F480295
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 776 | 329 | 1551 | 506 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100005780|Ga0068855_10000578011 |
| Length | 569 |
| Sequence | LINNIPIGILSVQGLKSQIAARQKNNKTENDKLPSIAMNKNIPVGILYKQYVMSPLKKQLLIITVIAAAVMELIDTSIVNVALSHMSGNLGATLEDTSWVITSYAIANVIIIPITSFLVARLGRRNYYIGSIILFTLCSLMCGQAGNIWTLVAFRFLQGLGGGALLSVSQAVVFELFPKEKQGVASALFGIGVFTGPTIGXXLGGFITENYSWPWIFYINLPIGIAAAISCYLLLTEPPVKPAVPKVDWTGIALLSIGISTLQTVLERGETEDWFSTPYITWFTVIAIVSLTAFVIWELKIDHPVVNLRVLKSKTLSIAAILTFITGLGLFTSVFLTPVVAQRLLNFTPTQTGLLLLPGAILAIVGLIVSGKLLQNGVSPVIIVGSGFLLFIYFNWRMSQINFDTSSAEITFSLIFRALGIAFLTVPLTALAVSSLQPKDIPQGAALNNMMRQLGGSFGISIINTYTAHRIAVHRTDLISNITINNPLATERLNQYISYFQHIGFTWFNAHDRAVKLIETGVVRQSGMLSYIDAYLLIGLLFVLSLPLLLFVAKRNKDKKQAAVIVSDH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 16 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 17 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 67 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 68 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 69 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 97 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 100 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 104 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 105 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 152 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 153 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 154 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 157 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 158 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 159 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 160 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 161 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 162 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 163 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 166 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 169 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 170 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 171 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 172 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 173 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 174 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 176 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 177 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 178 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 179 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 180 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 181 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 182 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 183 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 184 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 185 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 186 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 187 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 188 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 189 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 190 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 191 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 192 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 193 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 194 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 195 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 196 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 219 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 220 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 221 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 222 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 223 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 224 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 225 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 226 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 227 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 228 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 239 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 240 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 241 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 242 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 243 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 244 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 245 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 248 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 249 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 251 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 252 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 253 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 254 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 255 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 256 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 257 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 258 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 259 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 260 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 261 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 262 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 263 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 264 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 265 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 266 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 267 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 268 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 269 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 270 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 271 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 272 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 273 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 274 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 275 | 2738541273 | Elizabethkingia sp. YR214 | Isolate | Unclassified |
| 276 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 277 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 278 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 279 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 280 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 281 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 282 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 283 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 284 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 285 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 286 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 287 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 288 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 289 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 290 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 291 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 292 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 293 | 2881247448 | Flavobacterium beibuense RSKm HC5 | Isolate | Rhizosphere |
| 294 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 295 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 296 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 297 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 298 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 299 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 300 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 301 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 302 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 303 | 2904555929 | Flavobacterium sp. 1750 | Isolate | Rhizosphere |
| 304 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 305 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 306 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 307 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 308 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 309 | 2919509842 | Flavobacterium arsenatis 3773 | Isolate | Unclassified |
| 310 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 311 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 312 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 313 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 314 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 315 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 316 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 317 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 318 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 319 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 320 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 321 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 322 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 323 | 2965320100 | Flavobacterium agri MAH-1 | Isolate | Rhizosphere |
| 324 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 325 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 326 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 327 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
| 328 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
| 329 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.98 |
| Metatranscriptomes | 0 |
| Isolates | 9.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.82 |
| Nodule | 0.77 |
| Rhizoplane | 0.52 |
| Rhizosphere | 73.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068855_100005780 | 3300005563 | Bacteria | 15095 |
| 2 | SwRhRL2b_contig_1102694 | 2162886007 | Bacteria | 4114 |
| 3 | SwRhRL2b_contig_2318651 | 2162886007 | Bacteria | 3080 |
| 4 | JGI24740J21852_10004527 | 3300001979 | Bacteria | 5981 |
| 5 | JGI24739J22299_10006887 | 3300001989 | Bacteria | 4282 |
| 6 | JGI24737J22298_10006986 | 3300001990 | Bacteria | 3827 |
| 7 | JGI24735J21928_10000016 | 3300002067 | Bacteria | 157028 |
| 8 | JGI25162J39368_1000005 | 3300002737 | Bacteria | 435925 |
| 9 | JGI25162J39368_1000161 | 3300002737 | Bacteria | 74216 |
| 10 | JGI25162J39368_1001763 | 3300002737 | Bacteria | 10299 |
| 11 | JGI25154J39366_1000003 | 3300002738 | Bacteria | 397627 |
| 12 | JGI25157J39369_1002538 | 3300002741 | Bacteria | 4414 |
| 13 | JGI25406J46586_10015793 | 3300003203 | Bacteria | 3171 |
| 14 | JGI25165J46597_1001210 | 3300003214 | Bacteria | 15558 |
| 15 | rootH1_10011283 | 3300003316 | Bacteria | 4874 |
| 16 | rootH1_10015988 | 3300003316 | Bacteria | 11335 |
| 17 | rootH1_10077136 | 3300003316 | Bacteria | 4980 |
| 18 | rootH1_10093429 | 3300003316 | Bacteria | 2689 |
| 19 | rootH1_10125406 | 3300003316 | Bacteria | 2690 |
| 20 | rootH1_10126974 | 3300003316 | Bacteria | 3186 |
| 21 | rootH1_10134713 | 3300003316 | Bacteria | 2299 |
| 22 | rootH2_10000040 | 3300003320 | Bacteria | 68084 |
| 23 | rootH2_10001435 | 3300003320 | Bacteria | 37408 |
| 24 | rootH2_10001661 | 3300003320 | Bacteria | 18662 |
| 25 | rootH2_10004220 | 3300003320 | Bacteria | 52880 |
| 26 | rootH2_10006439 | 3300003320 | Bacteria | 29214 |
| 27 | rootH2_10007549 | 3300003320 | Bacteria | 7795 |
| 28 | rootH2_10031165 | 3300003320 | Bacteria | 16235 |
| 29 | rootH2_10062478 | 3300003320 | Bacteria | 10722 |
| 30 | rootH2_10090169 | 3300003320 | Bacteria | 7657 |
| 31 | rootH2_10148453 | 3300003320 | Bacteria | 3594 |
| 32 | rootH2_10148753 | 3300003320 | Bacteria | 3635 |
| 33 | rootH2_10230939 | 3300003320 | Bacteria | 2789 |
| 34 | rootL2_10029829 | 3300003322 | Bacteria | 12343 |
| 35 | rootL2_10038171 | 3300003322 | Bacteria | 3575 |
| 36 | rootL2_10060051 | 3300003322 | Bacteria | 3395 |
| 37 | rootL2_10089683 | 3300003322 | Bacteria | 13947 |
| 38 | rootL2_10089752 | 3300003322 | Unclassified | 2271 |
| 39 | rootL2_10224022 | 3300003322 | Bacteria | 3353 |
| 40 | rootL2_10239643 | 3300003322 | Bacteria | 2988 |
| 41 | rootL2_10256246 | 3300003322 | Bacteria | 2908 |
| 42 | rootL2_10288882 | 3300003322 | Bacteria | 2789 |
| 43 | rootH1_10007228 | 3300003316 | Bacteria | 1529 |
| 44 | rootH1_10007228 | 3300003323 | Bacteria | 16763 |
| 45 | rootH1_10009967 | 3300003323 | Bacteria | 20514 |
| 46 | rootH1_10037477 | 3300003323 | Bacteria | 9657 |
| 47 | rootH1_10047628 | 3300003323 | Bacteria | 5181 |
| 48 | rootH1_10060901 | 3300003323 | Bacteria | 7978 |
| 49 | rootH1_10061241 | 3300003323 | Bacteria | 15628 |
| 50 | rootH1_10063750 | 3300003323 | Bacteria | 6782 |
| 51 | rootH1_10063751 | 3300003323 | Bacteria | 4684 |
| 52 | rootH1_10084076 | 3300003323 | Bacteria | 2837 |
| 53 | rootH1_10132616 | 3300003323 | Bacteria | 3907 |
| 54 | rootH1_10156159 | 3300003323 | Bacteria | 10208 |
| 55 | JGI25160J50197_1000733 | 3300003354 | Bacteria | 17961 |
| 56 | JGI25160J50197_1007002 | 3300003354 | Bacteria | 4470 |
| 57 | Ga0055535_1002136 | 3300003761 | Bacteria | 7733 |
| 58 | Ga0055535_1002452 | 3300003761 | Bacteria | 6468 |
| 59 | Ga0055542_1004230 | 3300003762 | Bacteria | 3559 |
| 60 | Ga0055526_1004431 | 3300003771 | Bacteria | 8439 |
| 61 | Ga0055526_1020551 | 3300003771 | Bacteria | 2342 |
| 62 | Ga0055528_1000180 | 3300003790 | Bacteria | 53597 |
| 63 | Ga0055530_10002883 | 3300003791 | Bacteria | 10469 |
| 64 | Ga0055531_10000036 | 3300003794 | Bacteria | 147042 |
| 65 | Ga0055531_10000159 | 3300003794 | Bacteria | 77708 |
| 66 | Ga0055531_10000295 | 3300003794 | Bacteria | 49801 |
| 67 | Ga0065165_1000019 | 3300005262 | Bacteria | 271815 |
| 68 | Ga0065165_1016930 | 3300005262 | Unclassified | 2707 |
| 69 | Ga0065714_10009084 | 3300005288 | Bacteria | 3261 |
| 70 | Ga0065714_10076766 | 3300005288 | Bacteria | 2753 |
| 71 | Ga0065714_10078013 | 3300005288 | Bacteria | 2638 |
| 72 | Ga0065704_10003041 | 3300005289 | Bacteria | 4883 |
| 73 | Ga0065704_10074482 | 3300005289 | Bacteria | 6246 |
| 74 | Ga0065704_10074814 | 3300005289 | Bacteria | 5991 |
| 75 | Ga0065715_10159268 | 3300005293 | Bacteria | 1645 |
| 76 | Ga0070658_10106933 | 3300005327 | Bacteria | 2315 |
| 77 | Ga0070658_10178492 | 3300005327 | Bacteria | 1787 |
| 78 | Ga0070690_100009074 | 3300005330 | Bacteria | 5752 |
| 79 | Ga0070670_100014386 | 3300005331 | Bacteria | 6789 |
| 80 | Ga0070670_100029150 | 3300005331 | Bacteria | 4749 |
| 81 | Ga0068869_100071896 | 3300005334 | Bacteria | 2562 |
| 82 | Ga0070666_10003725 | 3300005335 | Bacteria | 9238 |
| 83 | Ga0070666_10032465 | 3300005335 | Bacteria | 3449 |
| 84 | Ga0070666_10053423 | 3300005335 | Bacteria | 2725 |
| 85 | Ga0070680_100079619 | 3300005336 | Bacteria | 2701 |
| 86 | Ga0068868_100015367 | 3300005338 | Bacteria | 5660 |
| 87 | Ga0070660_100005439 | 3300005339 | Bacteria | 8821 |
| 88 | Ga0070691_10025737 | 3300005341 | Bacteria | 2741 |
| 89 | Ga0070671_100066512 | 3300005355 | Bacteria | 3004 |
| 90 | Ga0070671_100087866 | 3300005355 | Unclassified | 2601 |
| 91 | Ga0070673_100002752 | 3300005364 | Bacteria | 10800 |
| 92 | Ga0070673_100015275 | 3300005364 | Bacteria | 5387 |
| 93 | Ga0070673_100061200 | 3300005364 | Bacteria | 2986 |
| 94 | Ga0070659_100001172 | 3300005366 | Bacteria | 19121 |
| 95 | Ga0070659_100007089 | 3300005366 | Bacteria | 8128 |
| 96 | Ga0070659_100007440 | 3300005366 | Bacteria | 7957 |
| 97 | Ga0070659_100064498 | 3300005366 | Bacteria | 2899 |
| 98 | Ga0070667_100080049 | 3300005367 | Bacteria | 2794 |
| 99 | Ga0070714_100000081 | 3300005435 | Bacteria | 82594 |
| 100 | Ga0070663_100061520 | 3300005455 | Bacteria | 2704 |
| 101 | Ga0070678_100029318 | 3300005456 | Unclassified | 3766 |
| 102 | Ga0070678_100069249 | 3300005456 | Bacteria | 2634 |
| 103 | Ga0070662_100002133 | 3300005457 | Bacteria | 12133 |
| 104 | Ga0070662_100003532 | 3300005457 | Bacteria | 9748 |
| 105 | Ga0070681_10093730 | 3300005458 | Bacteria | 2952 |
| 106 | Ga0068867_100000655 | 3300005459 | Bacteria | 22898 |
| 107 | Ga0068867_100030334 | 3300005459 | Unclassified | 3901 |
| 108 | Ga0068867_100082355 | 3300005459 | Unclassified | 2427 |
| 109 | Ga0070684_100008572 | 3300005535 | Bacteria | 8005 |
| 110 | Ga0068853_100000453 | 3300005539 | Bacteria | 27924 |
| 111 | Ga0068853_100012007 | 3300005539 | Bacteria | 7045 |
| 112 | Ga0068853_100020139 | 3300005539 | Bacteria | 5545 |
| 113 | Ga0068853_100030162 | 3300005539 | Bacteria | 4579 |
| 114 | Ga0068853_100060395 | 3300005539 | Bacteria | 3275 |
| 115 | Ga0068853_100126390 | 3300005539 | Bacteria | 2284 |
| 116 | Ga0068853_100166494 | 3300005539 | Bacteria | 1992 |
| 117 | Ga0070672_100022895 | 3300005543 | Unclassified | 4597 |
| 118 | Ga0070693_100042394 | 3300005547 | Bacteria | 2564 |
| 119 | Ga0070665_100000041 | 3300005548 | Bacteria | 297849 |
| 120 | Ga0070665_100000147 | 3300005548 | Bacteria | 129683 |
| 121 | Ga0068855_100001107 | 3300005563 | Bacteria | 33518 |
| 122 | Ga0068855_100011903 | 3300005563 | Bacteria | 10518 |
| 123 | Ga0068855_100012759 | 3300005563 | Bacteria | 10133 |
| 124 | Ga0068855_100013183 | 3300005563 | Bacteria | 9972 |
| 125 | Ga0068855_100032981 | 3300005563 | Bacteria | 6182 |
| 126 | Ga0068855_100050422 | 3300005563 | Bacteria | 4905 |
| 127 | Ga0068855_100055421 | 3300005563 | Bacteria | 4657 |
| 128 | Ga0068855_100066262 | 3300005563 | Bacteria | 4211 |
| 129 | Ga0068855_100140471 | 3300005563 | Bacteria | 2754 |
| 130 | Ga0070664_100016255 | 3300005564 | Bacteria | 6100 |
| 131 | Ga0070664_100028760 | 3300005564 | Bacteria | 4627 |
| 132 | Ga0068857_100023248 | 3300005577 | Bacteria | 5455 |
| 133 | Ga0068857_100060637 | 3300005577 | Bacteria | 3360 |
| 134 | Ga0068854_100027069 | 3300005578 | Bacteria | 3948 |
| 135 | Ga0068856_100009075 | 3300005614 | Bacteria | 9675 |
| 136 | Ga0068856_100037750 | 3300005614 | Bacteria | 4740 |
| 137 | Ga0068856_100049900 | 3300005614 | Bacteria | 4125 |
| 138 | Ga0068856_100139633 | 3300005614 | Bacteria | 2430 |
| 139 | Ga0068856_100142068 | 3300005614 | Unclassified | 2408 |
| 140 | Ga0068852_100000913 | 3300005616 | Bacteria | 19584 |
| 141 | Ga0068852_100003549 | 3300005616 | Bacteria | 10913 |
| 142 | Ga0068852_100007002 | 3300005616 | Bacteria | 8207 |
| 143 | Ga0068852_100009586 | 3300005616 | Bacteria | 7195 |
| 144 | Ga0068852_100027556 | 3300005616 | Bacteria | 4631 |
| 145 | Ga0068859_100000024 | 3300005617 | Bacteria | 217931 |
| 146 | Ga0068864_100024355 | 3300005618 | Bacteria | 5091 |
| 147 | Ga0068851_10024733 | 3300005834 | Unclassified | 2941 |
| 148 | Ga0068851_10062686 | 3300005834 | Bacteria | 1908 |
| 149 | Ga0068863_100024717 | 3300005841 | Bacteria | 5729 |
| 150 | Ga0068863_100099530 | 3300005841 | Bacteria | 2762 |
| 151 | Ga0068858_100047842 | 3300005842 | Bacteria | 3964 |
| 152 | Ga0068858_100057241 | 3300005842 | Bacteria | 3603 |
| 153 | Ga0068858_100098361 | 3300005842 | Unclassified | 2728 |
| 154 | Ga0068860_100000041 | 3300005843 | Bacteria | 227790 |
| 155 | Ga0068860_100000052 | 3300005843 | Bacteria | 207351 |
| 156 | Ga0068860_100000491 | 3300005843 | Bacteria | 48922 |
| 157 | Ga0068860_100004518 | 3300005843 | Bacteria | 14199 |
| 158 | Ga0068860_100006462 | 3300005843 | Bacteria | 11770 |
| 159 | Ga0068860_100007089 | 3300005843 | Bacteria | 11212 |
| 160 | Ga0068860_100008185 | 3300005843 | Bacteria | 10410 |
| 161 | Ga0068860_100018183 | 3300005843 | Bacteria | 6841 |
| 162 | Ga0097621_100000109 | 3300006237 | Bacteria | 46477 |
| 163 | Ga0097621_100000551 | 3300006237 | Bacteria | 26354 |
| 164 | Ga0097621_100027330 | 3300006237 | Bacteria | 4485 |
| 165 | Ga0097621_100057280 | 3300006237 | Bacteria | 3186 |
| 166 | Ga0068871_100000044 | 3300006358 | Bacteria | 67105 |
| 167 | Ga0068871_100000072 | 3300006358 | Bacteria | 56289 |
| 168 | Ga0068871_100036139 | 3300006358 | Unclassified | 3931 |
| 169 | Ga0068865_100000309 | 3300006881 | Bacteria | 26968 |
| 170 | Ga0097620_100000024 | 3300006931 | Bacteria | 217931 |
| 171 | Ga0099824_1006574 | 3300006942 | Bacteria | 15878 |
| 172 | Ga0079104_1000178 | 3300006946 | Bacteria | 90393 |
| 173 | Ga0099826_10000598 | 3300006948 | Bacteria | 18315 |
| 174 | Ga0105244_10000002 | 3300009036 | Bacteria | 495554 |
| 175 | Ga0105244_10000095 | 3300009036 | Bacteria | 93295 |
| 176 | Ga0105240_10000059 | 3300009093 | Bacteria | 219860 |
| 177 | Ga0105240_10000100 | 3300009093 | Bacteria | 176640 |
| 178 | Ga0105240_10000126 | 3300009093 | Bacteria | 157403 |
| 179 | Ga0105240_10000547 | 3300009093 | Bacteria | 69491 |
| 180 | Ga0105240_10000908 | 3300009093 | Bacteria | 52921 |
| 181 | Ga0105240_10000998 | 3300009093 | Bacteria | 50528 |
| 182 | Ga0105240_10001161 | 3300009093 | Bacteria | 46154 |
| 183 | Ga0105240_10003553 | 3300009093 | Bacteria | 24191 |
| 184 | Ga0105240_10006635 | 3300009093 | Bacteria | 16984 |
| 185 | Ga0105240_10008415 | 3300009093 | Bacteria | 14761 |
| 186 | Ga0105240_10012634 | 3300009093 | Bacteria | 11643 |
| 187 | Ga0105240_10018443 | 3300009093 | Bacteria | 9369 |
| 188 | Ga0105240_10022605 | 3300009093 | Bacteria | 8329 |
| 189 | Ga0105240_10028461 | 3300009093 | Bacteria | 7299 |
| 190 | Ga0105240_10045197 | 3300009093 | Bacteria | 5589 |
| 191 | Ga0105240_10051777 | 3300009093 | Bacteria | 5165 |
| 192 | Ga0105240_10075311 | 3300009093 | Bacteria | 4163 |
| 193 | Ga0105240_10107311 | 3300009093 | Unclassified | 3386 |
| 194 | Ga0105240_10296497 | 3300009093 | Bacteria | 1851 |
| 195 | Ga0111539_10007347 | 3300009094 | Bacteria | 14110 |
| 196 | Ga0105245_10033730 | 3300009098 | Bacteria | 4537 |
| 197 | Ga0105245_10066035 | 3300009098 | Bacteria | 3273 |
| 198 | Ga0105247_10004768 | 3300009101 | Bacteria | 8635 |
| 199 | Ga0105243_10000012 | 3300009148 | Bacteria | 300885 |
| 200 | Ga0105241_10000781 | 3300009174 | Bacteria | 24157 |
| 201 | Ga0105241_10003048 | 3300009174 | Bacteria | 12499 |
| 202 | Ga0105241_10005689 | 3300009174 | Bacteria | 9199 |
| 203 | Ga0105241_10008207 | 3300009174 | Bacteria | 7688 |
| 204 | Ga0105241_10020249 | 3300009174 | Bacteria | 4913 |
| 205 | Ga0105242_10002511 | 3300009176 | Bacteria | 14394 |
| 206 | Ga0105248_10094699 | 3300009177 | Bacteria | 3363 |
| 207 | Ga0105237_10000107 | 3300009545 | Bacteria | 117149 |
| 208 | Ga0105237_10000233 | 3300009545 | Bacteria | 79346 |
| 209 | Ga0105237_10001116 | 3300009545 | Bacteria | 35964 |
| 210 | Ga0105237_10002292 | 3300009545 | Bacteria | 23786 |
| 211 | Ga0105237_10002431 | 3300009545 | Bacteria | 23124 |
| 212 | Ga0105237_10002590 | 3300009545 | Bacteria | 22311 |
| 213 | Ga0105237_10003316 | 3300009545 | Bacteria | 19172 |
| 214 | Ga0105237_10003500 | 3300009545 | Bacteria | 18633 |
| 215 | Ga0105237_10004181 | 3300009545 | Bacteria | 16811 |
| 216 | Ga0105237_10004749 | 3300009545 | Bacteria | 15626 |
| 217 | Ga0105237_10005449 | 3300009545 | Bacteria | 14351 |
| 218 | Ga0105237_10006746 | 3300009545 | Bacteria | 12676 |
| 219 | Ga0105237_10010582 | 3300009545 | Bacteria | 9799 |
| 220 | Ga0105237_10011700 | 3300009545 | Bacteria | 9281 |
| 221 | Ga0105237_10012117 | 3300009545 | Bacteria | 9101 |
| 222 | Ga0105237_10016706 | 3300009545 | Bacteria | 7619 |
| 223 | Ga0105237_10016806 | 3300009545 | Bacteria | 7595 |
| 224 | Ga0105237_10019148 | 3300009545 | Bacteria | 7074 |
| 225 | Ga0105237_10019660 | 3300009545 | Bacteria | 6973 |
| 226 | Ga0105237_10022352 | 3300009545 | Bacteria | 6491 |
| 227 | Ga0105237_10056820 | 3300009545 | Bacteria | 3916 |
| 228 | Ga0105237_10149897 | 3300009545 | Unclassified | 2328 |
| 229 | Ga0105237_10171829 | 3300009545 | Bacteria | 2167 |
| 230 | Ga0105237_10236859 | 3300009545 | Bacteria | 1826 |
| 231 | Ga0105238_10006406 | 3300009551 | Bacteria | 11710 |
| 232 | Ga0105238_10013083 | 3300009551 | Bacteria | 8371 |
| 233 | Ga0105238_10015542 | 3300009551 | Bacteria | 7706 |
| 234 | Ga0105238_10055361 | 3300009551 | Bacteria | 3982 |
| 235 | Ga0105238_10321234 | 3300009551 | Bacteria | 1534 |
| 236 | Ga0105249_10021834 | 3300009553 | Bacteria | 5732 |
| 237 | Ga0105249_10092691 | 3300009553 | Bacteria | 2828 |
| 238 | Ga0105239_10000006 | 3300010375 | Bacteria | 442319 |
| 239 | Ga0105239_10000011 | 3300010375 | Bacteria | 337500 |
| 240 | Ga0105239_10000038 | 3300010375 | Bacteria | 205230 |
| 241 | Ga0105239_10000071 | 3300010375 | Bacteria | 143060 |
| 242 | Ga0105239_10000087 | 3300010375 | Bacteria | 129698 |
| 243 | Ga0105239_10000089 | 3300010375 | Bacteria | 129415 |
| 244 | Ga0105239_10000137 | 3300010375 | Bacteria | 102833 |
| 245 | Ga0105239_10001021 | 3300010375 | Bacteria | 39112 |
| 246 | Ga0105239_10001053 | 3300010375 | Bacteria | 38389 |
| 247 | Ga0105239_10001274 | 3300010375 | Bacteria | 34004 |
| 248 | Ga0105239_10001754 | 3300010375 | Bacteria | 28593 |
| 249 | Ga0105239_10001888 | 3300010375 | Bacteria | 27395 |
| 250 | Ga0105239_10002186 | 3300010375 | Bacteria | 25152 |
| 251 | Ga0105239_10003136 | 3300010375 | Bacteria | 20512 |
| 252 | Ga0105239_10003355 | 3300010375 | Bacteria | 19676 |
| 253 | Ga0105239_10004088 | 3300010375 | Bacteria | 17547 |
| 254 | Ga0105239_10005398 | 3300010375 | Bacteria | 15006 |
| 255 | Ga0105239_10005536 | 3300010375 | Bacteria | 14786 |
| 256 | Ga0105239_10012678 | 3300010375 | Bacteria | 9379 |
| 257 | Ga0105239_10025334 | 3300010375 | Bacteria | 6530 |
| 258 | Ga0105239_10029434 | 3300010375 | Bacteria | 6037 |
| 259 | Ga0105239_10050644 | 3300010375 | Bacteria | 4554 |
| 260 | Ga0105239_10057643 | 3300010375 | Bacteria | 4261 |
| 261 | Ga0105239_10073420 | 3300010375 | Bacteria | 3761 |
| 262 | Ga0105239_10244306 | 3300010375 | Bacteria | 2015 |
| 263 | Ga0157373_10000001 | 3300013100 | Bacteria | 864756 |
| 264 | Ga0157373_10000161 | 3300013100 | Bacteria | 54194 |
| 265 | Ga0157373_10006672 | 3300013100 | Bacteria | 8601 |
| 266 | Ga0157373_10007265 | 3300013100 | Bacteria | 8255 |
| 267 | Ga0157371_10000363 | 3300013102 | Bacteria | 57446 |
| 268 | Ga0157371_10001099 | 3300013102 | Bacteria | 29340 |
| 269 | Ga0157371_10003809 | 3300013102 | Bacteria | 13493 |
| 270 | Ga0157370_10000261 | 3300013104 | Bacteria | 66927 |
| 271 | Ga0157370_10000381 | 3300013104 | Bacteria | 55829 |
| 272 | Ga0157370_10000393 | 3300013104 | Bacteria | 54961 |
| 273 | Ga0157370_10000464 | 3300013104 | Bacteria | 50658 |
| 274 | Ga0157370_10000620 | 3300013104 | Bacteria | 44173 |
| 275 | Ga0157370_10003580 | 3300013104 | Bacteria | 18172 |
| 276 | Ga0157370_10005927 | 3300013104 | Bacteria | 13618 |
| 277 | Ga0157370_10025272 | 3300013104 | Bacteria | 5879 |
| 278 | Ga0157369_10001144 | 3300013105 | Bacteria | 33073 |
| 279 | Ga0157369_10010399 | 3300013105 | Bacteria | 10605 |
| 280 | Ga0157369_10011175 | 3300013105 | Bacteria | 10204 |
| 281 | Ga0157369_10012719 | 3300013105 | Bacteria | 9544 |
| 282 | Ga0157369_10024069 | 3300013105 | Bacteria | 6776 |
| 283 | Ga0157369_10067899 | 3300013105 | Bacteria | 3831 |
| 284 | Ga0157369_10190979 | 3300013105 | Bacteria | 2152 |
| 285 | Ga0157374_10006987 | 3300013296 | Bacteria | 9608 |
| 286 | Ga0157374_10009510 | 3300013296 | Bacteria | 8348 |
| 287 | Ga0157374_10013535 | 3300013296 | Bacteria | 7122 |
| 288 | Ga0157374_10034391 | 3300013296 | Bacteria | 4628 |
| 289 | Ga0157374_10183848 | 3300013296 | Unclassified | 2043 |
| 290 | Ga0157378_10001706 | 3300013297 | Bacteria | 19763 |
| 291 | Ga0157378_10003365 | 3300013297 | Bacteria | 14220 |
| 292 | Ga0157378_10005761 | 3300013297 | Bacteria | 10851 |
| 293 | Ga0157378_10007635 | 3300013297 | Bacteria | 9439 |
| 294 | Ga0157378_10013940 | 3300013297 | Bacteria | 7032 |
| 295 | Ga0157378_10059904 | 3300013297 | Bacteria | 3397 |
| 296 | Ga0157378_10076737 | 3300013297 | Unclassified | 3011 |
| 297 | Ga0157378_10093338 | 3300013297 | Bacteria | 2739 |
| 298 | Ga0163162_10000088 | 3300013306 | Bacteria | 85462 |
| 299 | Ga0163162_10000154 | 3300013306 | Bacteria | 63581 |
| 300 | Ga0163162_10000189 | 3300013306 | Bacteria | 56954 |
| 301 | Ga0163162_10000446 | 3300013306 | Bacteria | 38191 |
| 302 | Ga0163162_10000989 | 3300013306 | Bacteria | 26455 |
| 303 | Ga0163162_10001715 | 3300013306 | Bacteria | 20533 |
| 304 | Ga0163162_10010159 | 3300013306 | Bacteria | 9145 |
| 305 | Ga0163162_10012102 | 3300013306 | Bacteria | 8418 |
| 306 | Ga0157372_10000001 | 3300013307 | Bacteria | 791349 |
| 307 | Ga0157372_10000894 | 3300013307 | Bacteria | 32388 |
| 308 | Ga0157372_10001149 | 3300013307 | Bacteria | 28728 |
| 309 | Ga0157372_10003311 | 3300013307 | Bacteria | 17404 |
| 310 | Ga0157372_10003461 | 3300013307 | Bacteria | 17033 |
| 311 | Ga0157372_10005758 | 3300013307 | Bacteria | 13205 |
| 312 | Ga0157372_10019705 | 3300013307 | Bacteria | 7271 |
| 313 | Ga0157372_10058939 | 3300013307 | Bacteria | 4293 |
| 314 | Ga0157372_10081162 | 3300013307 | Bacteria | 3670 |
| 315 | Ga0157372_10085157 | 3300013307 | Bacteria | 3584 |
| 316 | Ga0157372_10203173 | 3300013307 | Bacteria | 2295 |
| 317 | Ga0157375_10000212 | 3300013308 | Bacteria | 54441 |
| 318 | Ga0157375_10013643 | 3300013308 | Bacteria | 7242 |
| 319 | Ga0157375_10078808 | 3300013308 | Bacteria | 3329 |
| 320 | Ga0157375_10264594 | 3300013308 | Bacteria | 1881 |
| 321 | Ga0157375_10280974 | 3300013308 | Bacteria | 1828 |
| 322 | Ga0163163_10000401 | 3300014325 | Bacteria | 40925 |
| 323 | Ga0163163_10072488 | 3300014325 | Unclassified | 3433 |
| 324 | Ga0163163_10125353 | 3300014325 | Bacteria | 2606 |
| 325 | Ga0182008_10000100 | 3300014497 | Bacteria | 66862 |
| 326 | Ga0157377_10021023 | 3300014745 | Bacteria | 3427 |
| 327 | Ga0157379_10006200 | 3300014968 | Bacteria | 10298 |
| 328 | Ga0157379_10019403 | 3300014968 | Bacteria | 6004 |
| 329 | Ga0157379_10050872 | 3300014968 | Bacteria | 3699 |
| 330 | Ga0157376_10001721 | 3300014969 | Bacteria | 14551 |
| 331 | Ga0157376_10013206 | 3300014969 | Bacteria | 6155 |
| 332 | Ga0182006_1001422 | 3300015261 | Bacteria | 14483 |
| 333 | Ga0182005_1000458 | 3300015265 | Bacteria | 21410 |
| 334 | Ga0163161_10000015 | 3300017792 | Bacteria | 250785 |
| 335 | Ga0163161_10000016 | 3300017792 | Bacteria | 235591 |
| 336 | Ga0163161_10000129 | 3300017792 | Bacteria | 70623 |
| 337 | Ga0163161_10001424 | 3300017792 | Bacteria | 17655 |
| 338 | Ga0163161_10005198 | 3300017792 | Bacteria | 9053 |
| 339 | Ga0163161_10005491 | 3300017792 | Bacteria | 8792 |
| 340 | Ga0163161_10053124 | 3300017792 | Bacteria | 2938 |
| 341 | Ga0213876_10001314 | 3300021384 | Bacteria | 15620 |
| 342 | Ga0207427_100323 | 3300025231 | Bacteria | 32232 |
| 343 | Ga0209437_100030 | 3300025233 | Bacteria | 532466 |
| 344 | Ga0209437_100043 | 3300025233 | Bacteria | 440454 |
| 345 | Ga0209437_100077 | 3300025233 | Bacteria | 286656 |
| 346 | Ga0209437_100093 | 3300025233 | Bacteria | 239733 |
| 347 | Ga0209258_100029 | 3300025242 | Bacteria | 490648 |
| 348 | Ga0209258_100036 | 3300025242 | Bacteria | 428859 |
| 349 | Ga0209646_1000004 | 3300025246 | Bacteria | 786587 |
| 350 | Ga0209646_1001113 | 3300025246 | Bacteria | 7929 |
| 351 | Ga0209026_1000132 | 3300025250 | Bacteria | 119048 |
| 352 | Ga0209026_1002237 | 3300025250 | Bacteria | 7445 |
| 353 | Ga0209148_1000089 | 3300025254 | Bacteria | 253548 |
| 354 | Ga0209148_1000139 | 3300025254 | Bacteria | 167011 |
| 355 | Ga0209233_1000486 | 3300025261 | Bacteria | 24139 |
| 356 | Ga0209233_1001892 | 3300025261 | Bacteria | 8030 |
| 357 | Ga0209673_1000042 | 3300025273 | Bacteria | 300704 |
| 358 | Ga0209564_1000840 | 3300025295 | Bacteria | 41373 |
| 359 | Ga0209564_1004230 | 3300025295 | Bacteria | 8928 |
| 360 | Ga0209758_1001003 | 3300025297 | Bacteria | 37543 |
| 361 | Ga0209758_1003437 | 3300025297 | Bacteria | 14408 |
| 362 | Ga0209758_1026375 | 3300025297 | Bacteria | 2516 |
| 363 | Ga0209050_1000308 | 3300025298 | Bacteria | 99516 |
| 364 | Ga0209050_1001642 | 3300025298 | Bacteria | 22859 |
| 365 | Ga0207426_1000170 | 3300025302 | Bacteria | 164216 |
| 366 | Ga0207426_1000192 | 3300025302 | Bacteria | 151680 |
| 367 | Ga0207426_1000310 | 3300025302 | Bacteria | 96036 |
| 368 | Ga0207426_1000316 | 3300025302 | Bacteria | 94148 |
| 369 | Ga0207426_1006631 | 3300025302 | Bacteria | 4982 |
| 370 | Ga0207426_1013256 | 3300025302 | Bacteria | 3061 |
| 371 | Ga0209051_1036254 | 3300025303 | Bacteria | 1824 |
| 372 | Ga0209257_1000006 | 3300025304 | Bacteria | 1570111 |
| 373 | Ga0209257_1000008 | 3300025304 | Bacteria | 1294570 |
| 374 | Ga0209257_1000077 | 3300025304 | Bacteria | 317964 |
| 375 | Ga0209257_1001059 | 3300025304 | Bacteria | 36382 |
| 376 | Ga0207656_10004894 | 3300025321 | Bacteria | 4701 |
| 377 | Ga0207655_1000012 | 3300025728 | Bacteria | 640488 |
| 378 | Ga0207680_10000455 | 3300025903 | Bacteria | 19322 |
| 379 | Ga0207680_10099756 | 3300025903 | Bacteria | 1864 |
| 380 | Ga0207647_10000082 | 3300025904 | Bacteria | 71437 |
| 381 | Ga0207647_10000258 | 3300025904 | Bacteria | 43440 |
| 382 | Ga0207647_10003046 | 3300025904 | Bacteria | 12596 |
| 383 | Ga0207647_10025668 | 3300025904 | Bacteria | 3867 |
| 384 | Ga0207645_10001313 | 3300025907 | Bacteria | 20428 |
| 385 | Ga0207645_10004307 | 3300025907 | Bacteria | 10558 |
| 386 | Ga0207705_10058257 | 3300025909 | Bacteria | 2787 |
| 387 | Ga0207705_10089064 | 3300025909 | Bacteria | 2258 |
| 388 | Ga0207654_10000944 | 3300025911 | Bacteria | 15963 |
| 389 | Ga0207654_10060572 | 3300025911 | Bacteria | 2211 |
| 390 | Ga0207654_10064360 | 3300025911 | Unclassified | 2156 |
| 391 | Ga0207695_10000013 | 3300025913 | Bacteria | 821265 |
| 392 | Ga0207695_10000027 | 3300025913 | Bacteria | 612456 |
| 393 | Ga0207695_10000039 | 3300025913 | Bacteria | 454801 |
| 394 | Ga0207695_10000067 | 3300025913 | Bacteria | 330915 |
| 395 | Ga0207695_10000462 | 3300025913 | Bacteria | 88318 |
| 396 | Ga0207695_10000636 | 3300025913 | Bacteria | 70234 |
| 397 | Ga0207695_10001344 | 3300025913 | Bacteria | 41706 |
| 398 | Ga0207695_10007657 | 3300025913 | Bacteria | 13682 |
| 399 | Ga0207695_10010350 | 3300025913 | Bacteria | 11416 |
| 400 | Ga0207695_10015824 | 3300025913 | Bacteria | 8860 |
| 401 | Ga0207695_10019331 | 3300025913 | Bacteria | 7844 |
| 402 | Ga0207695_10045756 | 3300025913 | Bacteria | 4643 |
| 403 | Ga0207695_10055876 | 3300025913 | Bacteria | 4111 |
| 404 | Ga0207695_10056712 | 3300025913 | Bacteria | 4075 |
| 405 | Ga0207695_10124522 | 3300025913 | Bacteria | 2541 |
| 406 | Ga0207671_10000904 | 3300025914 | Bacteria | 37479 |
| 407 | Ga0207671_10001299 | 3300025914 | Bacteria | 29321 |
| 408 | Ga0207671_10002877 | 3300025914 | Bacteria | 17823 |
| 409 | Ga0207671_10003140 | 3300025914 | Bacteria | 16767 |
| 410 | Ga0207671_10003329 | 3300025914 | Bacteria | 16151 |
| 411 | Ga0207671_10003615 | 3300025914 | Bacteria | 15272 |
| 412 | Ga0207671_10003994 | 3300025914 | Bacteria | 14339 |
| 413 | Ga0207671_10008032 | 3300025914 | Bacteria | 9022 |
| 414 | Ga0207671_10008692 | 3300025914 | Bacteria | 8571 |
| 415 | Ga0207671_10010120 | 3300025914 | Bacteria | 7816 |
| 416 | Ga0207671_10012711 | 3300025914 | Bacteria | 6752 |
| 417 | Ga0207671_10013534 | 3300025914 | Bacteria | 6497 |
| 418 | Ga0207671_10019677 | 3300025914 | Bacteria | 5156 |
| 419 | Ga0207671_10019941 | 3300025914 | Bacteria | 5115 |
| 420 | Ga0207671_10105088 | 3300025914 | Unclassified | 2142 |
| 421 | Ga0207660_10055191 | 3300025917 | Bacteria | 2838 |
| 422 | Ga0207657_10013025 | 3300025919 | Bacteria | 8171 |
| 423 | Ga0207652_10015401 | 3300025921 | Bacteria | 6211 |
| 424 | Ga0207694_10021422 | 3300025924 | Bacteria | 4898 |
| 425 | Ga0207694_10117866 | 3300025924 | Bacteria | 2117 |
| 426 | Ga0207650_10091479 | 3300025925 | Bacteria | 2325 |
| 427 | Ga0207664_10000042 | 3300025929 | Bacteria | 154793 |
| 428 | Ga0207644_10049573 | 3300025931 | Bacteria | 3007 |
| 429 | Ga0207690_10027064 | 3300025932 | Unclassified | 3621 |
| 430 | Ga0207690_10030606 | 3300025932 | Bacteria | 3435 |
| 431 | Ga0207690_10078667 | 3300025932 | Bacteria | 2296 |
| 432 | Ga0207706_10001583 | 3300025933 | Bacteria | 22590 |
| 433 | Ga0207706_10007140 | 3300025933 | Bacteria | 10333 |
| 434 | Ga0207686_10101551 | 3300025934 | Bacteria | 1922 |
| 435 | Ga0207709_10000006 | 3300025935 | Bacteria | 800946 |
| 436 | Ga0207704_10000220 | 3300025938 | Bacteria | 28668 |
| 437 | Ga0207691_10003968 | 3300025940 | Bacteria | 14366 |
| 438 | Ga0207691_10042786 | 3300025940 | Bacteria | 4174 |
| 439 | Ga0207691_10053050 | 3300025940 | Bacteria | 3703 |
| 440 | Ga0207689_10001522 | 3300025942 | Bacteria | 22065 |
| 441 | Ga0207661_10042475 | 3300025944 | Bacteria | 3584 |
| 442 | Ga0207679_10017412 | 3300025945 | Bacteria | 4794 |
| 443 | Ga0207679_10102303 | 3300025945 | Unclassified | 2243 |
| 444 | Ga0207667_10002393 | 3300025949 | Bacteria | 23487 |
| 445 | Ga0207667_10003062 | 3300025949 | Bacteria | 20722 |
| 446 | Ga0207667_10018573 | 3300025949 | Bacteria | 7793 |
| 447 | Ga0207667_10020708 | 3300025949 | Bacteria | 7308 |
| 448 | Ga0207667_10027149 | 3300025949 | Bacteria | 6240 |
| 449 | Ga0207667_10067152 | 3300025949 | Bacteria | 3736 |
| 450 | Ga0207667_10071267 | 3300025949 | Bacteria | 3614 |
| 451 | Ga0207667_10102159 | 3300025949 | Bacteria | 2957 |
| 452 | Ga0207667_10111978 | 3300025949 | Bacteria | 2815 |
| 453 | Ga0207658_10038530 | 3300025986 | Bacteria | 3444 |
| 454 | Ga0207677_10012512 | 3300026023 | Bacteria | 4882 |
| 455 | Ga0207677_10108634 | 3300026023 | Bacteria | 2060 |
| 456 | Ga0207703_10005373 | 3300026035 | Bacteria | 10318 |
| 457 | Ga0207703_10076912 | 3300026035 | Unclassified | 2769 |
| 458 | Ga0207639_10009010 | 3300026041 | Bacteria | 6871 |
| 459 | Ga0207639_10021511 | 3300026041 | Bacteria | 4634 |
| 460 | Ga0207639_10043781 | 3300026041 | Bacteria | 3363 |
| 461 | Ga0207639_10068389 | 3300026041 | Bacteria | 2768 |
| 462 | Ga0207639_10094247 | 3300026041 | Bacteria | 2403 |
| 463 | Ga0207639_10162556 | 3300026041 | Bacteria | 1883 |
| 464 | Ga0207678_10032459 | 3300026067 | Bacteria | 4550 |
| 465 | Ga0207702_10002046 | 3300026078 | Bacteria | 19526 |
| 466 | Ga0207702_10010352 | 3300026078 | Bacteria | 7810 |
| 467 | Ga0207702_10047968 | 3300026078 | Bacteria | 3600 |
| 468 | Ga0207702_10053235 | 3300026078 | Bacteria | 3426 |
| 469 | Ga0207641_10000058 | 3300026088 | Bacteria | 166385 |
| 470 | Ga0207641_10039984 | 3300026088 | Unclassified | 3923 |
| 471 | Ga0207648_10001785 | 3300026089 | Bacteria | 23566 |
| 472 | Ga0207648_10072778 | 3300026089 | Unclassified | 2995 |
| 473 | Ga0207648_10137387 | 3300026089 | Bacteria | 2153 |
| 474 | Ga0207674_10006611 | 3300026116 | Bacteria | 13626 |
| 475 | Ga0207674_10076297 | 3300026116 | Bacteria | 3360 |
| 476 | Ga0207683_10023502 | 3300026121 | Bacteria | 5303 |
| 477 | Ga0207683_10031871 | 3300026121 | Unclassified | 4577 |
| 478 | Ga0207683_10096155 | 3300026121 | Bacteria | 2641 |
| 479 | Ga0207683_10129738 | 3300026121 | Unclassified | 2267 |
| 480 | Ga0207698_10000512 | 3300026142 | Bacteria | 22530 |
| 481 | Ga0207698_10024806 | 3300026142 | Bacteria | 4214 |
| 482 | Ga0207698_10029005 | 3300026142 | Bacteria | 3956 |
| 483 | Ga0207698_10033668 | 3300026142 | Bacteria | 3726 |
| 484 | Ga0209281_1000299 | 3300027111 | Bacteria | 90106 |
| 485 | Ga0209489_109017 | 3300027361 | Bacteria | 12906 |
| 486 | Ga0209282_1020548 | 3300027666 | Bacteria | 4183 |
| 487 | Ga0268266_10000014 | 3300028379 | Bacteria | 644033 |
| 488 | Ga0268266_10000030 | 3300028379 | Bacteria | 417120 |
| 489 | Ga0268266_10017463 | 3300028379 | Bacteria | 6119 |
| 490 | Ga0268264_10000252 | 3300028381 | Bacteria | 99533 |
| 491 | Ga0268264_10000327 | 3300028381 | Bacteria | 75326 |
| 492 | Ga0268264_10000831 | 3300028381 | Bacteria | 33127 |
| 493 | Ga0268264_10001298 | 3300028381 | Bacteria | 23546 |
| 494 | Ga0268264_10002782 | 3300028381 | Bacteria | 15265 |
| 495 | Ga0268264_10003965 | 3300028381 | Bacteria | 12669 |
| 496 | Ga0268264_10014460 | 3300028381 | Bacteria | 6486 |
| 497 | Ga0265337_1001402 | 3300028556 | Bacteria | 11832 |
| 498 | Ga0265319_1000420 | 3300028563 | Bacteria | 30501 |
| 499 | Ga0265319_1000467 | 3300028563 | Bacteria | 28640 |
| 500 | Ga0265319_1003941 | 3300028563 | Bacteria | 7542 |
| 501 | Ga0265319_1009624 | 3300028563 | Bacteria | 4097 |
| 502 | Ga0265319_1009830 | 3300028563 | Bacteria | 4037 |
| 503 | Ga0265318_10000515 | 3300028577 | Bacteria | 27834 |
| 504 | Ga0265318_10002652 | 3300028577 | Bacteria | 9424 |
| 505 | Ga0265318_10003776 | 3300028577 | Bacteria | 7524 |
| 506 | Ga0265318_10008173 | 3300028577 | Bacteria | 4675 |
| 507 | Ga0265322_10001539 | 3300028654 | Bacteria | 7422 |
| 508 | Ga0265336_10000401 | 3300028666 | Bacteria | 27229 |
| 509 | Ga0307517_10027990 | 3300028786 | Bacteria | 6742 |
| 510 | Ga0307515_10000007 | 3300028794 | Bacteria | 719669 |
| 511 | Ga0307515_10000059 | 3300028794 | Bacteria | 257520 |
| 512 | Ga0307515_10001574 | 3300028794 | Bacteria | 50970 |
| 513 | Ga0307515_10002884 | 3300028794 | Bacteria | 36561 |
| 514 | Ga0265338_10000098 | 3300028800 | Bacteria | 159918 |
| 515 | Ga0265338_10000301 | 3300028800 | Bacteria | 89146 |
| 516 | Ga0265338_10078937 | 3300028800 | Bacteria | 2773 |
| 517 | Ga0265324_10000039 | 3300029957 | Bacteria | 118772 |
| 518 | Ga0265324_10009147 | 3300029957 | Bacteria | 3885 |
| 519 | Ga0307511_10000264 | 3300030521 | Bacteria | 54303 |
| 520 | Ga0265332_10024684 | 3300031238 | Bacteria | 2643 |
| 521 | Ga0265320_10000211 | 3300031240 | Bacteria | 47112 |
| 522 | Ga0265320_10002240 | 3300031240 | Bacteria | 13578 |
| 523 | Ga0265320_10003659 | 3300031240 | Bacteria | 10262 |
| 524 | Ga0265320_10004566 | 3300031240 | Bacteria | 9057 |
| 525 | Ga0265320_10010814 | 3300031240 | Bacteria | 5407 |
| 526 | Ga0265320_10017082 | 3300031240 | Bacteria | 4041 |
| 527 | Ga0265325_10001472 | 3300031241 | Bacteria | 16577 |
| 528 | Ga0265331_10013378 | 3300031250 | Bacteria | 4415 |
| 529 | Ga0265327_10000055 | 3300031251 | Bacteria | 247188 |
| 530 | Ga0265327_10000389 | 3300031251 | Bacteria | 82772 |
| 531 | Ga0265327_10003823 | 3300031251 | Bacteria | 13917 |
| 532 | Ga0265327_10006116 | 3300031251 | Bacteria | 9746 |
| 533 | Ga0265316_10000749 | 3300031344 | Bacteria | 35852 |
| 534 | Ga0265316_10047171 | 3300031344 | Bacteria | 3409 |
| 535 | Ga0307408_100001985 | 3300031548 | Bacteria | 14769 |
| 536 | Ga0265313_10000633 | 3300031595 | Bacteria | 36277 |
| 537 | Ga0265313_10001548 | 3300031595 | Bacteria | 21373 |
| 538 | Ga0265313_10004840 | 3300031595 | Bacteria | 10119 |
| 539 | Ga0265313_10005787 | 3300031595 | Bacteria | 8980 |
| 540 | Ga0265313_10013227 | 3300031595 | Bacteria | 4968 |
| 541 | Ga0265314_10000072 | 3300031711 | Bacteria | 149041 |
| 542 | Ga0265342_10020640 | 3300031712 | Bacteria | 4220 |
| 543 | Ga0307410_10003514 | 3300031852 | Bacteria | 7872 |
| 544 | Ga0307406_10000055 | 3300031901 | Bacteria | 62544 |
| 545 | Ga0307406_10006654 | 3300031901 | Bacteria | 6389 |
| 546 | Ga0307407_10000130 | 3300031903 | Bacteria | 23045 |
| 547 | Ga0307416_100003315 | 3300032002 | Bacteria | 9415 |
| 548 | Ga0307414_10000012 | 3300032004 | Bacteria | 322675 |
| 549 | Ga0307414_10050702 | 3300032004 | Bacteria | 2876 |
| 550 | Ga0307411_10000008 | 3300032005 | Bacteria | 321575 |
| 551 | Ga0307510_10000190 | 3300033180 | Bacteria | 53134 |
| 552 | Ga0307510_10022235 | 3300033180 | Bacteria | 7369 |
| 553 | Ga0373927_0103772 | 3300035695 | Unclassified | 1850 |
| 554 | Ga0395899_0000001 | 3300037312 | Bacteria | 1750322 |
| 555 | Ga0395899_0000676 | 3300037312 | Bacteria | 34533 |
| 556 | Ga0395905_0000001 | 3300037471 | Bacteria | 2037079 |
| 557 | Ga0395905_0008047 | 3300037471 | Bacteria | 10416 |
| 558 | Ga0436365_0473715 | 3300039437 | Bacteria | 54513 |
| 559 | Ga0436365_1374220 | 3300039437 | Bacteria | 5891 |
| 560 | Ga0439431_0000737 | 3300041997 | Bacteria | 7068 |
| 561 | Ga0466969_0020515 | 3300044656 | Bacteria | 3421 |
| 562 | Ga0466972_0000055 | 3300044658 | Bacteria | 111338 |
| 563 | Ga0466972_0000064 | 3300044658 | Bacteria | 104558 |
| 564 | Ga0466972_0006983 | 3300044658 | Bacteria | 5664 |
| 565 | Ga0466972_0053648 | 3300044658 | Bacteria | 1941 |
| 566 | Ga0466966_0000030 | 3300044684 | Bacteria | 103300 |
| 567 | Ga0466961_0044859 | 3300044693 | Bacteria | 2829 |
| 568 | Ga0453684_0007525 | 3300044712 | Bacteria | 19979 |
| 569 | Ga0453684_0242806 | 3300044712 | Bacteria | 2072 |
| 570 | Ga0466970_0004697 | 3300044765 | Bacteria | 6747 |
| 571 | Ga0466970_0007538 | 3300044765 | Bacteria | 5458 |
| 572 | Ga0466970_0031721 | 3300044765 | Bacteria | 2791 |
| 573 | Ga0466957_0004583 | 3300044842 | Bacteria | 7723 |
| 574 | Ga0466957_0005287 | 3300044842 | Bacteria | 7233 |
| 575 | Ga0466957_0010945 | 3300044842 | Bacteria | 5217 |
| 576 | Ga0466957_0027203 | 3300044842 | Bacteria | 3397 |
| 577 | Ga0466959_0000009 | 3300045049 | Bacteria | 176964 |
| 578 | Ga0466959_0002393 | 3300045049 | Bacteria | 11965 |
| 579 | Ga0495627_011886 | 3300046453 | Unclassified | 3106 |
| 580 | Ga0495638_0000006 | 3300046460 | Bacteria | 668846 |
| 581 | Ga0495650_0000127 | 3300046471 | Bacteria | 177276 |
| 582 | Ga0495585_0000088 | 3300046492 | Bacteria | 96490 |
| 583 | Ga0495585_0009559 | 3300046492 | Bacteria | 5804 |
| 584 | Ga0495606_0000033 | 3300046507 | Bacteria | 247739 |
| 585 | Ga0495606_0011985 | 3300046507 | Bacteria | 7003 |
| 586 | Ga0495606_0020200 | 3300046507 | Bacteria | 4922 |
| 587 | Ga0495606_0023809 | 3300046507 | Bacteria | 4428 |
| 588 | Ga0495606_0059733 | 3300046507 | Bacteria | 2445 |
| 589 | Ga0495606_0061665 | 3300046507 | Bacteria | 2397 |
| 590 | Ga0495610_0000350 | 3300046512 | Bacteria | 48523 |
| 591 | Ga0495610_0001633 | 3300046512 | Bacteria | 19730 |
| 592 | Ga0495631_0002396 | 3300046518 | Bacteria | 10595 |
| 593 | Ga0495632_0055057 | 3300046519 | Bacteria | 1948 |
| 594 | Ga0495643_0000357 | 3300046522 | Bacteria | 62250 |
| 595 | Ga0495643_0000542 | 3300046522 | Bacteria | 46816 |
| 596 | Ga0495643_0031212 | 3300046522 | Bacteria | 2967 |
| 597 | Ga0495663_0007878 | 3300046525 | Bacteria | 2944 |
| 598 | Ga0495609_0002951 | 3300046538 | Bacteria | 10058 |
| 599 | Ga0495609_0015316 | 3300046538 | Bacteria | 3590 |
| 600 | Ga0495633_0000067 | 3300046558 | Bacteria | 139122 |
| 601 | Ga0495633_0000869 | 3300046558 | Bacteria | 26201 |
| 602 | Ga0495633_0003779 | 3300046558 | Bacteria | 9930 |
| 603 | Ga0495668_0000069 | 3300046616 | Bacteria | 174287 |
| 604 | Ga0495668_0001902 | 3300046616 | Bacteria | 18682 |
| 605 | Ga0495611_0000046 | 3300046648 | Bacteria | 88300 |
| 606 | Ga0495611_0000106 | 3300046648 | Bacteria | 58129 |
| 607 | Ga0495625_0000048 | 3300046660 | Bacteria | 198976 |
| 608 | Ga0495625_0000419 | 3300046660 | Bacteria | 63844 |
| 609 | Ga0495625_0002288 | 3300046660 | Bacteria | 20992 |
| 610 | Ga0495625_0019975 | 3300046660 | Bacteria | 5182 |
| 611 | Ga0495661_0002260 | 3300046665 | Bacteria | 14910 |
| 612 | Ga0495661_0007898 | 3300046665 | Bacteria | 7391 |
| 613 | Ga0495661_0055728 | 3300046665 | Bacteria | 2368 |
| 614 | Ga0495649_0000146 | 3300046694 | Bacteria | 61862 |
| 615 | Ga0495660_0012841 | 3300046810 | Bacteria | 4859 |
| 616 | Ga0495683_0068468 | 3300047323 | Bacteria | 1746 |
| 617 | Ga0495687_000144 | 3300047443 | Bacteria | 108217 |
| 618 | Ga0495687_001622 | 3300047443 | Bacteria | 20265 |
| 619 | Ga0495686_0000040 | 3300047472 | Bacteria | 301210 |
| 620 | Ga0495686_0000041 | 3300047472 | Bacteria | 297599 |
| 621 | Ga0495686_0000058 | 3300047472 | Bacteria | 240089 |
| 622 | Ga0495686_0000454 | 3300047472 | Bacteria | 61738 |
| 623 | Ga0495686_0000938 | 3300047472 | Bacteria | 36167 |
| 624 | Ga0495686_0001041 | 3300047472 | Bacteria | 33277 |
| 625 | Ga0496101_0064240 | 3300048904 | Unclassified | 2673 |
| 626 | Ga0496114_0080679 | 3300048917 | Unclassified | 2748 |
| 627 | Ga0496115_0006177 | 3300048918 | Bacteria | 8762 |
| 628 | Ga0496116_0000004 | 3300048919 | Bacteria | 839841 |
| 629 | Ga0496116_0000047 | 3300048919 | Bacteria | 315121 |
| 630 | Ga0496116_0001943 | 3300048919 | Bacteria | 22262 |
| 631 | Ga0496117_0003199 | 3300048920 | Bacteria | 19389 |
| 632 | Ga0496121_0000007 | 3300048924 | Bacteria | 942516 |
| 633 | Ga0496121_0024856 | 3300048924 | Bacteria | 5712 |
| 634 | Ga0496121_0100184 | 3300048924 | Bacteria | 2237 |
| 635 | Ga0496122_0002274 | 3300048925 | Bacteria | 27798 |
| 636 | Ga0496122_0002475 | 3300048925 | Bacteria | 26106 |
| 637 | Ga0496123_0033280 | 3300048926 | Bacteria | 3712 |
| 638 | Ga0496124_0015640 | 3300048927 | Bacteria | 7262 |
| 639 | Ga0496125_0000012 | 3300048928 | Bacteria | 651142 |
| 640 | Ga0496125_0000050 | 3300048928 | Bacteria | 286703 |
| 641 | Ga0496125_0000483 | 3300048928 | Bacteria | 70302 |
| 642 | Ga0496126_0004174 | 3300048929 | Bacteria | 17438 |
| 643 | Ga0496126_0022098 | 3300048929 | Bacteria | 6196 |
| 644 | Ga0495678_003658 | 3300049459 | Bacteria | 9334 |
| 645 | Ga0501031_0029530 | 3300049568 | Bacteria | 3576 |
| 646 | Ga0501033_0058914 | 3300049570 | Bacteria | 2836 |
| 647 | Ga0501034_0036525 | 3300049571 | Bacteria | 4977 |
| 648 | Ga0501034_0041531 | 3300049571 | Bacteria | 4654 |
| 649 | Ga0501036_0072346 | 3300049572 | Bacteria | 2914 |
| 650 | Ga0501037_0008518 | 3300049573 | Bacteria | 7523 |
| 651 | Ga0501038_0010723 | 3300049574 | Bacteria | 8377 |
| 652 | Ga0501043_0081596 | 3300049579 | Bacteria | 2541 |
| 653 | Ga0501046_0082021 | 3300049580 | Bacteria | 2491 |
| 654 | Ga0501047_0075165 | 3300049581 | Bacteria | 3251 |
| 655 | Ga0501047_0186317 | 3300049581 | Bacteria | 1941 |
| 656 | Ga0501238_000216 | 3300049671 | Bacteria | 8280 |
| 657 | Ga0501247_000051 | 3300049677 | Bacteria | 6402 |
| 658 | Ga0501249_000027 | 3300049679 | Bacteria | 87387 |
| 659 | Ga0501219_000280 | 3300049703 | Bacteria | 9053 |
| 660 | Ga0501241_000127 | 3300049758 | Bacteria | 16544 |
| 661 | Ga0501241_001897 | 3300049758 | Bacteria | 4108 |
| 662 | Ga0501241_001963 | 3300049758 | Bacteria | 4037 |
| 663 | Ga0501241_003329 | 3300049758 | Bacteria | 3038 |
| 664 | Ga0501266_000004 | 3300049763 | Bacteria | 356286 |
| 665 | Ga0501280_000632 | 3300049776 | Bacteria | 8001 |
| 666 | Ga0501035_0186598 | 3300049822 | Bacteria | 1784 |
| 667 | Ga0501044_0080680 | 3300049823 | Bacteria | 3295 |
| 668 | Ga0501284_00002 | 3300050005 | Bacteria | 220402 |
| 669 | nmdc:mga0k408_497_c1 | 3300050493 | Bacteria | 21567 |
| 670 | nmdc:mga0k408_7085_c1 | 3300050493 | Bacteria | 5989 |
| 671 | nmdc:mga08y16_99331_c1 | 3300050511 | Bacteria | 3030 |
| 672 | Ga0500578_0000029 | 3300053086 | Bacteria | 140078 |
| 673 | Ga0500578_0021871 | 3300053086 | Bacteria | 4108 |
| 674 | Ga0500644_0000071 | 3300053088 | Bacteria | 60641 |
| 675 | Ga0500644_0000155 | 3300053088 | Bacteria | 42910 |
| 676 | Ga0500644_0001116 | 3300053088 | Bacteria | 7906 |
| 677 | Ga0500644_0001528 | 3300053088 | Bacteria | 6079 |
| 678 | Ga0500644_0006229 | 3300053088 | Bacteria | 3048 |
| 679 | Ga0500583_0000053 | 3300053092 | Bacteria | 74724 |
| 680 | Ga0500651_0011345 | 3300053093 | Bacteria | 5370 |
| 681 | Ga0500651_0049750 | 3300053093 | Bacteria | 2632 |
| 682 | Ga0500641_0000020 | 3300053096 | Bacteria | 119591 |
| 683 | Ga0500641_0000025 | 3300053096 | Bacteria | 108050 |
| 684 | Ga0500641_0000553 | 3300053096 | Bacteria | 13499 |
| 685 | Ga0500641_0001693 | 3300053096 | Bacteria | 7842 |
| 686 | Ga0500562_000029 | 3300053108 | Bacteria | 94705 |
| 687 | Ga0500569_012683 | 3300053109 | Bacteria | 2044 |
| 688 | Ga0500618_000073 | 3300053125 | Bacteria | 81706 |
| 689 | Ga0500618_006949 | 3300053125 | Bacteria | 3272 |
| 690 | Ga0500652_005048 | 3300053131 | Bacteria | 4125 |
| 691 | Ga0500652_014800 | 3300053131 | Bacteria | 2799 |
| 692 | Ga0500658_0000010 | 3300053134 | Bacteria | 248149 |
| 693 | Ga0500658_0000895 | 3300053134 | Bacteria | 12204 |
| 694 | Ga0500568_0046215 | 3300053139 | Bacteria | 1729 |
| 695 | Ga0500577_0001383 | 3300053142 | Bacteria | 6199 |
| 696 | Ga0500577_0001852 | 3300053142 | Bacteria | 5417 |
| 697 | Ga0500616_0000044 | 3300053153 | Bacteria | 339611 |
| 698 | Ga0500616_0031602 | 3300053153 | Bacteria | 2898 |
| 699 | Ga0500622_0000304 | 3300053156 | Bacteria | 50299 |
| 700 | Ga0500622_0000305 | 3300053156 | Bacteria | 50294 |
| 701 | Ga0500622_0001510 | 3300053156 | Bacteria | 18461 |
| 702 | Ga0500622_0003237 | 3300053156 | Bacteria | 11063 |
| 703 | Ga0500624_000231 | 3300053157 | Bacteria | 20263 |
| 704 | Ga0500633_0003732 | 3300053160 | Bacteria | 3372 |
| 705 | Ga0500633_0015264 | 3300053160 | Bacteria | 2200 |
| 706 | Ga0466962_0058894 | 3300061719 | Bacteria | 1833 |
| 707 | 2513232265 | 2513020052 | Bacteria | 5120511 |
| 708 | 2520881906 | 2519899754 | Bacteria | 5336938 |
| 709 | 2599478882 | 2599185184 | Bacteria | 6430550 |
| 710 | 2644009813 | 2643221600 | Bacteria | 5530138 |
| 711 | 2644369742 | 2643221667 | Bacteria | 5627472 |
| 712 | 2644374230 | 2643221667 | Bacteria | 5627472 |
| 713 | 2644640559 | 2643221716 | Bacteria | 4986332 |
| 714 | 2644683704 | 2643221725 | Bacteria | 5087956 |
| 715 | 2722729286 | 2721755487 | Bacteria | 6357185 |
| 716 | 2738698586 | 2738541273 | Bacteria | 4048577 |
| 717 | 2738733205 | 2738541279 | Bacteria | 6149495 |
| 718 | 2738733289 | 2738541279 | Bacteria | 6149495 |
| 719 | 2738754220 | 2738541283 | Bacteria | 7222293 |
| 720 | 2738765743 | 2738541285 | Bacteria | 6150075 |
| 721 | 2738765827 | 2738541285 | Bacteria | 6150075 |
| 722 | 2739214786 | 2738543007 | Bacteria | 6149845 |
| 723 | 2739214870 | 2738543007 | Bacteria | 6149845 |
| 724 | 2739252912 | 2738543014 | Bacteria | 4048139 |
| 725 | 2740002472 | 2739367857 | Bacteria | 5433684 |
| 726 | 2740007288 | 2739367858 | Bacteria | 5432813 |
| 727 | 2740032287 | 2739367866 | Bacteria | 4215900 |
| 728 | 2802652409 | 2802428842 | Bacteria | 4926114 |
| 729 | 2817417410 | 2816332280 | Bacteria | 5109718 |
| 730 | 2819578119 | 2818991442 | Bacteria | 8318214 |
| 731 | 2819588678 | 2818991444 | Bacteria | 6968812 |
| 732 | 2819682133 | 2818991460 | Bacteria | 7595395 |
| 733 | 2821139235 | 2821136567 | Bacteria | 8080116 |
| 734 | 2840677970 | 2840677318 | Bacteria | 2664183 |
| 735 | 2857615883 | 2857613821 | Bacteria | 4917088 |
| 736 | 2857620372 | 2857618242 | Bacteria | 5635925 |
| 737 | 2881250788 | 2881247448 | Bacteria | 3717788 |
| 738 | 2881362653 | 2881359912 | Bacteria | 4935907 |
| 739 | 2883070862 | 2883068021 | Bacteria | 6192739 |
| 740 | 2884795105 | 2884791551 | Bacteria | 8511252 |
| 741 | 2896085787 | 2896085136 | Bacteria | 6129793 |
| 742 | 2896114037 | 2896109856 | Bacteria | 7140722 |
| 743 | 2898715959 | 2898713307 | Bacteria | 4110805 |
| 744 | 2903897856 | 2903895155 | Bacteria | 5258610 |
| 745 | 2904422078 | 2904419702 | Bacteria | 5166287 |
| 746 | 2904473200 | 2904467357 | Bacteria | 8057758 |
| 747 | 2904559086 | 2904555929 | Bacteria | 5218588 |
| 748 | 2904780961 | 2904780799 | Bacteria | 5840761 |
| 749 | 2911138966 | 2911138879 | Bacteria | 5811561 |
| 750 | 2919180575 | 2919177583 | Bacteria | 5641607 |
| 751 | 2919192114 | 2919191525 | Bacteria | 5765973 |
| 752 | 2919438673 | 2919437846 | Bacteria | 6199444 |
| 753 | 2919511724 | 2919509842 | Bacteria | 4104664 |
| 754 | 2919686032 | 2919683626 | Bacteria | 5534354 |
| 755 | 2928082892 | 2928078545 | Bacteria | 6534839 |
| 756 | 2928149910 | 2928147474 | Bacteria | 6512076 |
| 757 | 2929154674 | 2929150217 | Bacteria | 5462483 |
| 758 | 2929157637 | 2929154850 | Bacteria | 6753285 |
| 759 | 2929182520 | 2929177148 | Bacteria | 7883697 |
| 760 | 2929242294 | 2929239360 | Bacteria | 7745570 |
| 761 | 2929244161 | 2929239360 | Bacteria | 7745570 |
| 762 | 2929922266 | 2929921140 | Bacteria | 8649150 |
| 763 | 2929925867 | 2929921140 | Bacteria | 8649150 |
| 764 | 2932086213 | 2932082852 | Bacteria | 6563563 |
| 765 | 2945978445 | 2945977869 | Bacteria | 7777518 |
| 766 | 2946015691 | 2946013367 | Bacteria | 7766675 |
| 767 | 2958459085 | 2958458903 | Bacteria | 5301041 |
| 768 | 2958512674 | 2958512119 | Bacteria | 4528530 |
| 769 | 2965320533 | 2965320100 | Bacteria | 3975600 |
| 770 | 2965323318 | 2965320100 | Bacteria | 3975600 |
| 771 | 2977271507 | 2977268062 | Bacteria | 5243061 |
| 772 | 8003154777 | 8003151029 | Bacteria | 8187759 |
| 773 | 8054310538 | 8054307821 | Bacteria | 5212224 |
| 774 | 8055423034 | 8055419101 | Bacteria | 5289643 |
| 775 | 8055596614 | 8055592153 | Bacteria | 5961247 |
| 776 | 8056442064 | 8056440228 | Bacteria | 4946504 |
| 777 | Ga0068855_100005780 | |||
| 778 | SwRhRL2b_contig_1102694 | |||
| 779 | SwRhRL2b_contig_2318651 | |||
| 780 | JGI24740J21852_10004527 | |||
| 781 | JGI24739J22299_10006887 | |||
| 782 | JGI24737J22298_10006986 | |||
| 783 | JGI24735J21928_10000016 | |||
| 784 | JGI25162J39368_1000005 | |||
| 785 | JGI25162J39368_1000161 | |||
| 786 | JGI25162J39368_1001763 | |||
| 787 | JGI25154J39366_1000003 | |||
| 788 | JGI25157J39369_1002538 | |||
| 789 | JGI25406J46586_10015793 | |||
| 790 | JGI25165J46597_1001210 | |||
| 791 | rootH1_10011283 | |||
| 792 | rootH1_10015988 | |||
| 793 | rootH1_10077136 | |||
| 794 | rootH1_10093429 | |||
| 795 | rootH1_10125406 | |||
| 796 | rootH1_10126974 | |||
| 797 | rootH1_10134713 | |||
| 798 | rootH2_10000040 | |||
| 799 | rootH2_10001435 | |||
| 800 | rootH2_10001661 | |||
| 801 | rootH2_10004220 | |||
| 802 | rootH2_10006439 | |||
| 803 | rootH2_10007549 | |||
| 804 | rootH2_10031165 | |||
| 805 | rootH2_10062478 | |||
| 806 | rootH2_10090169 | |||
| 807 | rootH2_10148453 | |||
| 808 | rootH2_10148753 | |||
| 809 | rootH2_10230939 | |||
| 810 | rootL2_10029829 | |||
| 811 | rootL2_10038171 | |||
| 812 | rootL2_10060051 | |||
| 813 | rootL2_10089683 | |||
| 814 | rootL2_10089752 | |||
| 815 | rootL2_10224022 | |||
| 816 | rootL2_10239643 | |||
| 817 | rootL2_10256246 | |||
| 818 | rootL2_10288882 | |||
| 819 | rootH1_10007228 | |||
| 820 | rootH1_10009967 | |||
| 821 | rootH1_10037477 | |||
| 822 | rootH1_10047628 | |||
| 823 | rootH1_10060901 | |||
| 824 | rootH1_10061241 | |||
| 825 | rootH1_10063750 | |||
| 826 | rootH1_10063751 | |||
| 827 | rootH1_10084076 | |||
| 828 | rootH1_10132616 | |||
| 829 | rootH1_10156159 | |||
| 830 | JGI25160J50197_1000733 | |||
| 831 | JGI25160J50197_1007002 | |||
| 832 | Ga0055535_1002136 | |||
| 833 | Ga0055535_1002452 | |||
| 834 | Ga0055542_1004230 | |||
| 835 | Ga0055526_1004431 | |||
| 836 | Ga0055526_1020551 | |||
| 837 | Ga0055528_1000180 | |||
| 838 | Ga0055530_10002883 | |||
| 839 | Ga0055531_10000036 | |||
| 840 | Ga0055531_10000159 | |||
| 841 | Ga0055531_10000295 | |||
| 842 | Ga0065165_1000019 | |||
| 843 | Ga0065165_1016930 | |||
| 844 | Ga0065714_10009084 | |||
| 845 | Ga0065714_10076766 | |||
| 846 | Ga0065714_10078013 | |||
| 847 | Ga0065704_10003041 | |||
| 848 | Ga0065704_10074482 | |||
| 849 | Ga0065704_10074814 | |||
| 850 | Ga0065715_10159268 | |||
| 851 | Ga0070658_10106933 | |||
| 852 | Ga0070658_10178492 | |||
| 853 | Ga0070690_100009074 | |||
| 854 | Ga0070670_100014386 | |||
| 855 | Ga0070670_100029150 | |||
| 856 | Ga0068869_100071896 | |||
| 857 | Ga0070666_10003725 | |||
| 858 | Ga0070666_10032465 | |||
| 859 | Ga0070666_10053423 | |||
| 860 | Ga0070680_100079619 | |||
| 861 | Ga0068868_100015367 | |||
| 862 | Ga0070660_100005439 | |||
| 863 | Ga0070691_10025737 | |||
| 864 | Ga0070671_100066512 | |||
| 865 | Ga0070671_100087866 | |||
| 866 | Ga0070673_100002752 | |||
| 867 | Ga0070673_100015275 | |||
| 868 | Ga0070673_100061200 | |||
| 869 | Ga0070659_100001172 | |||
| 870 | Ga0070659_100007089 | |||
| 871 | Ga0070659_100007440 | |||
| 872 | Ga0070659_100064498 | |||
| 873 | Ga0070667_100080049 | |||
| 874 | Ga0070714_100000081 | |||
| 875 | Ga0070663_100061520 | |||
| 876 | Ga0070678_100029318 | |||
| 877 | Ga0070678_100069249 | |||
| 878 | Ga0070662_100002133 | |||
| 879 | Ga0070662_100003532 | |||
| 880 | Ga0070681_10093730 | |||
| 881 | Ga0068867_100000655 | |||
| 882 | Ga0068867_100030334 | |||
| 883 | Ga0068867_100082355 | |||
| 884 | Ga0070684_100008572 | |||
| 885 | Ga0068853_100000453 | |||
| 886 | Ga0068853_100012007 | |||
| 887 | Ga0068853_100020139 | |||
| 888 | Ga0068853_100030162 | |||
| 889 | Ga0068853_100060395 | |||
| 890 | Ga0068853_100126390 | |||
| 891 | Ga0068853_100166494 | |||
| 892 | Ga0070672_100022895 | |||
| 893 | Ga0070693_100042394 | |||
| 894 | Ga0070665_100000041 | |||
| 895 | Ga0070665_100000147 | |||
| 896 | Ga0068855_100001107 | |||
| 897 | Ga0068855_100011903 | |||
| 898 | Ga0068855_100012759 | |||
| 899 | Ga0068855_100013183 | |||
| 900 | Ga0068855_100032981 | |||
| 901 | Ga0068855_100050422 | |||
| 902 | Ga0068855_100055421 | |||
| 903 | Ga0068855_100066262 | |||
| 904 | Ga0068855_100140471 | |||
| 905 | Ga0070664_100016255 | |||
| 906 | Ga0070664_100028760 | |||
| 907 | Ga0068857_100023248 | |||
| 908 | Ga0068857_100060637 | |||
| 909 | Ga0068854_100027069 | |||
| 910 | Ga0068856_100009075 | |||
| 911 | Ga0068856_100037750 | |||
| 912 | Ga0068856_100049900 | |||
| 913 | Ga0068856_100139633 | |||
| 914 | Ga0068856_100142068 | |||
| 915 | Ga0068852_100000913 | |||
| 916 | Ga0068852_100003549 | |||
| 917 | Ga0068852_100007002 | |||
| 918 | Ga0068852_100009586 | |||
| 919 | Ga0068852_100027556 | |||
| 920 | Ga0068859_100000024 | |||
| 921 | Ga0068864_100024355 | |||
| 922 | Ga0068851_10024733 | |||
| 923 | Ga0068851_10062686 | |||
| 924 | Ga0068863_100024717 | |||
| 925 | Ga0068863_100099530 | |||
| 926 | Ga0068858_100047842 | |||
| 927 | Ga0068858_100057241 | |||
| 928 | Ga0068858_100098361 | |||
| 929 | Ga0068860_100000041 | |||
| 930 | Ga0068860_100000052 | |||
| 931 | Ga0068860_100000491 | |||
| 932 | Ga0068860_100004518 | |||
| 933 | Ga0068860_100006462 | |||
| 934 | Ga0068860_100007089 | |||
| 935 | Ga0068860_100008185 | |||
| 936 | Ga0068860_100018183 | |||
| 937 | Ga0097621_100000109 | |||
| 938 | Ga0097621_100000551 | |||
| 939 | Ga0097621_100027330 | |||
| 940 | Ga0097621_100057280 | |||
| 941 | Ga0068871_100000044 | |||
| 942 | Ga0068871_100000072 | |||
| 943 | Ga0068871_100036139 | |||
| 944 | Ga0068865_100000309 | |||
| 945 | Ga0097620_100000024 | |||
| 946 | Ga0099824_1006574 | |||
| 947 | Ga0079104_1000178 | |||
| 948 | Ga0099826_10000598 | |||
| 949 | Ga0105244_10000002 | |||
| 950 | Ga0105244_10000095 | |||
| 951 | Ga0105240_10000059 | |||
| 952 | Ga0105240_10000100 | |||
| 953 | Ga0105240_10000126 | |||
| 954 | Ga0105240_10000547 | |||
| 955 | Ga0105240_10000908 | |||
| 956 | Ga0105240_10000998 | |||
| 957 | Ga0105240_10001161 | |||
| 958 | Ga0105240_10003553 | |||
| 959 | Ga0105240_10006635 | |||
| 960 | Ga0105240_10008415 | |||
| 961 | Ga0105240_10012634 | |||
| 962 | Ga0105240_10018443 | |||
| 963 | Ga0105240_10022605 | |||
| 964 | Ga0105240_10028461 | |||
| 965 | Ga0105240_10045197 | |||
| 966 | Ga0105240_10051777 | |||
| 967 | Ga0105240_10075311 | |||
| 968 | Ga0105240_10107311 | |||
| 969 | Ga0105240_10296497 | |||
| 970 | Ga0111539_10007347 | |||
| 971 | Ga0105245_10033730 | |||
| 972 | Ga0105245_10066035 | |||
| 973 | Ga0105247_10004768 | |||
| 974 | Ga0105243_10000012 | |||
| 975 | Ga0105241_10000781 | |||
| 976 | Ga0105241_10003048 | |||
| 977 | Ga0105241_10005689 | |||
| 978 | Ga0105241_10008207 | |||
| 979 | Ga0105241_10020249 | |||
| 980 | Ga0105242_10002511 | |||
| 981 | Ga0105248_10094699 | |||
| 982 | Ga0105237_10000107 | |||
| 983 | Ga0105237_10000233 | |||
| 984 | Ga0105237_10001116 | |||
| 985 | Ga0105237_10002292 | |||
| 986 | Ga0105237_10002431 | |||
| 987 | Ga0105237_10002590 | |||
| 988 | Ga0105237_10003316 | |||
| 989 | Ga0105237_10003500 | |||
| 990 | Ga0105237_10004181 | |||
| 991 | Ga0105237_10004749 | |||
| 992 | Ga0105237_10005449 | |||
| 993 | Ga0105237_10006746 | |||
| 994 | Ga0105237_10010582 | |||
| 995 | Ga0105237_10011700 | |||
| 996 | Ga0105237_10012117 | |||
| 997 | Ga0105237_10016706 | |||
| 998 | Ga0105237_10016806 | |||
| 999 | Ga0105237_10019148 | |||
| 1000 | Ga0105237_10019660 | |||
| 1001 | Ga0105237_10022352 | |||
| 1002 | Ga0105237_10056820 | |||
| 1003 | Ga0105237_10149897 | |||
| 1004 | Ga0105237_10171829 | |||
| 1005 | Ga0105237_10236859 | |||
| 1006 | Ga0105238_10006406 | |||
| 1007 | Ga0105238_10013083 | |||
| 1008 | Ga0105238_10015542 | |||
| 1009 | Ga0105238_10055361 | |||
| 1010 | Ga0105238_10321234 | |||
| 1011 | Ga0105249_10021834 | |||
| 1012 | Ga0105249_10092691 | |||
| 1013 | Ga0105239_10000006 | |||
| 1014 | Ga0105239_10000011 | |||
| 1015 | Ga0105239_10000038 | |||
| 1016 | Ga0105239_10000071 | |||
| 1017 | Ga0105239_10000087 | |||
| 1018 | Ga0105239_10000089 | |||
| 1019 | Ga0105239_10000137 | |||
| 1020 | Ga0105239_10001021 | |||
| 1021 | Ga0105239_10001053 | |||
| 1022 | Ga0105239_10001274 | |||
| 1023 | Ga0105239_10001754 | |||
| 1024 | Ga0105239_10001888 | |||
| 1025 | Ga0105239_10002186 | |||
| 1026 | Ga0105239_10003136 | |||
| 1027 | Ga0105239_10003355 | |||
| 1028 | Ga0105239_10004088 | |||
| 1029 | Ga0105239_10005398 | |||
| 1030 | Ga0105239_10005536 | |||
| 1031 | Ga0105239_10012678 | |||
| 1032 | Ga0105239_10025334 | |||
| 1033 | Ga0105239_10029434 | |||
| 1034 | Ga0105239_10050644 | |||
| 1035 | Ga0105239_10057643 | |||
| 1036 | Ga0105239_10073420 | |||
| 1037 | Ga0105239_10244306 | |||
| 1038 | Ga0157373_10000001 | |||
| 1039 | Ga0157373_10000161 | |||
| 1040 | Ga0157373_10006672 | |||
| 1041 | Ga0157373_10007265 | |||
| 1042 | Ga0157371_10000363 | |||
| 1043 | Ga0157371_10001099 | |||
| 1044 | Ga0157371_10003809 | |||
| 1045 | Ga0157370_10000261 | |||
| 1046 | Ga0157370_10000381 | |||
| 1047 | Ga0157370_10000393 | |||
| 1048 | Ga0157370_10000464 | |||
| 1049 | Ga0157370_10000620 | |||
| 1050 | Ga0157370_10003580 | |||
| 1051 | Ga0157370_10005927 | |||
| 1052 | Ga0157370_10025272 | |||
| 1053 | Ga0157369_10001144 | |||
| 1054 | Ga0157369_10010399 | |||
| 1055 | Ga0157369_10011175 | |||
| 1056 | Ga0157369_10012719 | |||
| 1057 | Ga0157369_10024069 | |||
| 1058 | Ga0157369_10067899 | |||
| 1059 | Ga0157369_10190979 | |||
| 1060 | Ga0157374_10006987 | |||
| 1061 | Ga0157374_10009510 | |||
| 1062 | Ga0157374_10013535 | |||
| 1063 | Ga0157374_10034391 | |||
| 1064 | Ga0157374_10183848 | |||
| 1065 | Ga0157378_10001706 | |||
| 1066 | Ga0157378_10003365 | |||
| 1067 | Ga0157378_10005761 | |||
| 1068 | Ga0157378_10007635 | |||
| 1069 | Ga0157378_10013940 | |||
| 1070 | Ga0157378_10059904 | |||
| 1071 | Ga0157378_10076737 | |||
| 1072 | Ga0157378_10093338 | |||
| 1073 | Ga0163162_10000088 | |||
| 1074 | Ga0163162_10000154 | |||
| 1075 | Ga0163162_10000189 | |||
| 1076 | Ga0163162_10000446 | |||
| 1077 | Ga0163162_10000989 | |||
| 1078 | Ga0163162_10001715 | |||
| 1079 | Ga0163162_10010159 | |||
| 1080 | Ga0163162_10012102 | |||
| 1081 | Ga0157372_10000001 | |||
| 1082 | Ga0157372_10000894 | |||
| 1083 | Ga0157372_10001149 | |||
| 1084 | Ga0157372_10003311 | |||
| 1085 | Ga0157372_10003461 | |||
| 1086 | Ga0157372_10005758 | |||
| 1087 | Ga0157372_10019705 | |||
| 1088 | Ga0157372_10058939 | |||
| 1089 | Ga0157372_10081162 | |||
| 1090 | Ga0157372_10085157 | |||
| 1091 | Ga0157372_10203173 | |||
| 1092 | Ga0157375_10000212 | |||
| 1093 | Ga0157375_10013643 | |||
| 1094 | Ga0157375_10078808 | |||
| 1095 | Ga0157375_10264594 | |||
| 1096 | Ga0157375_10280974 | |||
| 1097 | Ga0163163_10000401 | |||
| 1098 | Ga0163163_10072488 | |||
| 1099 | Ga0163163_10125353 | |||
| 1100 | Ga0182008_10000100 | |||
| 1101 | Ga0157377_10021023 | |||
| 1102 | Ga0157379_10006200 | |||
| 1103 | Ga0157379_10019403 | |||
| 1104 | Ga0157379_10050872 | |||
| 1105 | Ga0157376_10001721 | |||
| 1106 | Ga0157376_10013206 | |||
| 1107 | Ga0182006_1001422 | |||
| 1108 | Ga0182005_1000458 | |||
| 1109 | Ga0163161_10000015 | |||
| 1110 | Ga0163161_10000016 | |||
| 1111 | Ga0163161_10000129 | |||
| 1112 | Ga0163161_10001424 | |||
| 1113 | Ga0163161_10005198 | |||
| 1114 | Ga0163161_10005491 | |||
| 1115 | Ga0163161_10053124 | |||
| 1116 | Ga0213876_10001314 | |||
| 1117 | Ga0207427_100323 | |||
| 1118 | Ga0209437_100030 | |||
| 1119 | Ga0209437_100043 | |||
| 1120 | Ga0209437_100077 | |||
| 1121 | Ga0209437_100093 | |||
| 1122 | Ga0209258_100029 | |||
| 1123 | Ga0209258_100036 | |||
| 1124 | Ga0209646_1000004 | |||
| 1125 | Ga0209646_1001113 | |||
| 1126 | Ga0209026_1000132 | |||
| 1127 | Ga0209026_1002237 | |||
| 1128 | Ga0209148_1000089 | |||
| 1129 | Ga0209148_1000139 | |||
| 1130 | Ga0209233_1000486 | |||
| 1131 | Ga0209233_1001892 | |||
| 1132 | Ga0209673_1000042 | |||
| 1133 | Ga0209564_1000840 | |||
| 1134 | Ga0209564_1004230 | |||
| 1135 | Ga0209758_1001003 | |||
| 1136 | Ga0209758_1003437 | |||
| 1137 | Ga0209758_1026375 | |||
| 1138 | Ga0209050_1000308 | |||
| 1139 | Ga0209050_1001642 | |||
| 1140 | Ga0207426_1000170 | |||
| 1141 | Ga0207426_1000192 | |||
| 1142 | Ga0207426_1000310 | |||
| 1143 | Ga0207426_1000316 | |||
| 1144 | Ga0207426_1006631 | |||
| 1145 | Ga0207426_1013256 | |||
| 1146 | Ga0209051_1036254 | |||
| 1147 | Ga0209257_1000006 | |||
| 1148 | Ga0209257_1000008 | |||
| 1149 | Ga0209257_1000077 | |||
| 1150 | Ga0209257_1001059 | |||
| 1151 | Ga0207656_10004894 | |||
| 1152 | Ga0207655_1000012 | |||
| 1153 | Ga0207680_10000455 | |||
| 1154 | Ga0207680_10099756 | |||
| 1155 | Ga0207647_10000082 | |||
| 1156 | Ga0207647_10000258 | |||
| 1157 | Ga0207647_10003046 | |||
| 1158 | Ga0207647_10025668 | |||
| 1159 | Ga0207645_10001313 | |||
| 1160 | Ga0207645_10004307 | |||
| 1161 | Ga0207705_10058257 | |||
| 1162 | Ga0207705_10089064 | |||
| 1163 | Ga0207654_10000944 | |||
| 1164 | Ga0207654_10060572 | |||
| 1165 | Ga0207654_10064360 | |||
| 1166 | Ga0207695_10000013 | |||
| 1167 | Ga0207695_10000027 | |||
| 1168 | Ga0207695_10000039 | |||
| 1169 | Ga0207695_10000067 | |||
| 1170 | Ga0207695_10000462 | |||
| 1171 | Ga0207695_10000636 | |||
| 1172 | Ga0207695_10001344 | |||
| 1173 | Ga0207695_10007657 | |||
| 1174 | Ga0207695_10010350 | |||
| 1175 | Ga0207695_10015824 | |||
| 1176 | Ga0207695_10019331 | |||
| 1177 | Ga0207695_10045756 | |||
| 1178 | Ga0207695_10055876 | |||
| 1179 | Ga0207695_10056712 | |||
| 1180 | Ga0207695_10124522 | |||
| 1181 | Ga0207671_10000904 | |||
| 1182 | Ga0207671_10001299 | |||
| 1183 | Ga0207671_10002877 | |||
| 1184 | Ga0207671_10003140 | |||
| 1185 | Ga0207671_10003329 | |||
| 1186 | Ga0207671_10003615 | |||
| 1187 | Ga0207671_10003994 | |||
| 1188 | Ga0207671_10008032 | |||
| 1189 | Ga0207671_10008692 | |||
| 1190 | Ga0207671_10010120 | |||
| 1191 | Ga0207671_10012711 | |||
| 1192 | Ga0207671_10013534 | |||
| 1193 | Ga0207671_10019677 | |||
| 1194 | Ga0207671_10019941 | |||
| 1195 | Ga0207671_10105088 | |||
| 1196 | Ga0207660_10055191 | |||
| 1197 | Ga0207657_10013025 | |||
| 1198 | Ga0207652_10015401 | |||
| 1199 | Ga0207694_10021422 | |||
| 1200 | Ga0207694_10117866 | |||
| 1201 | Ga0207650_10091479 | |||
| 1202 | Ga0207664_10000042 | |||
| 1203 | Ga0207644_10049573 | |||
| 1204 | Ga0207690_10027064 | |||
| 1205 | Ga0207690_10030606 | |||
| 1206 | Ga0207690_10078667 | |||
| 1207 | Ga0207706_10001583 | |||
| 1208 | Ga0207706_10007140 | |||
| 1209 | Ga0207686_10101551 | |||
| 1210 | Ga0207709_10000006 | |||
| 1211 | Ga0207704_10000220 | |||
| 1212 | Ga0207691_10003968 | |||
| 1213 | Ga0207691_10042786 | |||
| 1214 | Ga0207691_10053050 | |||
| 1215 | Ga0207689_10001522 | |||
| 1216 | Ga0207661_10042475 | |||
| 1217 | Ga0207679_10017412 | |||
| 1218 | Ga0207679_10102303 | |||
| 1219 | Ga0207667_10002393 | |||
| 1220 | Ga0207667_10003062 | |||
| 1221 | Ga0207667_10018573 | |||
| 1222 | Ga0207667_10020708 | |||
| 1223 | Ga0207667_10027149 | |||
| 1224 | Ga0207667_10067152 | |||
| 1225 | Ga0207667_10071267 | |||
| 1226 | Ga0207667_10102159 | |||
| 1227 | Ga0207667_10111978 | |||
| 1228 | Ga0207658_10038530 | |||
| 1229 | Ga0207677_10012512 | |||
| 1230 | Ga0207677_10108634 | |||
| 1231 | Ga0207703_10005373 | |||
| 1232 | Ga0207703_10076912 | |||
| 1233 | Ga0207639_10009010 | |||
| 1234 | Ga0207639_10021511 | |||
| 1235 | Ga0207639_10043781 | |||
| 1236 | Ga0207639_10068389 | |||
| 1237 | Ga0207639_10094247 | |||
| 1238 | Ga0207639_10162556 | |||
| 1239 | Ga0207678_10032459 | |||
| 1240 | Ga0207702_10002046 | |||
| 1241 | Ga0207702_10010352 | |||
| 1242 | Ga0207702_10047968 | |||
| 1243 | Ga0207702_10053235 | |||
| 1244 | Ga0207641_10000058 | |||
| 1245 | Ga0207641_10039984 | |||
| 1246 | Ga0207648_10001785 | |||
| 1247 | Ga0207648_10072778 | |||
| 1248 | Ga0207648_10137387 | |||
| 1249 | Ga0207674_10006611 | |||
| 1250 | Ga0207674_10076297 | |||
| 1251 | Ga0207683_10023502 | |||
| 1252 | Ga0207683_10031871 | |||
| 1253 | Ga0207683_10096155 | |||
| 1254 | Ga0207683_10129738 | |||
| 1255 | Ga0207698_10000512 | |||
| 1256 | Ga0207698_10024806 | |||
| 1257 | Ga0207698_10029005 | |||
| 1258 | Ga0207698_10033668 | |||
| 1259 | Ga0209281_1000299 | |||
| 1260 | Ga0209489_109017 | |||
| 1261 | Ga0209282_1020548 | |||
| 1262 | Ga0268266_10000014 | |||
| 1263 | Ga0268266_10000030 | |||
| 1264 | Ga0268266_10017463 | |||
| 1265 | Ga0268264_10000252 | |||
| 1266 | Ga0268264_10000327 | |||
| 1267 | Ga0268264_10000831 | |||
| 1268 | Ga0268264_10001298 | |||
| 1269 | Ga0268264_10002782 | |||
| 1270 | Ga0268264_10003965 | |||
| 1271 | Ga0268264_10014460 | |||
| 1272 | Ga0265337_1001402 | |||
| 1273 | Ga0265319_1000420 | |||
| 1274 | Ga0265319_1000467 | |||
| 1275 | Ga0265319_1003941 | |||
| 1276 | Ga0265319_1009624 | |||
| 1277 | Ga0265319_1009830 | |||
| 1278 | Ga0265318_10000515 | |||
| 1279 | Ga0265318_10002652 | |||
| 1280 | Ga0265318_10003776 | |||
| 1281 | Ga0265318_10008173 | |||
| 1282 | Ga0265322_10001539 | |||
| 1283 | Ga0265336_10000401 | |||
| 1284 | Ga0307517_10027990 | |||
| 1285 | Ga0307515_10000007 | |||
| 1286 | Ga0307515_10000059 | |||
| 1287 | Ga0307515_10001574 | |||
| 1288 | Ga0307515_10002884 | |||
| 1289 | Ga0265338_10000098 | |||
| 1290 | Ga0265338_10000301 | |||
| 1291 | Ga0265338_10078937 | |||
| 1292 | Ga0265324_10000039 | |||
| 1293 | Ga0265324_10009147 | |||
| 1294 | Ga0307511_10000264 | |||
| 1295 | Ga0265332_10024684 | |||
| 1296 | Ga0265320_10000211 | |||
| 1297 | Ga0265320_10002240 | |||
| 1298 | Ga0265320_10003659 | |||
| 1299 | Ga0265320_10004566 | |||
| 1300 | Ga0265320_10010814 | |||
| 1301 | Ga0265320_10017082 | |||
| 1302 | Ga0265325_10001472 | |||
| 1303 | Ga0265331_10013378 | |||
| 1304 | Ga0265327_10000055 | |||
| 1305 | Ga0265327_10000389 | |||
| 1306 | Ga0265327_10003823 | |||
| 1307 | Ga0265327_10006116 | |||
| 1308 | Ga0265316_10000749 | |||
| 1309 | Ga0265316_10047171 | |||
| 1310 | Ga0307408_100001985 | |||
| 1311 | Ga0265313_10000633 | |||
| 1312 | Ga0265313_10001548 | |||
| 1313 | Ga0265313_10004840 | |||
| 1314 | Ga0265313_10005787 | |||
| 1315 | Ga0265313_10013227 | |||
| 1316 | Ga0265314_10000072 | |||
| 1317 | Ga0265342_10020640 | |||
| 1318 | Ga0307410_10003514 | |||
| 1319 | Ga0307406_10000055 | |||
| 1320 | Ga0307406_10006654 | |||
| 1321 | Ga0307407_10000130 | |||
| 1322 | Ga0307416_100003315 | |||
| 1323 | Ga0307414_10000012 | |||
| 1324 | Ga0307414_10050702 | |||
| 1325 | Ga0307411_10000008 | |||
| 1326 | Ga0307510_10000190 | |||
| 1327 | Ga0307510_10022235 | |||
| 1328 | Ga0373927_0103772 | |||
| 1329 | Ga0395899_0000001 | |||
| 1330 | Ga0395899_0000676 | |||
| 1331 | Ga0395905_0000001 | |||
| 1332 | Ga0395905_0008047 | |||
| 1333 | Ga0436365_0473715 | |||
| 1334 | Ga0436365_1374220 | |||
| 1335 | Ga0439431_0000737 | |||
| 1336 | Ga0466969_0020515 | |||
| 1337 | Ga0466972_0000055 | |||
| 1338 | Ga0466972_0000064 | |||
| 1339 | Ga0466972_0006983 | |||
| 1340 | Ga0466972_0053648 | |||
| 1341 | Ga0466966_0000030 | |||
| 1342 | Ga0466961_0044859 | |||
| 1343 | Ga0453684_0007525 | |||
| 1344 | Ga0453684_0242806 | |||
| 1345 | Ga0466970_0004697 | |||
| 1346 | Ga0466970_0007538 | |||
| 1347 | Ga0466970_0031721 | |||
| 1348 | Ga0466957_0004583 | |||
| 1349 | Ga0466957_0005287 | |||
| 1350 | Ga0466957_0010945 | |||
| 1351 | Ga0466957_0027203 | |||
| 1352 | Ga0466959_0000009 | |||
| 1353 | Ga0466959_0002393 | |||
| 1354 | Ga0495627_011886 | |||
| 1355 | Ga0495638_0000006 | |||
| 1356 | Ga0495650_0000127 | |||
| 1357 | Ga0495585_0000088 | |||
| 1358 | Ga0495585_0009559 | |||
| 1359 | Ga0495606_0000033 | |||
| 1360 | Ga0495606_0011985 | |||
| 1361 | Ga0495606_0020200 | |||
| 1362 | Ga0495606_0023809 | |||
| 1363 | Ga0495606_0059733 | |||
| 1364 | Ga0495606_0061665 | |||
| 1365 | Ga0495610_0000350 | |||
| 1366 | Ga0495610_0001633 | |||
| 1367 | Ga0495631_0002396 | |||
| 1368 | Ga0495632_0055057 | |||
| 1369 | Ga0495643_0000357 | |||
| 1370 | Ga0495643_0000542 | |||
| 1371 | Ga0495643_0031212 | |||
| 1372 | Ga0495663_0007878 | |||
| 1373 | Ga0495609_0002951 | |||
| 1374 | Ga0495609_0015316 | |||
| 1375 | Ga0495633_0000067 | |||
| 1376 | Ga0495633_0000869 | |||
| 1377 | Ga0495633_0003779 | |||
| 1378 | Ga0495668_0000069 | |||
| 1379 | Ga0495668_0001902 | |||
| 1380 | Ga0495611_0000046 | |||
| 1381 | Ga0495611_0000106 | |||
| 1382 | Ga0495625_0000048 | |||
| 1383 | Ga0495625_0000419 | |||
| 1384 | Ga0495625_0002288 | |||
| 1385 | Ga0495625_0019975 | |||
| 1386 | Ga0495661_0002260 | |||
| 1387 | Ga0495661_0007898 | |||
| 1388 | Ga0495661_0055728 | |||
| 1389 | Ga0495649_0000146 | |||
| 1390 | Ga0495660_0012841 | |||
| 1391 | Ga0495683_0068468 | |||
| 1392 | Ga0495687_000144 | |||
| 1393 | Ga0495687_001622 | |||
| 1394 | Ga0495686_0000040 | |||
| 1395 | Ga0495686_0000041 | |||
| 1396 | Ga0495686_0000058 | |||
| 1397 | Ga0495686_0000454 | |||
| 1398 | Ga0495686_0000938 | |||
| 1399 | Ga0495686_0001041 | |||
| 1400 | Ga0496101_0064240 | |||
| 1401 | Ga0496114_0080679 | |||
| 1402 | Ga0496115_0006177 | |||
| 1403 | Ga0496116_0000004 | |||
| 1404 | Ga0496116_0000047 | |||
| 1405 | Ga0496116_0001943 | |||
| 1406 | Ga0496117_0003199 | |||
| 1407 | Ga0496121_0000007 | |||
| 1408 | Ga0496121_0024856 | |||
| 1409 | Ga0496121_0100184 | |||
| 1410 | Ga0496122_0002274 | |||
| 1411 | Ga0496122_0002475 | |||
| 1412 | Ga0496123_0033280 | |||
| 1413 | Ga0496124_0015640 | |||
| 1414 | Ga0496125_0000012 | |||
| 1415 | Ga0496125_0000050 | |||
| 1416 | Ga0496125_0000483 | |||
| 1417 | Ga0496126_0004174 | |||
| 1418 | Ga0496126_0022098 | |||
| 1419 | Ga0495678_003658 | |||
| 1420 | Ga0501031_0029530 | |||
| 1421 | Ga0501033_0058914 | |||
| 1422 | Ga0501034_0036525 | |||
| 1423 | Ga0501034_0041531 | |||
| 1424 | Ga0501036_0072346 | |||
| 1425 | Ga0501037_0008518 | |||
| 1426 | Ga0501038_0010723 | |||
| 1427 | Ga0501043_0081596 | |||
| 1428 | Ga0501046_0082021 | |||
| 1429 | Ga0501047_0075165 | |||
| 1430 | Ga0501047_0186317 | |||
| 1431 | Ga0501238_000216 | |||
| 1432 | Ga0501247_000051 | |||
| 1433 | Ga0501249_000027 | |||
| 1434 | Ga0501219_000280 | |||
| 1435 | Ga0501241_000127 | |||
| 1436 | Ga0501241_001897 | |||
| 1437 | Ga0501241_001963 | |||
| 1438 | Ga0501241_003329 | |||
| 1439 | Ga0501266_000004 | |||
| 1440 | Ga0501280_000632 | |||
| 1441 | Ga0501035_0186598 | |||
| 1442 | Ga0501044_0080680 | |||
| 1443 | Ga0501284_00002 | |||
| 1444 | nmdc:mga0k408_497_c1 | |||
| 1445 | nmdc:mga0k408_7085_c1 | |||
| 1446 | nmdc:mga08y16_99331_c1 | |||
| 1447 | Ga0500578_0000029 | |||
| 1448 | Ga0500578_0021871 | |||
| 1449 | Ga0500644_0000071 | |||
| 1450 | Ga0500644_0000155 | |||
| 1451 | Ga0500644_0001116 | |||
| 1452 | Ga0500644_0001528 | |||
| 1453 | Ga0500644_0006229 | |||
| 1454 | Ga0500583_0000053 | |||
| 1455 | Ga0500651_0011345 | |||
| 1456 | Ga0500651_0049750 | |||
| 1457 | Ga0500641_0000020 | |||
| 1458 | Ga0500641_0000025 | |||
| 1459 | Ga0500641_0000553 | |||
| 1460 | Ga0500641_0001693 | |||
| 1461 | Ga0500562_000029 | |||
| 1462 | Ga0500569_012683 | |||
| 1463 | Ga0500618_000073 | |||
| 1464 | Ga0500618_006949 | |||
| 1465 | Ga0500652_005048 | |||
| 1466 | Ga0500652_014800 | |||
| 1467 | Ga0500658_0000010 | |||
| 1468 | Ga0500658_0000895 | |||
| 1469 | Ga0500568_0046215 | |||
| 1470 | Ga0500577_0001383 | |||
| 1471 | Ga0500577_0001852 | |||
| 1472 | Ga0500616_0000044 | |||
| 1473 | Ga0500616_0031602 | |||
| 1474 | Ga0500622_0000304 | |||
| 1475 | Ga0500622_0000305 | |||
| 1476 | Ga0500622_0001510 | |||
| 1477 | Ga0500622_0003237 | |||
| 1478 | Ga0500624_000231 | |||
| 1479 | Ga0500633_0003732 | |||
| 1480 | Ga0500633_0015264 | |||
| 1481 | Ga0466962_0058894 | |||
| 1482 | 2513232265 | |||
| 1483 | 2520881906 | |||
| 1484 | 2599478882 | |||
| 1485 | 2644009813 | |||
| 1486 | 2644369742 | |||
| 1487 | 2644374230 | |||
| 1488 | 2644640559 | |||
| 1489 | 2644683704 | |||
| 1490 | 2722729286 | |||
| 1491 | 2738698586 | |||
| 1492 | 2738733205 | |||
| 1493 | 2738733289 | |||
| 1494 | 2738754220 | |||
| 1495 | 2738765743 | |||
| 1496 | 2738765827 | |||
| 1497 | 2739214786 | |||
| 1498 | 2739214870 | |||
| 1499 | 2739252912 | |||
| 1500 | 2740002472 | |||
| 1501 | 2740007288 | |||
| 1502 | 2740032287 | |||
| 1503 | 2802652409 | |||
| 1504 | 2817417410 | |||
| 1505 | 2819578119 | |||
| 1506 | 2819588678 | |||
| 1507 | 2819682133 | |||
| 1508 | 2821139235 | |||
| 1509 | 2840677970 | |||
| 1510 | 2857615883 | |||
| 1511 | 2857620372 | |||
| 1512 | 2881250788 | |||
| 1513 | 2881362653 | |||
| 1514 | 2883070862 | |||
| 1515 | 2884795105 | |||
| 1516 | 2896085787 | |||
| 1517 | 2896114037 | |||
| 1518 | 2898715959 | |||
| 1519 | 2903897856 | |||
| 1520 | 2904422078 | |||
| 1521 | 2904473200 | |||
| 1522 | 2904559086 | |||
| 1523 | 2904780961 | |||
| 1524 | 2911138966 | |||
| 1525 | 2919180575 | |||
| 1526 | 2919192114 | |||
| 1527 | 2919438673 | |||
| 1528 | 2919511724 | |||
| 1529 | 2919686032 | |||
| 1530 | 2928082892 | |||
| 1531 | 2928149910 | |||
| 1532 | 2929154674 | |||
| 1533 | 2929157637 | |||
| 1534 | 2929182520 | |||
| 1535 | 2929242294 | |||
| 1536 | 2929244161 | |||
| 1537 | 2929922266 | |||
| 1538 | 2929925867 | |||
| 1539 | 2932086213 | |||
| 1540 | 2945978445 | |||
| 1541 | 2946015691 | |||
| 1542 | 2958459085 | |||
| 1543 | 2958512674 | |||
| 1544 | 2965320533 | |||
| 1545 | 2965323318 | |||
| 1546 | 2977271507 | |||
| 1547 | 8003154777 | |||
| 1548 | 8054310538 | |||
| 1549 | 8055423034 | |||
| 1550 | 8055596614 | |||
| 1551 | 8056442064 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7y58-assembly1.cif.gz_A | cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus | 0.8566 | 1 | 514 |
| 7d5q-assembly2.cif.gz_B | structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody | 0.8463 | 19 | 509 |
| 7d5q-assembly1.cif.gz_A | structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody | 0.8434 | 19 | 509 |
| 7y58-assembly1.cif.gz_A | cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus | 0.8376 | 1 | 514 |
| 7d5q-assembly2.cif.gz_B | structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody | 0.8352 | 19 | 509 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WG85_29_254_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.962 | 21 | 248 | 1.20.1250.20 |
| af_Q04301_34_211_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9543 | 18 | 194 | 1.20.1250.20 |
| af_P36554_12_217_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9506 | 23 | 228 | 1.20.1250.20 |
| af_P9WG87_21_208_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9505 | 23 | 211 | 1.20.1250.20 |
| af_P9WG85_29_254_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9496 | 21 | 248 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7LDE2-F1-model_v4 | Multidrug efflux MFS transporter | 0.9782 | 15 | 175 |
GO:0005886
GO:0022857 |
| AF-A0A3S1U0X0-F1-model_v4 | MFS transporter | 0.9632 | 26 | 162 |
GO:0005886
GO:0022857 |
| AF-A0A422LRI7-F1-model_v4 | 4-hydroxybenzoate transporter PcaK | 0.9539 | 34 | 124 |
GO:0005886
GO:0022857 |
| AF-A0A3S1U0X0-F1-model_v4 | MFS transporter | 0.9431 | 26 | 162 |
GO:0005886
GO:0022857 |
| AF-A0A425BL68-F1-model_v4 | deleted | 0.9418 | 13 | 124 |
|