219 Ga0207667_10002393
1220 Ga0207667_10003062
1221 Ga0207667_10018573
1222 Ga0207667_10020708
1223 Ga0207667_10027149
1224 Ga0207667_10067152
1225 Ga0207667_10071267
1226 Ga0207667_10102159
1227 Ga0207667_10111978
1228 Ga0207658_10038530
1229 Ga0207677_10012512
1230 Ga0207677_10108634
1231 Ga0207703_10005373
1232 Ga0207703_10076912
1233 Ga0207639_10009010
1234 Ga0207639_10021511
1235 Ga0207639_10043781
1236 Ga0207639_10068389
1237 Ga0207639_10094247
1238 Ga0207639_10162556
1239 Ga0207678_10032459
1240 Ga0207702_10002046
1241 Ga0207702_10010352
1242 Ga0207702_10047968
1243 Ga0207702_10053235
1244 Ga0207641_10000058
1245 Ga0207641_10039984
1246 Ga0207648_10001785
1247 Ga0207648_10072778
1248 Ga0207648_10137387
1249 Ga0207674_10006611
1250 Ga0207674_10076297
1251 Ga0207683_10023502
1252 Ga0207683_10031871
1253 Ga0207683_10096155
1254 Ga0207683_10129738
1255 Ga0207698_10000512
1256 Ga0207698_10024806
1257 Ga0207698_10029005
1258 Ga0207698_10033668
1259 Ga0209281_1000299
1260 Ga0209489_109017
1261 Ga0209282_1020548
1262 Ga0268266_10000014
1263 Ga0268266_10000030
1264 Ga0268266_10017463
1265 Ga0268264_10000252
1266 Ga0268264_10000327
1267 Ga0268264_10000831
1268 Ga0268264_10001298
1269 Ga0268264_10002782
1270 Ga0268264_10003965
1271 Ga0268264_10014460
1272 Ga0265337_1001402
1273 Ga0265319_1000420
1274 Ga0265319_1000467
1275 Ga0265319_1003941
1276 Ga0265319_1009624
1277 Ga0265319_1009830
1278 Ga0265318_10000515
1279 Ga0265318_10002652
1280 Ga0265318_10003776
1281 Ga0265318_10008173
1282 Ga0265322_10001539
1283 Ga0265336_10000401
1284 Ga0307517_10027990
1285 Ga0307515_10000007
1286 Ga0307515_10000059
1287 Ga0307515_10001574
1288 Ga0307515_10002884
1289 Ga0265338_10000098
1290 Ga0265338_10000301
1291 Ga0265338_10078937
1292 Ga0265324_10000039
1293 Ga0265324_10009147
1294 Ga0307511_10000264
1295 Ga0265332_10024684
1296 Ga0265320_10000211
1297 Ga0265320_10002240
1298 Ga0265320_10003659
1299 Ga0265320_10004566
1300 Ga0265320_10010814
1301 Ga0265320_10017082
1302 Ga0265325_10001472
1303 Ga0265331_10013378
1304 Ga0265327_10000055
1305 Ga0265327_10000389
1306 Ga0265327_10003823
1307 Ga0265327_10006116
1308 Ga0265316_10000749
1309 Ga0265316_10047171
1310 Ga0307408_100001985
1311 Ga0265313_10000633
1312 Ga0265313_10001548
1313 Ga0265313_10004840
1314 Ga0265313_10005787
1315 Ga0265313_10013227
1316 Ga0265314_10000072
1317 Ga0265342_10020640
1318 Ga0307410_10003514
1319 Ga0307406_10000055
1320 Ga0307406_10006654
1321 Ga0307407_10000130
1322 Ga0307416_100003315
1323 Ga0307414_10000012
1324 Ga0307414_10050702
1325 Ga0307411_10000008
1326 Ga0307510_10000190
1327 Ga0307510_10022235
1328 Ga0373927_0103772
1329 Ga0395899_0000001
1330 Ga0395899_0000676
1331 Ga0395905_0000001
1332 Ga0395905_0008047
1333 Ga0436365_0473715
1334 Ga0436365_1374220
1335 Ga0439431_0000737
1336 Ga0466969_0020515
1337 Ga0466972_0000055
1338 Ga0466972_0000064
1339 Ga0466972_0006983
1340 Ga0466972_0053648
1341 Ga0466966_0000030
1342 Ga0466961_0044859
1343 Ga0453684_0007525
1344 Ga0453684_0242806
1345 Ga0466970_0004697
1346 Ga0466970_0007538
1347 Ga0466970_0031721
1348 Ga0466957_0004583
1349 Ga0466957_0005287
1350 Ga0466957_0010945
1351 Ga0466957_0027203
1352 Ga0466959_0000009
1353 Ga0466959_0002393
1354 Ga0495627_011886
1355 Ga0495638_0000006
1356 Ga0495650_0000127
1357 Ga0495585_0000088
1358 Ga0495585_0009559
1359 Ga0495606_0000033
1360 Ga0495606_0011985
1361 Ga0495606_0020200
1362 Ga0495606_0023809
1363 Ga0495606_0059733
1364 Ga0495606_0061665
1365 Ga0495610_0000350
1366 Ga0495610_0001633
1367 Ga0495631_0002396
1368 Ga0495632_0055057
1369 Ga0495643_0000357
1370 Ga0495643_0000542
1371 Ga0495643_0031212
1372 Ga0495663_0007878
1373 Ga0495609_0002951
1374 Ga0495609_0015316
1375 Ga0495633_0000067
1376 Ga0495633_0000869
1377 Ga0495633_0003779
1378 Ga0495668_0000069
1379 Ga0495668_0001902
1380 Ga0495611_0000046
1381 Ga0495611_0000106
1382 Ga0495625_0000048
1383 Ga0495625_0000419
1384 Ga0495625_0002288
1385 Ga0495625_0019975
1386 Ga0495661_0002260
1387 Ga0495661_0007898
1388 Ga0495661_0055728
1389 Ga0495649_0000146
1390 Ga0495660_0012841
1391 Ga0495683_0068468
1392 Ga0495687_000144
1393 Ga0495687_001622
1394 Ga0495686_0000040
1395 Ga0495686_0000041
1396 Ga0495686_0000058
1397 Ga0495686_0000454
1398 Ga0495686_0000938
1399 Ga0495686_0001041
1400 Ga0496101_0064240
1401 Ga0496114_0080679
1402 Ga0496115_0006177
1403 Ga0496116_0000004
1404 Ga0496116_0000047
1405 Ga0496116_0001943
1406 Ga0496117_0003199
1407 Ga0496121_0000007
1408 Ga0496121_0024856
1409 Ga0496121_0100184
1410 Ga0496122_0002274
1411 Ga0496122_0002475
1412 Ga0496123_0033280
1413 Ga0496124_0015640
1414 Ga0496125_0000012
1415 Ga0496125_0000050
1416 Ga0496125_0000483
1417 Ga0496126_0004174
1418 Ga0496126_0022098
1419 Ga0495678_003658
1420 Ga0501031_0029530
1421 Ga0501033_0058914
1422 Ga0501034_0036525
1423 Ga0501034_0041531
1424 Ga0501036_0072346
1425 Ga0501037_0008518
1426 Ga0501038_0010723
1427 Ga0501043_0081596
1428 Ga0501046_0082021
1429 Ga0501047_0075165
1430 Ga0501047_0186317
1431 Ga0501238_000216
1432 Ga0501247_000051
1433 Ga0501249_000027
1434 Ga0501219_000280
1435 Ga0501241_000127
1436 Ga0501241_001897
1437 Ga0501241_001963
1438 Ga0501241_003329
1439 Ga0501266_000004
1440 Ga0501280_000632
1441 Ga0501035_0186598
1442 Ga0501044_0080680
1443 Ga0501284_00002
1444 nmdc:mga0k408_497_c1
1445 nmdc:mga0k408_7085_c1
1446 nmdc:mga08y16_99331_c1
1447 Ga0500578_0000029
1448 Ga0500578_0021871
1449 Ga0500644_0000071
1450 Ga0500644_0000155
1451 Ga0500644_0001116
1452 Ga0500644_0001528
1453 Ga0500644_0006229
1454 Ga0500583_0000053
1455 Ga0500651_0011345
1456 Ga0500651_0049750
1457 Ga0500641_0000020
1458 Ga0500641_0000025
1459 Ga0500641_0000553
1460 Ga0500641_0001693
1461 Ga0500562_000029
1462 Ga0500569_012683
1463 Ga0500618_000073
1464 Ga0500618_006949
1465 Ga0500652_005048
1466 Ga0500652_014800
1467 Ga0500658_0000010
1468 Ga0500658_0000895
1469 Ga0500568_0046215
1470 Ga0500577_0001383
1471 Ga0500577_0001852
1472 Ga0500616_0000044
1473 Ga0500616_0031602
1474 Ga0500622_0000304
1475 Ga0500622_0000305
1476 Ga0500622_0001510
1477 Ga0500622_0003237
1478 Ga0500624_000231
1479 Ga0500633_0003732
1480 Ga0500633_0015264
1481 Ga0466962_0058894
1482 2513232265
1483 2520881906
1484 2599478882
1485 2644009813
1486 2644369742
1487 2644374230
1488 2644640559
1489 2644683704
1490 2722729286
1491 2738698586
1492 2738733205
1493 2738733289
1494 2738754220
1495 2738765743
1496 2738765827
1497 2739214786
1498 2739214870
1499 2739252912
1500 2740002472
1501 2740007288
1502 2740032287
1503 2802652409
1504 2817417410
1505 2819578119
1506 2819588678
1507 2819682133
1508 2821139235
1509 2840677970
1510 2857615883
1511 2857620372
1512 2881250788
1513 2881362653
1514 2883070862
1515 2884795105
1516 2896085787
1517 2896114037
1518 2898715959
1519 2903897856
1520 2904422078
1521 2904473200
1522 2904559086
1523 2904780961
1524 2911138966
1525 2919180575
1526 2919192114
1527 2919438673
1528 2919511724
1529 2919686032
1530 2928082892
1531 2928149910
1532 2929154674
1533 2929157637
1534 2929182520
1535 2929242294
1536 2929244161
1537 2929922266
1538 2929925867
1539 2932086213
1540 2945978445
1541 2946015691
1542 2958459085
1543 2958512674
1544 2965320533
1545 2965323318
1546 2977271507
1547 8003154777
1548 8054310538
1549 8055423034
1550 8055596614
1551 8056442064

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

65

460

0.87

PF00083

Sugar_tr

Sugar (and other) transporter

62

239

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.8566 1 514
7d5q-assembly2.cif.gz_B structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8463 19 509
7d5q-assembly1.cif.gz_A structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8434 19 509
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.8376 1 514
7d5q-assembly2.cif.gz_B structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8352 19 509
ID Description Score Start End Superfamily
af_P9WG85_29_254_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.962 21 248 1.20.1250.20
af_Q04301_34_211_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9543 18 194 1.20.1250.20
af_P36554_12_217_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9506 23 228 1.20.1250.20
af_P9WG87_21_208_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9505 23 211 1.20.1250.20
af_P9WG85_29_254_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9496 21 248 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2V7LDE2-F1-model_v4 Multidrug efflux MFS transporter 0.9782 15 175 GO:0005886
GO:0022857
AF-A0A3S1U0X0-F1-model_v4 MFS transporter 0.9632 26 162 GO:0005886
GO:0022857
AF-A0A422LRI7-F1-model_v4 4-hydroxybenzoate transporter PcaK 0.9539 34 124 GO:0005886
GO:0022857
AF-A0A3S1U0X0-F1-model_v4 MFS transporter 0.9431 26 162 GO:0005886
GO:0022857
AF-A0A425BL68-F1-model_v4 deleted 0.9418 13 124

Map