F480309
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 776 | 350 | 1552 | 130 |
Family's Representative Sequence
| Representative Sequence | 3300013100|Ga0157373_10106587|Ga0157373_101065872 |
| Length | 153 |
| Sequence | MFEKIFVFFTQYNFMAKSKQKITQVNKDILAYNETLPPSYKEIGNLLYNEISRSLPEAENKIWHAHPVWFLNGNPVVGYSKLKDAVRLLFWSGQSFDEPGLQPEGSFKAAEARYTSAEQVKTKDVKRWLEKSKKIQWDYKNIVKRKGVLERLM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 70 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 82 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 97 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013874 | Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 178 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 184 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 186 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 187 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 188 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 190 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 193 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 196 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 200 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 201 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 207 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 208 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 210 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 211 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 212 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 213 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 214 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 219 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 220 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 221 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 222 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 223 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 224 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 225 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 226 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 227 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 228 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 229 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 230 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 248 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 249 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 250 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 251 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 252 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 253 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 254 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 255 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 256 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 278 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 279 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 284 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 285 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 286 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 287 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 290 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 291 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 292 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 299 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 300 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 301 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 302 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 303 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 304 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 305 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 306 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 307 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 308 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 309 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 310 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 311 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 312 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 313 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 314 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 315 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 316 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 319 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 320 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 321 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 322 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 323 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 324 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 325 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 326 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 327 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 328 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 329 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 330 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 331 | 2786546517 | Verrucomicrobia bacterium LW23 | Isolate | Rhizoplane |
| 332 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 333 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 334 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 335 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 336 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 337 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 338 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 339 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 340 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 341 | 2919509842 | Flavobacterium arsenatis 3773 | Isolate | Unclassified |
| 342 | 2919688452 | Pararheinheimera soli 4138 | Isolate | Unclassified |
| 343 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 344 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 345 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 346 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 347 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 348 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 349 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 350 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.88 |
| Metatranscriptomes | 0 |
| Isolates | 4.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.47 |
| Nodule | 0.52 |
| Rhizoplane | 1.16 |
| Rhizosphere | 84.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157373_10106587 | 3300013100 | Bacteria | 1970 |
| 2 | ARcpr5yngRDRAFT_c004230 | 3300000043 | Bacteria | 1364 |
| 3 | JGI24739J22299_10002038 | 3300001989 | Bacteria | 7741 |
| 4 | JGI25158J39367_1012611 | 3300002739 | Bacteria | 1113 |
| 5 | JGI25153J46596_10015700 | 3300003215 | Bacteria | 3070 |
| 6 | JGI25153J46596_10019196 | 3300003215 | Bacteria | 2626 |
| 7 | rootH1_10103492 | 3300003316 | Eukaryota | 1722 |
| 8 | rootL2_10104087 | 3300003322 | Bacteria | 2177 |
| 9 | rootL2_10105973 | 3300003322 | Bacteria | 1953 |
| 10 | rootL2_10119672 | 3300003322 | Bacteria | 1305 |
| 11 | rootL2_10158095 | 3300003322 | Bacteria | 2265 |
| 12 | rootH1_10079681 | 3300003323 | Unclassified | 1773 |
| 13 | rootH1_10347417 | 3300003323 | Bacteria | 1183 |
| 14 | JGI25160J50197_1007932 | 3300003354 | Bacteria | 4091 |
| 15 | Ga0055526_1010199 | 3300003771 | Bacteria | 4402 |
| 16 | Ga0055531_10000198 | 3300003794 | Bacteria | 66737 |
| 17 | Ga0065712_10106611 | 3300005290 | Bacteria | 1913 |
| 18 | Ga0070676_10019445 | 3300005328 | Bacteria | 3779 |
| 19 | Ga0070676_10167147 | 3300005328 | Unclassified | 1420 |
| 20 | Ga0070683_100006379 | 3300005329 | Bacteria | 9892 |
| 21 | Ga0070683_100016678 | 3300005329 | Bacteria | 6480 |
| 22 | Ga0070683_100059315 | 3300005329 | Bacteria | 3555 |
| 23 | Ga0070683_100159745 | 3300005329 | Bacteria | 2138 |
| 24 | Ga0070683_100314924 | 3300005329 | Bacteria | 1489 |
| 25 | Ga0070683_100482193 | 3300005329 | Bacteria | 1184 |
| 26 | Ga0070683_100866581 | 3300005329 | Bacteria | 866 |
| 27 | Ga0070690_100083176 | 3300005330 | Unclassified | 2097 |
| 28 | Ga0070690_100084555 | 3300005330 | Unclassified | 2080 |
| 29 | Ga0070690_100182641 | 3300005330 | Bacteria | 1450 |
| 30 | Ga0070690_100325291 | 3300005330 | Bacteria | 1109 |
| 31 | Ga0070690_100326847 | 3300005330 | Bacteria | 1107 |
| 32 | Ga0070677_10822660 | 3300005333 | Bacteria | 532 |
| 33 | Ga0068869_100012359 | 3300005334 | Bacteria | 5642 |
| 34 | Ga0068869_100106101 | 3300005334 | Unclassified | 2131 |
| 35 | Ga0068869_100210369 | 3300005334 | Bacteria | 1537 |
| 36 | Ga0068869_101887554 | 3300005334 | Bacteria | 535 |
| 37 | Ga0070666_10017465 | 3300005335 | Bacteria | 4600 |
| 38 | Ga0070666_10330248 | 3300005335 | Bacteria | 1089 |
| 39 | Ga0070666_10546448 | 3300005335 | Bacteria | 842 |
| 40 | Ga0070666_10781377 | 3300005335 | Unclassified | 703 |
| 41 | Ga0070666_11099765 | 3300005335 | Bacteria | 591 |
| 42 | Ga0070680_100782161 | 3300005336 | Bacteria | 822 |
| 43 | Ga0070682_100187710 | 3300005337 | Bacteria | 1449 |
| 44 | Ga0070682_100204344 | 3300005337 | Bacteria | 1395 |
| 45 | Ga0068868_100002169 | 3300005338 | Bacteria | 13537 |
| 46 | Ga0068868_100023827 | 3300005338 | Bacteria | 4636 |
| 47 | Ga0068868_100080731 | 3300005338 | Unclassified | 2607 |
| 48 | Ga0068868_100148690 | 3300005338 | Bacteria | 1928 |
| 49 | Ga0068868_100713010 | 3300005338 | Bacteria | 898 |
| 50 | Ga0070689_100041733 | 3300005340 | Unclassified | 3521 |
| 51 | Ga0070689_100073368 | 3300005340 | Bacteria | 2676 |
| 52 | Ga0070689_100091049 | 3300005340 | Bacteria | 2404 |
| 53 | Ga0070689_100301642 | 3300005340 | Bacteria | 1333 |
| 54 | Ga0070689_100884844 | 3300005340 | Bacteria | 789 |
| 55 | Ga0070687_100119449 | 3300005343 | Bacteria | 1505 |
| 56 | Ga0070687_101224015 | 3300005343 | Unclassified | 554 |
| 57 | Ga0070661_100016114 | 3300005344 | Bacteria | 5276 |
| 58 | Ga0070661_100090324 | 3300005344 | Bacteria | 2268 |
| 59 | Ga0070668_100061129 | 3300005347 | Bacteria | 2918 |
| 60 | Ga0070668_100300872 | 3300005347 | Bacteria | 1345 |
| 61 | Ga0070668_100906050 | 3300005347 | Unclassified | 788 |
| 62 | Ga0070669_100087000 | 3300005353 | Bacteria | 2336 |
| 63 | Ga0070669_100209378 | 3300005353 | Bacteria | 1537 |
| 64 | Ga0070669_100344017 | 3300005353 | Bacteria | 1209 |
| 65 | Ga0070669_100532123 | 3300005353 | Bacteria | 978 |
| 66 | Ga0070675_100013847 | 3300005354 | Bacteria | 6350 |
| 67 | Ga0070675_100643818 | 3300005354 | Bacteria | 963 |
| 68 | Ga0070675_101999431 | 3300005354 | Unclassified | 534 |
| 69 | Ga0070671_100081905 | 3300005355 | Unclassified | 2698 |
| 70 | Ga0070671_100093118 | 3300005355 | Unclassified | 2525 |
| 71 | Ga0070671_100119075 | 3300005355 | Bacteria | 2221 |
| 72 | Ga0070671_100562148 | 3300005355 | Bacteria | 984 |
| 73 | Ga0070674_100216534 | 3300005356 | Bacteria | 1488 |
| 74 | Ga0070674_100575762 | 3300005356 | Bacteria | 948 |
| 75 | Ga0070673_100045506 | 3300005364 | Bacteria | 3404 |
| 76 | Ga0070673_100051448 | 3300005364 | Unclassified | 3226 |
| 77 | Ga0070688_100004273 | 3300005365 | Bacteria | 7424 |
| 78 | Ga0070688_100369908 | 3300005365 | Bacteria | 1054 |
| 79 | Ga0070688_100553745 | 3300005365 | Bacteria | 875 |
| 80 | Ga0070688_101294561 | 3300005365 | Bacteria | 588 |
| 81 | Ga0070659_100003088 | 3300005366 | Bacteria | 11836 |
| 82 | Ga0070659_100214647 | 3300005366 | Bacteria | 1586 |
| 83 | Ga0070659_100270364 | 3300005366 | Unclassified | 1412 |
| 84 | Ga0070659_100327987 | 3300005366 | Bacteria | 1280 |
| 85 | Ga0070667_100376109 | 3300005367 | Bacteria | 1290 |
| 86 | Ga0070667_100472833 | 3300005367 | Bacteria | 1147 |
| 87 | Ga0070667_100742586 | 3300005367 | Bacteria | 909 |
| 88 | Ga0070667_100867715 | 3300005367 | Unclassified | 839 |
| 89 | Ga0070713_101435857 | 3300005436 | Bacteria | 669 |
| 90 | Ga0070701_10014865 | 3300005438 | Bacteria | 3578 |
| 91 | Ga0070701_10770683 | 3300005438 | Unclassified | 653 |
| 92 | Ga0070711_100013432 | 3300005439 | Bacteria | 5144 |
| 93 | Ga0070700_101059141 | 3300005441 | Bacteria | 670 |
| 94 | Ga0070694_101602466 | 3300005444 | Bacteria | 552 |
| 95 | Ga0070663_100312784 | 3300005455 | Unclassified | 1261 |
| 96 | Ga0070663_100481650 | 3300005455 | Bacteria | 1027 |
| 97 | Ga0070663_100498951 | 3300005455 | Bacteria | 1010 |
| 98 | Ga0070678_100084777 | 3300005456 | Unclassified | 2413 |
| 99 | Ga0070678_100672540 | 3300005456 | Bacteria | 930 |
| 100 | Ga0070662_100109004 | 3300005457 | Bacteria | 2106 |
| 101 | Ga0070662_100331882 | 3300005457 | Bacteria | 1243 |
| 102 | Ga0070662_100401930 | 3300005457 | Bacteria | 1131 |
| 103 | Ga0070662_100454018 | 3300005457 | Unclassified | 1064 |
| 104 | Ga0070662_101439311 | 3300005457 | Unclassified | 594 |
| 105 | Ga0070662_101458647 | 3300005457 | Bacteria | 590 |
| 106 | Ga0070681_10049698 | 3300005458 | Bacteria | 4187 |
| 107 | Ga0070681_10343751 | 3300005458 | Bacteria | 1402 |
| 108 | Ga0068867_100024456 | 3300005459 | Bacteria | 4328 |
| 109 | Ga0068867_100509901 | 3300005459 | Bacteria | 1035 |
| 110 | Ga0068867_100641219 | 3300005459 | Bacteria | 931 |
| 111 | Ga0068867_101003731 | 3300005459 | Bacteria | 757 |
| 112 | Ga0068867_101347319 | 3300005459 | Bacteria | 660 |
| 113 | Ga0070685_10046768 | 3300005466 | Unclassified | 2485 |
| 114 | Ga0070685_10284767 | 3300005466 | Unclassified | 1108 |
| 115 | Ga0070698_100014985 | 3300005471 | Bacteria | 8195 |
| 116 | Ga0070698_102018695 | 3300005471 | Bacteria | 530 |
| 117 | Ga0070699_100268874 | 3300005518 | Bacteria | 1525 |
| 118 | Ga0070679_100116762 | 3300005530 | Bacteria | 2653 |
| 119 | Ga0070684_100001466 | 3300005535 | Bacteria | 17035 |
| 120 | Ga0070684_100021811 | 3300005535 | Bacteria | 5334 |
| 121 | Ga0070684_100086213 | 3300005535 | Bacteria | 2786 |
| 122 | Ga0070684_100143719 | 3300005535 | Unclassified | 2159 |
| 123 | Ga0070684_100641464 | 3300005535 | Bacteria | 988 |
| 124 | Ga0068853_100003944 | 3300005539 | Bacteria | 11396 |
| 125 | Ga0068853_100005794 | 3300005539 | Bacteria | 9732 |
| 126 | Ga0068853_100026313 | 3300005539 | Bacteria | 4885 |
| 127 | Ga0068853_100331602 | 3300005539 | Bacteria | 1412 |
| 128 | Ga0068853_102051936 | 3300005539 | Bacteria | 554 |
| 129 | Ga0068853_102487444 | 3300005539 | Bacteria | 501 |
| 130 | Ga0070672_100119647 | 3300005543 | Bacteria | 2155 |
| 131 | Ga0070672_100242177 | 3300005543 | Bacteria | 1517 |
| 132 | Ga0070672_100323824 | 3300005543 | Unclassified | 1310 |
| 133 | Ga0070672_102064323 | 3300005543 | Unclassified | 514 |
| 134 | Ga0070686_100041186 | 3300005544 | Unclassified | 2886 |
| 135 | Ga0070686_100277074 | 3300005544 | Bacteria | 1235 |
| 136 | Ga0070665_100000093 | 3300005548 | Bacteria | 173153 |
| 137 | Ga0070665_100417419 | 3300005548 | Unclassified | 1350 |
| 138 | Ga0070664_100004395 | 3300005564 | Bacteria | 11319 |
| 139 | Ga0070664_100005000 | 3300005564 | Bacteria | 10622 |
| 140 | Ga0068857_100037682 | 3300005577 | Unclassified | 4283 |
| 141 | Ga0068857_100054783 | 3300005577 | Bacteria | 3540 |
| 142 | Ga0068857_100144206 | 3300005577 | Bacteria | 2154 |
| 143 | Ga0068857_100176185 | 3300005577 | Bacteria | 1945 |
| 144 | Ga0068857_100760168 | 3300005577 | Unclassified | 923 |
| 145 | Ga0068854_100195424 | 3300005578 | Bacteria | 1587 |
| 146 | Ga0068854_100281775 | 3300005578 | Bacteria | 1339 |
| 147 | Ga0068854_101447579 | 3300005578 | Bacteria | 622 |
| 148 | Ga0068854_101547216 | 3300005578 | Unclassified | 603 |
| 149 | Ga0068856_100016755 | 3300005614 | Bacteria | 7099 |
| 150 | Ga0068856_100088141 | 3300005614 | Bacteria | 3085 |
| 151 | Ga0068852_100019269 | 3300005616 | Bacteria | 5395 |
| 152 | Ga0068852_100564730 | 3300005616 | Bacteria | 1139 |
| 153 | Ga0068859_100037001 | 3300005617 | Bacteria | 4899 |
| 154 | Ga0068859_100037557 | 3300005617 | Bacteria | 4861 |
| 155 | Ga0068859_100096370 | 3300005617 | Bacteria | 3011 |
| 156 | Ga0068859_100599145 | 3300005617 | Bacteria | 1195 |
| 157 | Ga0068859_100729250 | 3300005617 | Bacteria | 1081 |
| 158 | Ga0068859_101461808 | 3300005617 | Unclassified | 754 |
| 159 | Ga0068864_100003839 | 3300005618 | Bacteria | 12389 |
| 160 | Ga0068864_100585376 | 3300005618 | Bacteria | 1082 |
| 161 | Ga0068864_100695572 | 3300005618 | Bacteria | 993 |
| 162 | Ga0068864_102149569 | 3300005618 | Bacteria | 565 |
| 163 | Ga0068866_10002365 | 3300005718 | Bacteria | 7824 |
| 164 | Ga0068866_10067909 | 3300005718 | Bacteria | 1873 |
| 165 | Ga0068866_10219631 | 3300005718 | Bacteria | 1146 |
| 166 | Ga0068866_10851881 | 3300005718 | Unclassified | 637 |
| 167 | Ga0068861_100027092 | 3300005719 | Bacteria | 4171 |
| 168 | Ga0068861_100081668 | 3300005719 | Bacteria | 2531 |
| 169 | Ga0068861_100339172 | 3300005719 | Unclassified | 1315 |
| 170 | Ga0068861_100983836 | 3300005719 | Bacteria | 804 |
| 171 | Ga0068861_102436635 | 3300005719 | Unclassified | 526 |
| 172 | Ga0068851_10000107 | 3300005834 | Bacteria | 44477 |
| 173 | Ga0068851_10046249 | 3300005834 | Unclassified | 2201 |
| 174 | Ga0068851_10048862 | 3300005834 | Bacteria | 2145 |
| 175 | Ga0068863_100164825 | 3300005841 | Bacteria | 2125 |
| 176 | Ga0068863_100709277 | 3300005841 | Bacteria | 1000 |
| 177 | Ga0068858_100253238 | 3300005842 | Unclassified | 1673 |
| 178 | Ga0068858_100638106 | 3300005842 | Bacteria | 1035 |
| 179 | Ga0068858_101326699 | 3300005842 | Bacteria | 708 |
| 180 | Ga0068858_101472542 | 3300005842 | Unclassified | 671 |
| 181 | Ga0068860_100001707 | 3300005843 | Bacteria | 23468 |
| 182 | Ga0068860_100071637 | 3300005843 | Bacteria | 3293 |
| 183 | Ga0068860_100071679 | 3300005843 | Bacteria | 3292 |
| 184 | Ga0068860_100499234 | 3300005843 | Bacteria | 1215 |
| 185 | Ga0068860_100676314 | 3300005843 | Bacteria | 1041 |
| 186 | Ga0068860_100967656 | 3300005843 | Bacteria | 868 |
| 187 | Ga0068860_102482966 | 3300005843 | Bacteria | 538 |
| 188 | Ga0068862_100156272 | 3300005844 | Unclassified | 2033 |
| 189 | Ga0068862_100162205 | 3300005844 | Bacteria | 1996 |
| 190 | Ga0068862_100197255 | 3300005844 | Bacteria | 1814 |
| 191 | Ga0075365_10239562 | 3300006038 | Unclassified | 1274 |
| 192 | Ga0075364_10001124 | 3300006051 | Bacteria | 14283 |
| 193 | Ga0075364_10170367 | 3300006051 | Bacteria | 1472 |
| 194 | Ga0075364_10657882 | 3300006051 | Unclassified | 715 |
| 195 | Ga0075369_10088842 | 3300006186 | Bacteria | 1377 |
| 196 | Ga0075366_10099140 | 3300006195 | Unclassified | 1748 |
| 197 | Ga0075366_10171835 | 3300006195 | Bacteria | 1315 |
| 198 | Ga0097621_100009919 | 3300006237 | Bacteria | 6938 |
| 199 | Ga0097621_100066221 | 3300006237 | Unclassified | 2975 |
| 200 | Ga0068871_100014830 | 3300006358 | Bacteria | 5821 |
| 201 | Ga0068871_100654884 | 3300006358 | Bacteria | 959 |
| 202 | Ga0068871_101415042 | 3300006358 | Bacteria | 656 |
| 203 | Ga0075428_100158926 | 3300006844 | Bacteria | 2453 |
| 204 | Ga0075431_100661251 | 3300006847 | Bacteria | 1025 |
| 205 | Ga0075433_10611409 | 3300006852 | Bacteria | 957 |
| 206 | Ga0075434_100336849 | 3300006871 | Bacteria | 1529 |
| 207 | Ga0075434_100966708 | 3300006871 | Unclassified | 866 |
| 208 | Ga0075434_102631977 | 3300006871 | Bacteria | 503 |
| 209 | Ga0075429_100911229 | 3300006880 | Bacteria | 769 |
| 210 | Ga0068865_100102867 | 3300006881 | Unclassified | 2094 |
| 211 | Ga0068865_100151860 | 3300006881 | Bacteria | 1758 |
| 212 | Ga0068865_100271068 | 3300006881 | Bacteria | 1348 |
| 213 | Ga0068865_100504537 | 3300006881 | Bacteria | 1009 |
| 214 | Ga0075436_100406222 | 3300006914 | Bacteria | 987 |
| 215 | Ga0097620_100037002 | 3300006931 | Bacteria | 4899 |
| 216 | Ga0097620_100037557 | 3300006931 | Bacteria | 4861 |
| 217 | Ga0097620_100096370 | 3300006931 | Bacteria | 3011 |
| 218 | Ga0097620_100599218 | 3300006931 | Bacteria | 1195 |
| 219 | Ga0097620_100729334 | 3300006931 | Bacteria | 1081 |
| 220 | Ga0097620_101461444 | 3300006931 | Unclassified | 754 |
| 221 | Ga0099824_1000985 | 3300006942 | Bacteria | 38209 |
| 222 | Ga0099826_10011055 | 3300006948 | Bacteria | 6786 |
| 223 | Ga0075435_101117114 | 3300007076 | Bacteria | 689 |
| 224 | Ga0105251_10126907 | 3300009011 | Bacteria | 1158 |
| 225 | Ga0105244_10000002 | 3300009036 | Bacteria | 495554 |
| 226 | Ga0105240_11033273 | 3300009093 | Bacteria | 877 |
| 227 | Ga0111539_10274661 | 3300009094 | Unclassified | 1961 |
| 228 | Ga0111539_10737312 | 3300009094 | Unclassified | 1147 |
| 229 | Ga0111539_10804592 | 3300009094 | Bacteria | 1094 |
| 230 | Ga0111539_11785608 | 3300009094 | Unclassified | 713 |
| 231 | Ga0111539_13161590 | 3300009094 | Bacteria | 531 |
| 232 | Ga0105245_10039235 | 3300009098 | Bacteria | 4215 |
| 233 | Ga0105247_10126684 | 3300009101 | Bacteria | 1660 |
| 234 | Ga0105247_10333136 | 3300009101 | Bacteria | 1062 |
| 235 | Ga0114129_10019457 | 3300009147 | Bacteria | 9666 |
| 236 | Ga0114129_11024080 | 3300009147 | Bacteria | 1038 |
| 237 | Ga0105241_10735341 | 3300009174 | Bacteria | 903 |
| 238 | Ga0105241_10881380 | 3300009174 | Bacteria | 830 |
| 239 | Ga0105241_11164503 | 3300009174 | Unclassified | 729 |
| 240 | Ga0105241_11622058 | 3300009174 | Unclassified | 626 |
| 241 | Ga0105242_10020009 | 3300009176 | Bacteria | 5245 |
| 242 | Ga0105242_10562664 | 3300009176 | Unclassified | 1095 |
| 243 | Ga0105242_10867910 | 3300009176 | Bacteria | 899 |
| 244 | Ga0105242_11415276 | 3300009176 | Bacteria | 723 |
| 245 | Ga0105242_11552995 | 3300009176 | Unclassified | 694 |
| 246 | Ga0105242_12917390 | 3300009176 | Bacteria | 529 |
| 247 | Ga0105248_10210070 | 3300009177 | Unclassified | 2193 |
| 248 | Ga0105248_11399140 | 3300009177 | Bacteria | 791 |
| 249 | Ga0105248_11469838 | 3300009177 | Bacteria | 771 |
| 250 | Ga0105248_12442562 | 3300009177 | Bacteria | 595 |
| 251 | Ga0105237_10516039 | 3300009545 | Bacteria | 1202 |
| 252 | Ga0105237_10794951 | 3300009545 | Unclassified | 953 |
| 253 | Ga0105237_11609407 | 3300009545 | Unclassified | 656 |
| 254 | Ga0105249_10285576 | 3300009553 | Unclassified | 1650 |
| 255 | Ga0105249_10309758 | 3300009553 | Unclassified | 1587 |
| 256 | Ga0105249_10465296 | 3300009553 | Bacteria | 1305 |
| 257 | Ga0105249_10548580 | 3300009553 | Bacteria | 1206 |
| 258 | Ga0105249_10966506 | 3300009553 | Bacteria | 920 |
| 259 | Ga0105249_11804425 | 3300009553 | Bacteria | 684 |
| 260 | Ga0105249_12059939 | 3300009553 | Unclassified | 643 |
| 261 | Ga0105030_103579 | 3300009987 | Bacteria | 1337 |
| 262 | Ga0105028_102950 | 3300009993 | Bacteria | 1783 |
| 263 | Ga0105239_10012803 | 3300010375 | Bacteria | 9332 |
| 264 | Ga0105239_10174399 | 3300010375 | Bacteria | 2405 |
| 265 | Ga0105239_10199086 | 3300010375 | Unclassified | 2244 |
| 266 | Ga0105239_10402406 | 3300010375 | Bacteria | 1549 |
| 267 | Ga0105239_10655231 | 3300010375 | Bacteria | 1199 |
| 268 | Ga0105239_10725687 | 3300010375 | Bacteria | 1137 |
| 269 | Ga0105239_11186955 | 3300010375 | Bacteria | 879 |
| 270 | Ga0105239_12296783 | 3300010375 | Bacteria | 628 |
| 271 | Ga0105246_10499363 | 3300011119 | Bacteria | 1033 |
| 272 | Ga0157373_10000001 | 3300013100 | Bacteria | 864756 |
| 273 | Ga0157373_10033673 | 3300013100 | Bacteria | 3684 |
| 274 | Ga0157373_10640601 | 3300013100 | Bacteria | 776 |
| 275 | Ga0157373_11514959 | 3300013100 | Unclassified | 512 |
| 276 | Ga0157371_10122289 | 3300013102 | Bacteria | 1851 |
| 277 | Ga0157371_10273584 | 3300013102 | Bacteria | 1219 |
| 278 | Ga0157371_10527442 | 3300013102 | Bacteria | 874 |
| 279 | Ga0157370_10000489 | 3300013104 | Bacteria | 49302 |
| 280 | Ga0157370_10001280 | 3300013104 | Bacteria | 31419 |
| 281 | Ga0157370_10071002 | 3300013104 | Bacteria | 3286 |
| 282 | Ga0157370_11011941 | 3300013104 | Bacteria | 752 |
| 283 | Ga0157370_11763754 | 3300013104 | Bacteria | 556 |
| 284 | Ga0157369_10054684 | 3300013105 | Bacteria | 4310 |
| 285 | Ga0157369_12591628 | 3300013105 | Bacteria | 513 |
| 286 | Ga0157374_10000002 | 3300013296 | Bacteria | 1054226 |
| 287 | Ga0157374_10009412 | 3300013296 | Bacteria | 8385 |
| 288 | Ga0157374_10025109 | 3300013296 | Bacteria | 5345 |
| 289 | Ga0157374_10029675 | 3300013296 | Bacteria | 4957 |
| 290 | Ga0157374_10114510 | 3300013296 | Bacteria | 2596 |
| 291 | Ga0157374_10669842 | 3300013296 | Bacteria | 1050 |
| 292 | Ga0157374_12771913 | 3300013296 | Bacteria | 518 |
| 293 | Ga0157378_10002639 | 3300013297 | Bacteria | 15981 |
| 294 | Ga0157378_10008109 | 3300013297 | Bacteria | 9165 |
| 295 | Ga0157378_10044506 | 3300013297 | Bacteria | 3942 |
| 296 | Ga0157378_10058138 | 3300013297 | Bacteria | 3448 |
| 297 | Ga0157378_10142346 | 3300013297 | Bacteria | 2228 |
| 298 | Ga0157378_10363768 | 3300013297 | Bacteria | 1416 |
| 299 | Ga0157378_10758992 | 3300013297 | Unclassified | 993 |
| 300 | Ga0163162_10000254 | 3300013306 | Bacteria | 48422 |
| 301 | Ga0163162_10007176 | 3300013306 | Bacteria | 10819 |
| 302 | Ga0163162_10008484 | 3300013306 | Bacteria | 10025 |
| 303 | Ga0163162_10009840 | 3300013306 | Bacteria | 9302 |
| 304 | Ga0163162_10223918 | 3300013306 | Bacteria | 2011 |
| 305 | Ga0163162_10886185 | 3300013306 | Unclassified | 1006 |
| 306 | Ga0157372_10007573 | 3300013307 | Bacteria | 11545 |
| 307 | Ga0157372_10104222 | 3300013307 | Bacteria | 3242 |
| 308 | Ga0157372_10161952 | 3300013307 | Bacteria | 2586 |
| 309 | Ga0157372_10281114 | 3300013307 | Bacteria | 1935 |
| 310 | Ga0157372_10732963 | 3300013307 | Bacteria | 1149 |
| 311 | Ga0157372_11282640 | 3300013307 | Bacteria | 845 |
| 312 | Ga0157372_11933268 | 3300013307 | Bacteria | 678 |
| 313 | Ga0157375_10024352 | 3300013308 | Bacteria | 5601 |
| 314 | Ga0157375_10036428 | 3300013308 | Bacteria | 4706 |
| 315 | Ga0157375_10129687 | 3300013308 | Bacteria | 2640 |
| 316 | Ga0157375_10175685 | 3300013308 | Bacteria | 2291 |
| 317 | Ga0157375_10361940 | 3300013308 | Bacteria | 1617 |
| 318 | Ga0157375_10556304 | 3300013308 | Bacteria | 1309 |
| 319 | Ga0157375_11839703 | 3300013308 | Unclassified | 718 |
| 320 | Ga0157514_124540 | 3300013874 | Unclassified | 516 |
| 321 | Ga0163163_10000982 | 3300014325 | Bacteria | 24199 |
| 322 | Ga0163163_10211146 | 3300014325 | Bacteria | 1990 |
| 323 | Ga0163163_10961520 | 3300014325 | Unclassified | 917 |
| 324 | Ga0163163_11038910 | 3300014325 | Bacteria | 883 |
| 325 | Ga0157380_10001909 | 3300014326 | Bacteria | 13834 |
| 326 | Ga0157380_10353377 | 3300014326 | Unclassified | 1376 |
| 327 | Ga0157380_10613928 | 3300014326 | Bacteria | 1078 |
| 328 | Ga0157380_10678969 | 3300014326 | Bacteria | 1032 |
| 329 | Ga0157380_11245544 | 3300014326 | Bacteria | 789 |
| 330 | Ga0157380_13271170 | 3300014326 | Bacteria | 518 |
| 331 | Ga0157377_10003474 | 3300014745 | Bacteria | 7141 |
| 332 | Ga0157377_10007460 | 3300014745 | Bacteria | 5283 |
| 333 | Ga0157379_10051108 | 3300014968 | Bacteria | 3692 |
| 334 | Ga0157379_10403400 | 3300014968 | Bacteria | 1257 |
| 335 | Ga0157379_10768322 | 3300014968 | Bacteria | 908 |
| 336 | Ga0157376_10007019 | 3300014969 | Bacteria | 7994 |
| 337 | Ga0157376_10345503 | 3300014969 | Bacteria | 1422 |
| 338 | Ga0182006_1001457 | 3300015261 | Bacteria | 14254 |
| 339 | Ga0182006_1030786 | 3300015261 | Bacteria | 2166 |
| 340 | Ga0182006_1030872 | 3300015261 | Bacteria | 2163 |
| 341 | Ga0163161_10213813 | 3300017792 | Bacteria | 1490 |
| 342 | Ga0163161_10388803 | 3300017792 | Unclassified | 1116 |
| 343 | Ga0209436_100584 | 3300025208 | Bacteria | 15640 |
| 344 | Ga0209130_1002010 | 3300025284 | Bacteria | 11082 |
| 345 | Ga0209564_1001302 | 3300025295 | Bacteria | 26894 |
| 346 | Ga0209758_1000465 | 3300025297 | Bacteria | 67058 |
| 347 | Ga0209758_1004804 | 3300025297 | Bacteria | 10915 |
| 348 | Ga0207426_1000002 | 3300025302 | Bacteria | 1249660 |
| 349 | Ga0207426_1000148 | 3300025302 | Bacteria | 190030 |
| 350 | Ga0207426_1007198 | 3300025302 | Bacteria | 4692 |
| 351 | Ga0209257_1000008 | 3300025304 | Bacteria | 1294570 |
| 352 | Ga0207697_10244352 | 3300025315 | Unclassified | 793 |
| 353 | Ga0207656_10000280 | 3300025321 | Bacteria | 17571 |
| 354 | Ga0207655_1000012 | 3300025728 | Bacteria | 640488 |
| 355 | Ga0207713_1082415 | 3300025735 | Bacteria | 1153 |
| 356 | Ga0207642_10182088 | 3300025899 | Bacteria | 1146 |
| 357 | Ga0207642_10188122 | 3300025899 | Bacteria | 1131 |
| 358 | Ga0207688_10019324 | 3300025901 | Bacteria | 3710 |
| 359 | Ga0207680_10042960 | 3300025903 | Bacteria | 2648 |
| 360 | Ga0207680_10676067 | 3300025903 | Bacteria | 740 |
| 361 | Ga0207680_10698111 | 3300025903 | Unclassified | 727 |
| 362 | Ga0207647_10088385 | 3300025904 | Bacteria | 1851 |
| 363 | Ga0207645_10005747 | 3300025907 | Bacteria | 8952 |
| 364 | Ga0207645_10007796 | 3300025907 | Bacteria | 7533 |
| 365 | Ga0207645_10025876 | 3300025907 | Bacteria | 3795 |
| 366 | Ga0207654_10261372 | 3300025911 | Bacteria | 1164 |
| 367 | Ga0207707_10301213 | 3300025912 | Bacteria | 1386 |
| 368 | Ga0207707_10607303 | 3300025912 | Unclassified | 925 |
| 369 | Ga0207671_10202388 | 3300025914 | Bacteria | 1551 |
| 370 | Ga0207671_10515279 | 3300025914 | Unclassified | 953 |
| 371 | Ga0207663_10361733 | 3300025916 | Unclassified | 1101 |
| 372 | Ga0207660_10295226 | 3300025917 | Bacteria | 1289 |
| 373 | Ga0207662_10005164 | 3300025918 | Bacteria | 6926 |
| 374 | Ga0207662_10065398 | 3300025918 | Bacteria | 2190 |
| 375 | Ga0207662_10491331 | 3300025918 | Bacteria | 844 |
| 376 | Ga0207657_10006495 | 3300025919 | Bacteria | 12116 |
| 377 | Ga0207657_10426651 | 3300025919 | Bacteria | 1042 |
| 378 | Ga0207649_10007914 | 3300025920 | Bacteria | 5784 |
| 379 | Ga0207649_10035518 | 3300025920 | Bacteria | 2995 |
| 380 | Ga0207649_11096146 | 3300025920 | Unclassified | 628 |
| 381 | Ga0207652_10161445 | 3300025921 | Bacteria | 2009 |
| 382 | Ga0207681_10054744 | 3300025923 | Bacteria | 2714 |
| 383 | Ga0207681_10222151 | 3300025923 | Unclassified | 1462 |
| 384 | Ga0207681_10261818 | 3300025923 | Bacteria | 1354 |
| 385 | Ga0207681_10312480 | 3300025923 | Bacteria | 1247 |
| 386 | Ga0207694_10000948 | 3300025924 | Bacteria | 25592 |
| 387 | Ga0207659_10016053 | 3300025926 | Bacteria | 4867 |
| 388 | Ga0207687_10578269 | 3300025927 | Bacteria | 945 |
| 389 | Ga0207700_11196990 | 3300025928 | Bacteria | 678 |
| 390 | Ga0207644_10145629 | 3300025931 | Unclassified | 1828 |
| 391 | Ga0207644_10401943 | 3300025931 | Bacteria | 1120 |
| 392 | Ga0207644_10407730 | 3300025931 | Bacteria | 1112 |
| 393 | Ga0207644_10992832 | 3300025931 | Bacteria | 704 |
| 394 | Ga0207690_10204182 | 3300025932 | Bacteria | 1503 |
| 395 | Ga0207690_10426165 | 3300025932 | Bacteria | 1062 |
| 396 | Ga0207690_10517977 | 3300025932 | Bacteria | 966 |
| 397 | Ga0207706_10007318 | 3300025933 | Bacteria | 10206 |
| 398 | Ga0207706_10007765 | 3300025933 | Bacteria | 9902 |
| 399 | Ga0207706_10013786 | 3300025933 | Bacteria | 7336 |
| 400 | Ga0207706_10142304 | 3300025933 | Unclassified | 2110 |
| 401 | Ga0207706_10429955 | 3300025933 | Unclassified | 1143 |
| 402 | Ga0207706_10480780 | 3300025933 | Bacteria | 1073 |
| 403 | Ga0207686_10161376 | 3300025934 | Unclassified | 1571 |
| 404 | Ga0207686_10284594 | 3300025934 | Unclassified | 1222 |
| 405 | Ga0207686_10460607 | 3300025934 | Bacteria | 980 |
| 406 | Ga0207709_11814517 | 3300025935 | Bacteria | 507 |
| 407 | Ga0207670_10178845 | 3300025936 | Bacteria | 1596 |
| 408 | Ga0207670_10274678 | 3300025936 | Unclassified | 1311 |
| 409 | Ga0207670_10994451 | 3300025936 | Bacteria | 705 |
| 410 | Ga0207669_10429924 | 3300025937 | Unclassified | 1041 |
| 411 | Ga0207669_10470811 | 3300025937 | Bacteria | 999 |
| 412 | Ga0207704_10032386 | 3300025938 | Bacteria | 2958 |
| 413 | Ga0207704_10300539 | 3300025938 | Unclassified | 1229 |
| 414 | Ga0207704_10393765 | 3300025938 | Unclassified | 1091 |
| 415 | Ga0207665_10642262 | 3300025939 | Unclassified | 831 |
| 416 | Ga0207691_10010037 | 3300025940 | Bacteria | 9085 |
| 417 | Ga0207691_10023371 | 3300025940 | Bacteria | 5819 |
| 418 | Ga0207691_11190176 | 3300025940 | Unclassified | 632 |
| 419 | Ga0207689_10001172 | 3300025942 | Bacteria | 25240 |
| 420 | Ga0207689_10018213 | 3300025942 | Bacteria | 5928 |
| 421 | Ga0207689_10028413 | 3300025942 | Bacteria | 4680 |
| 422 | Ga0207689_10280510 | 3300025942 | Unclassified | 1380 |
| 423 | Ga0207689_10374791 | 3300025942 | Bacteria | 1185 |
| 424 | Ga0207689_10944516 | 3300025942 | Bacteria | 728 |
| 425 | Ga0207661_10142848 | 3300025944 | Bacteria | 2061 |
| 426 | Ga0207661_10406158 | 3300025944 | Bacteria | 1236 |
| 427 | Ga0207661_10453445 | 3300025944 | Bacteria | 1168 |
| 428 | Ga0207679_10007316 | 3300025945 | Bacteria | 6997 |
| 429 | Ga0207679_10155071 | 3300025945 | Bacteria | 1869 |
| 430 | Ga0207667_10168373 | 3300025949 | Bacteria | 2252 |
| 431 | Ga0207651_10501605 | 3300025960 | Bacteria | 1049 |
| 432 | Ga0207712_10211488 | 3300025961 | Bacteria | 1545 |
| 433 | Ga0207712_10274543 | 3300025961 | Bacteria | 1373 |
| 434 | Ga0207712_10320577 | 3300025961 | Unclassified | 1278 |
| 435 | Ga0207712_10386777 | 3300025961 | Bacteria | 1172 |
| 436 | Ga0207712_10518134 | 3300025961 | Bacteria | 1021 |
| 437 | Ga0207712_10531791 | 3300025961 | Bacteria | 1009 |
| 438 | Ga0207712_11146040 | 3300025961 | Unclassified | 693 |
| 439 | Ga0207668_10045410 | 3300025972 | Bacteria | 2996 |
| 440 | Ga0207640_10209621 | 3300025981 | Bacteria | 1483 |
| 441 | Ga0207640_10319870 | 3300025981 | Bacteria | 1235 |
| 442 | Ga0207640_10452386 | 3300025981 | Bacteria | 1059 |
| 443 | Ga0207640_10866924 | 3300025981 | Unclassified | 787 |
| 444 | Ga0207640_11404673 | 3300025981 | Unclassified | 625 |
| 445 | Ga0207640_11616211 | 3300025981 | Bacteria | 584 |
| 446 | Ga0207658_10149251 | 3300025986 | Bacteria | 1902 |
| 447 | Ga0207658_10175788 | 3300025986 | Bacteria | 1768 |
| 448 | Ga0207658_10535847 | 3300025986 | Bacteria | 1046 |
| 449 | Ga0207658_11149975 | 3300025986 | Bacteria | 709 |
| 450 | Ga0207677_10023067 | 3300026023 | Bacteria | 3836 |
| 451 | Ga0207677_10050125 | 3300026023 | Bacteria | 2822 |
| 452 | Ga0207677_10227946 | 3300026023 | Bacteria | 1499 |
| 453 | Ga0207677_10276879 | 3300026023 | Bacteria | 1375 |
| 454 | Ga0207677_10344379 | 3300026023 | Unclassified | 1246 |
| 455 | Ga0207677_10377209 | 3300026023 | Bacteria | 1196 |
| 456 | Ga0207677_10927163 | 3300026023 | Unclassified | 786 |
| 457 | Ga0207677_11695293 | 3300026023 | Bacteria | 586 |
| 458 | Ga0207703_10721829 | 3300026035 | Bacteria | 948 |
| 459 | Ga0207703_11132196 | 3300026035 | Bacteria | 752 |
| 460 | Ga0207703_12000299 | 3300026035 | Bacteria | 556 |
| 461 | Ga0207639_10229808 | 3300026041 | Bacteria | 1607 |
| 462 | Ga0207639_10790723 | 3300026041 | Bacteria | 884 |
| 463 | Ga0207678_10041135 | 3300026067 | Bacteria | 4007 |
| 464 | Ga0207678_10233971 | 3300026067 | Bacteria | 1573 |
| 465 | Ga0207678_10470689 | 3300026067 | Unclassified | 1094 |
| 466 | Ga0207678_11136471 | 3300026067 | Bacteria | 692 |
| 467 | Ga0207708_10076086 | 3300026075 | Unclassified | 2574 |
| 468 | Ga0207708_10164802 | 3300026075 | Bacteria | 1752 |
| 469 | Ga0207708_11169931 | 3300026075 | Bacteria | 672 |
| 470 | Ga0207702_10489798 | 3300026078 | Bacteria | 1197 |
| 471 | Ga0207641_10083867 | 3300026088 | Bacteria | 2773 |
| 472 | Ga0207641_10373477 | 3300026088 | Unclassified | 1364 |
| 473 | Ga0207641_10985808 | 3300026088 | Bacteria | 839 |
| 474 | Ga0207641_11892343 | 3300026088 | Bacteria | 598 |
| 475 | Ga0207648_10002675 | 3300026089 | Bacteria | 18959 |
| 476 | Ga0207648_10271086 | 3300026089 | Bacteria | 1516 |
| 477 | Ga0207648_10797787 | 3300026089 | Bacteria | 879 |
| 478 | Ga0207676_10069494 | 3300026095 | Bacteria | 2820 |
| 479 | Ga0207676_10086205 | 3300026095 | Bacteria | 2565 |
| 480 | Ga0207676_10502240 | 3300026095 | Bacteria | 1152 |
| 481 | Ga0207676_10706343 | 3300026095 | Bacteria | 977 |
| 482 | Ga0207676_12073637 | 3300026095 | Bacteria | 567 |
| 483 | Ga0207674_10051237 | 3300026116 | Unclassified | 4213 |
| 484 | Ga0207674_10159823 | 3300026116 | Bacteria | 2208 |
| 485 | Ga0207674_10200470 | 3300026116 | Bacteria | 1945 |
| 486 | Ga0207674_10257473 | 3300026116 | Bacteria | 1692 |
| 487 | Ga0207674_10998212 | 3300026116 | Unclassified | 806 |
| 488 | Ga0207675_100033169 | 3300026118 | Bacteria | 4811 |
| 489 | Ga0207675_100503919 | 3300026118 | Unclassified | 1205 |
| 490 | Ga0207675_100525727 | 3300026118 | Unclassified | 1180 |
| 491 | Ga0207675_101003382 | 3300026118 | Bacteria | 853 |
| 492 | Ga0207683_10075015 | 3300026121 | Unclassified | 2993 |
| 493 | Ga0207683_10298434 | 3300026121 | Bacteria | 1474 |
| 494 | Ga0207698_10028188 | 3300026142 | Bacteria | 4001 |
| 495 | Ga0207698_10224102 | 3300026142 | Unclassified | 1701 |
| 496 | Ga0207698_11000901 | 3300026142 | Bacteria | 846 |
| 497 | Ga0209489_114058 | 3300027361 | Bacteria | 5929 |
| 498 | Ga0209282_1011751 | 3300027666 | Bacteria | 5561 |
| 499 | Ga0268266_10000060 | 3300028379 | Bacteria | 269063 |
| 500 | Ga0268266_10347474 | 3300028379 | Unclassified | 1393 |
| 501 | Ga0268265_10043355 | 3300028380 | Unclassified | 3344 |
| 502 | Ga0268265_10133564 | 3300028380 | Bacteria | 2067 |
| 503 | Ga0268264_10000175 | 3300028381 | Bacteria | 136178 |
| 504 | Ga0268264_10002457 | 3300028381 | Bacteria | 16284 |
| 505 | Ga0268264_10061921 | 3300028381 | Bacteria | 3140 |
| 506 | Ga0268264_10128301 | 3300028381 | Bacteria | 2245 |
| 507 | Ga0268264_10454190 | 3300028381 | Bacteria | 1242 |
| 508 | Ga0268264_10485335 | 3300028381 | Bacteria | 1202 |
| 509 | Ga0268264_10490604 | 3300028381 | Bacteria | 1196 |
| 510 | Ga0268264_10501902 | 3300028381 | Bacteria | 1183 |
| 511 | Ga0268264_11258856 | 3300028381 | Bacteria | 750 |
| 512 | Ga0268264_11989058 | 3300028381 | Unclassified | 590 |
| 513 | Ga0265338_10462911 | 3300028800 | Bacteria | 897 |
| 514 | Ga0316179_1000130 | 3300030734 | Bacteria | 1373 |
| 515 | Ga0265327_10000031 | 3300031251 | Bacteria | 325718 |
| 516 | Ga0265327_10467551 | 3300031251 | Unclassified | 544 |
| 517 | Ga0307513_10675953 | 3300031456 | Bacteria | 739 |
| 518 | Ga0307509_10954741 | 3300031507 | Unclassified | 523 |
| 519 | Ga0307408_100000481 | 3300031548 | Bacteria | 34941 |
| 520 | Ga0307405_10327773 | 3300031731 | Bacteria | 1172 |
| 521 | Ga0307413_10177152 | 3300031824 | Bacteria | 1516 |
| 522 | Ga0307410_10000018 | 3300031852 | Bacteria | 69156 |
| 523 | Ga0307406_10000171 | 3300031901 | Bacteria | 38853 |
| 524 | Ga0307406_10001227 | 3300031901 | Bacteria | 14359 |
| 525 | Ga0307406_10776148 | 3300031901 | Bacteria | 807 |
| 526 | Ga0307407_10096261 | 3300031903 | Bacteria | 1827 |
| 527 | Ga0307407_11064737 | 3300031903 | Bacteria | 627 |
| 528 | Ga0307412_10001812 | 3300031911 | Bacteria | 11822 |
| 529 | Ga0307412_10233753 | 3300031911 | Bacteria | 1417 |
| 530 | Ga0307412_10701903 | 3300031911 | Bacteria | 868 |
| 531 | Ga0307409_102070604 | 3300031995 | Bacteria | 599 |
| 532 | Ga0307416_100000955 | 3300032002 | Bacteria | 15266 |
| 533 | Ga0307416_100236492 | 3300032002 | Unclassified | 1766 |
| 534 | Ga0307416_100455525 | 3300032002 | Bacteria | 1333 |
| 535 | Ga0307416_102750313 | 3300032002 | Bacteria | 588 |
| 536 | Ga0307414_10000008 | 3300032004 | Bacteria | 375832 |
| 537 | Ga0307414_10061286 | 3300032004 | Bacteria | 2664 |
| 538 | Ga0307414_10066564 | 3300032004 | Bacteria | 2576 |
| 539 | Ga0307414_10241783 | 3300032004 | Bacteria | 1495 |
| 540 | Ga0307414_11141080 | 3300032004 | Bacteria | 720 |
| 541 | Ga0307411_10000008 | 3300032005 | Bacteria | 321575 |
| 542 | Ga0307411_10004815 | 3300032005 | Bacteria | 6543 |
| 543 | Ga0307411_10148067 | 3300032005 | Bacteria | 1741 |
| 544 | Ga0307415_100509472 | 3300032126 | Unclassified | 1054 |
| 545 | Ga0373938_0092517 | 3300034957 | Bacteria | 750 |
| 546 | Ga0373929_0119621 | 3300035085 | Bacteria | 681 |
| 547 | Ga0373941_0207651 | 3300035115 | Bacteria | 747 |
| 548 | Ga0373946_0340730 | 3300035171 | Unclassified | 748 |
| 549 | Ga0373961_0146694 | 3300035241 | Bacteria | 801 |
| 550 | Ga0373931_0404239 | 3300035691 | Bacteria | 865 |
| 551 | Ga0373935_1089906 | 3300035692 | Unclassified | 594 |
| 552 | Ga0373927_0005513 | 3300035695 | Bacteria | 8717 |
| 553 | Ga0373947_0145111 | 3300035725 | Unclassified | 1525 |
| 554 | Ga0373925_0001575 | 3300037068 | Bacteria | 19287 |
| 555 | Ga0395899_0000040 | 3300037312 | Bacteria | 261561 |
| 556 | Ga0436365_1058329 | 3300039437 | Bacteria | 1146 |
| 557 | Ga0439447_006620 | 3300041407 | Bacteria | 3744 |
| 558 | Ga0439466_0044957 | 3300041411 | Bacteria | 1461 |
| 559 | Ga0439465_0028386 | 3300041413 | Bacteria | 1774 |
| 560 | Ga0451791_0586514 | 3300041451 | Bacteria | 694 |
| 561 | Ga0451798_0178282 | 3300041458 | Unclassified | 1238 |
| 562 | Ga0451802_1556064 | 3300041460 | Bacteria | 1260 |
| 563 | Ga0451807_2576305 | 3300041486 | Bacteria | 533 |
| 564 | Ga0451837_0691837 | 3300041494 | Bacteria | 1304 |
| 565 | Ga0451841_0107162 | 3300041498 | Bacteria | 719 |
| 566 | Ga0451841_0726177 | 3300041498 | Bacteria | 596 |
| 567 | Ga0451845_0770630 | 3300041501 | Bacteria | 706 |
| 568 | Ga0451843_0552928 | 3300041509 | Bacteria | 521 |
| 569 | Ga0451855_0355676 | 3300041511 | Unclassified | 615 |
| 570 | Ga0451853_2279928 | 3300041512 | Unclassified | 1854 |
| 571 | Ga0451853_2382366 | 3300041512 | Bacteria | 617 |
| 572 | Ga0451577_0000179 | 3300042876 | Bacteria | 137689 |
| 573 | Ga0451577_0002444 | 3300042876 | Bacteria | 22149 |
| 574 | Ga0451577_0004275 | 3300042876 | Bacteria | 15188 |
| 575 | Ga0451577_0086963 | 3300042876 | Bacteria | 2789 |
| 576 | Ga0451577_0653898 | 3300042876 | Bacteria | 953 |
| 577 | Ga0451577_0655905 | 3300042876 | Bacteria | 951 |
| 578 | Ga0451577_0809693 | 3300042876 | Unclassified | 846 |
| 579 | Ga0466972_0005842 | 3300044658 | Bacteria | 6172 |
| 580 | Ga0453683_0016706 | 3300044673 | Bacteria | 4731 |
| 581 | Ga0453683_0036470 | 3300044673 | Bacteria | 3094 |
| 582 | Ga0453684_0000033 | 3300044712 | Bacteria | 734012 |
| 583 | Ga0453684_0005055 | 3300044712 | Bacteria | 26722 |
| 584 | Ga0453684_0007112 | 3300044712 | Bacteria | 20859 |
| 585 | Ga0453684_0148017 | 3300044712 | Bacteria | 2794 |
| 586 | Ga0453684_0247003 | 3300044712 | Bacteria | 2051 |
| 587 | Ga0451576_0000003 | 3300045051 | Bacteria | 1550573 |
| 588 | Ga0451576_0001481 | 3300045051 | Bacteria | 39707 |
| 589 | Ga0451576_0004415 | 3300045051 | Bacteria | 18299 |
| 590 | Ga0451576_0112400 | 3300045051 | Bacteria | 2835 |
| 591 | Ga0451576_1208426 | 3300045051 | Bacteria | 789 |
| 592 | Ga0466967_0220951 | 3300045976 | Bacteria | 1800 |
| 593 | Ga0495627_006222 | 3300046453 | Bacteria | 4696 |
| 594 | Ga0495638_0234429 | 3300046460 | Unclassified | 1019 |
| 595 | Ga0495582_0461364 | 3300046473 | Unclassified | 734 |
| 596 | Ga0495606_0007856 | 3300046507 | Bacteria | 9414 |
| 597 | Ga0495630_0801382 | 3300046517 | Unclassified | 719 |
| 598 | Ga0495663_0001124 | 3300046525 | Bacteria | 8638 |
| 599 | Ga0495586_0583449 | 3300046535 | Unclassified | 646 |
| 600 | Ga0495633_0289767 | 3300046558 | Bacteria | 744 |
| 601 | Ga0495611_0021462 | 3300046648 | Bacteria | 2789 |
| 602 | Ga0495625_0257618 | 3300046660 | Bacteria | 1130 |
| 603 | Ga0495613_0908126 | 3300046689 | Unclassified | 570 |
| 604 | Ga0495670_0439736 | 3300046691 | Bacteria | 706 |
| 605 | Ga0495649_0348026 | 3300046694 | Unclassified | 749 |
| 606 | Ga0495636_0000025 | 3300047318 | Bacteria | 66081 |
| 607 | Ga0495672_0007222 | 3300047320 | Bacteria | 8384 |
| 608 | Ga0495676_0184240 | 3300047321 | Unclassified | 1461 |
| 609 | Ga0496104_0288337 | 3300048907 | Unclassified | 1554 |
| 610 | Ga0496112_1059278 | 3300048915 | Bacteria | 730 |
| 611 | Ga0496114_0624226 | 3300048917 | Bacteria | 949 |
| 612 | Ga0496115_1456152 | 3300048918 | Bacteria | 503 |
| 613 | Ga0496117_0000618 | 3300048920 | Bacteria | 57549 |
| 614 | Ga0496117_0139173 | 3300048920 | Bacteria | 1457 |
| 615 | Ga0496118_0081732 | 3300048921 | Bacteria | 2267 |
| 616 | Ga0496121_0534448 | 3300048924 | Bacteria | 737 |
| 617 | Ga0496122_0041880 | 3300048925 | Bacteria | 3612 |
| 618 | Ga0496125_0004169 | 3300048928 | Bacteria | 16851 |
| 619 | Ga0496126_0000737 | 3300048929 | Bacteria | 59387 |
| 620 | Ga0496126_0028238 | 3300048929 | Bacteria | 5349 |
| 621 | Ga0501031_0243921 | 3300049568 | Bacteria | 1168 |
| 622 | Ga0501031_0336506 | 3300049568 | Unclassified | 977 |
| 623 | Ga0501033_0137748 | 3300049570 | Bacteria | 1766 |
| 624 | Ga0501034_0003765 | 3300049571 | Bacteria | 17128 |
| 625 | Ga0501034_0009675 | 3300049571 | Bacteria | 10083 |
| 626 | Ga0501034_0306311 | 3300049571 | Bacteria | 1524 |
| 627 | Ga0501034_0724236 | 3300049571 | Bacteria | 892 |
| 628 | Ga0501034_1037337 | 3300049571 | Unclassified | 703 |
| 629 | Ga0501034_1064456 | 3300049571 | Unclassified | 691 |
| 630 | Ga0501036_0096062 | 3300049572 | Bacteria | 2505 |
| 631 | Ga0501036_0342326 | 3300049572 | Bacteria | 1249 |
| 632 | Ga0501036_0852981 | 3300049572 | Bacteria | 749 |
| 633 | Ga0501038_0069900 | 3300049574 | Bacteria | 2982 |
| 634 | Ga0501038_1282051 | 3300049574 | Bacteria | 530 |
| 635 | Ga0501039_0054166 | 3300049575 | Bacteria | 3105 |
| 636 | Ga0501039_0450916 | 3300049575 | Bacteria | 1010 |
| 637 | Ga0501040_0002720 | 3300049576 | Bacteria | 11389 |
| 638 | Ga0501040_0064134 | 3300049576 | Bacteria | 2529 |
| 639 | Ga0501041_0017052 | 3300049577 | Bacteria | 4321 |
| 640 | Ga0501043_0387584 | 3300049579 | Unclassified | 1057 |
| 641 | Ga0501046_0118279 | 3300049580 | Bacteria | 2018 |
| 642 | Ga0501067_0015811 | 3300049583 | Bacteria | 4174 |
| 643 | Ga0501067_0316816 | 3300049583 | Bacteria | 869 |
| 644 | Ga0501068_0041203 | 3300049584 | Bacteria | 2774 |
| 645 | Ga0501069_0009079 | 3300049585 | Bacteria | 5247 |
| 646 | Ga0501069_0191256 | 3300049585 | Unclassified | 1184 |
| 647 | Ga0501070_0018495 | 3300049586 | Bacteria | 5847 |
| 648 | Ga0501070_0084236 | 3300049586 | Bacteria | 2632 |
| 649 | Ga0501070_0834992 | 3300049586 | Bacteria | 722 |
| 650 | Ga0501070_0947678 | 3300049586 | Bacteria | 669 |
| 651 | Ga0501071_0032827 | 3300049587 | Bacteria | 3688 |
| 652 | Ga0501071_0047920 | 3300049587 | Bacteria | 3071 |
| 653 | Ga0501071_0139888 | 3300049587 | Bacteria | 1802 |
| 654 | Ga0501071_1207769 | 3300049587 | Bacteria | 584 |
| 655 | Ga0501072_0081780 | 3300049588 | Bacteria | 2560 |
| 656 | Ga0501072_1605367 | 3300049588 | Bacteria | 501 |
| 657 | Ga0501073_0006596 | 3300049589 | Bacteria | 8639 |
| 658 | Ga0501073_0075953 | 3300049589 | Bacteria | 2338 |
| 659 | Ga0501073_0607763 | 3300049589 | Bacteria | 755 |
| 660 | Ga0501074_0216159 | 3300049590 | Bacteria | 1365 |
| 661 | Ga0501074_0528081 | 3300049590 | Bacteria | 836 |
| 662 | Ga0501074_0920910 | 3300049590 | Bacteria | 615 |
| 663 | Ga0501075_0019345 | 3300049591 | Bacteria | 4938 |
| 664 | Ga0501075_0028896 | 3300049591 | Unclassified | 4096 |
| 665 | Ga0501076_0433041 | 3300049592 | Bacteria | 1082 |
| 666 | Ga0501076_0785177 | 3300049592 | Bacteria | 786 |
| 667 | Ga0501076_0827313 | 3300049592 | Bacteria | 764 |
| 668 | Ga0501076_1603265 | 3300049592 | Bacteria | 534 |
| 669 | Ga0501077_0333967 | 3300049593 | Bacteria | 966 |
| 670 | Ga0501077_0421807 | 3300049593 | Bacteria | 853 |
| 671 | Ga0501259_050204 | 3300049688 | Bacteria | 845 |
| 672 | Ga0501261_026977 | 3300049690 | Bacteria | 852 |
| 673 | Ga0501079_1567903 | 3300049741 | Bacteria | 518 |
| 674 | Ga0501080_0023191 | 3300049742 | Bacteria | 5755 |
| 675 | Ga0501080_0083244 | 3300049742 | Bacteria | 2972 |
| 676 | Ga0501080_0520421 | 3300049742 | Unclassified | 1061 |
| 677 | Ga0501081_0028432 | 3300049743 | Bacteria | 3773 |
| 678 | Ga0501083_0047827 | 3300049744 | Bacteria | 2888 |
| 679 | Ga0501083_0071798 | 3300049744 | Bacteria | 2301 |
| 680 | Ga0501083_0104106 | 3300049744 | Bacteria | 1870 |
| 681 | Ga0501083_0230893 | 3300049744 | Bacteria | 1205 |
| 682 | Ga0501241_001809 | 3300049758 | Bacteria | 4216 |
| 683 | Ga0501241_119787 | 3300049758 | Bacteria | 583 |
| 684 | Ga0501266_000004 | 3300049763 | Bacteria | 356286 |
| 685 | Ga0501269_010167 | 3300049766 | Bacteria | 1142 |
| 686 | Ga0501280_000847 | 3300049776 | Bacteria | 6611 |
| 687 | Ga0501035_0556996 | 3300049822 | Unclassified | 938 |
| 688 | Ga0501045_0253280 | 3300049824 | Bacteria | 1310 |
| 689 | nmdc:mga00v17_1338_c1 | 3300050491 | Bacteria | 12911 |
| 690 | nmdc:mga0yw44_637247_c1 | 3300050492 | Unclassified | 724 |
| 691 | nmdc:mga0yw44_854959_c1 | 3300050492 | Bacteria | 617 |
| 692 | nmdc:mga0k408_128118_c1 | 3300050493 | Bacteria | 1506 |
| 693 | nmdc:mga05p37_3491_c2 | 3300050507 | Bacteria | 16049 |
| 694 | nmdc:mga05p37_748844_c1 | 3300050507 | Bacteria | 1077 |
| 695 | nmdc:mga09592_1099382_c1 | 3300050508 | Unclassified | 661 |
| 696 | nmdc:mga08y16_1148100_c1 | 3300050511 | Unclassified | 750 |
| 697 | nmdc:mga08y16_1699626_c1 | 3300050511 | Bacteria | 586 |
| 698 | nmdc:mga08y16_552540_c1 | 3300050511 | Bacteria | 1165 |
| 699 | nmdc:mga0n895_325214_c1 | 3300050512 | Bacteria | 1558 |
| 700 | nmdc:mga0rr50_609395_c1 | 3300050513 | Bacteria | 931 |
| 701 | nmdc:mga0rr50_714278_c1 | 3300050513 | Unclassified | 855 |
| 702 | nmdc:mga0rr50_944110_c1 | 3300050513 | Bacteria | 735 |
| 703 | nmdc:mga08x19_1346249_c1 | 3300050514 | Unclassified | 505 |
| 704 | nmdc:mga0sz30_51443_c1 | 3300050516 | Bacteria | 1747 |
| 705 | Ga0500643_000009 | 3300053087 | Bacteria | 444150 |
| 706 | Ga0500643_068296 | 3300053087 | Unclassified | 989 |
| 707 | Ga0500643_081112 | 3300053087 | Bacteria | 891 |
| 708 | Ga0500644_0000682 | 3300053088 | Bacteria | 12338 |
| 709 | Ga0500644_0002702 | 3300053088 | Unclassified | 4429 |
| 710 | Ga0500644_0399863 | 3300053088 | Bacteria | 599 |
| 711 | Ga0500646_0028727 | 3300053090 | Unclassified | 1520 |
| 712 | Ga0500646_0044538 | 3300053090 | Unclassified | 1260 |
| 713 | Ga0500646_0050005 | 3300053090 | Bacteria | 1203 |
| 714 | Ga0500583_0000084 | 3300053092 | Bacteria | 52917 |
| 715 | Ga0500583_0000798 | 3300053092 | Bacteria | 9103 |
| 716 | Ga0500583_0001253 | 3300053092 | Bacteria | 7246 |
| 717 | Ga0500583_0047512 | 3300053092 | Bacteria | 1978 |
| 718 | Ga0500641_0000003 | 3300053096 | Bacteria | 284831 |
| 719 | Ga0500650_0111741 | 3300053098 | Unclassified | 1275 |
| 720 | Ga0500562_000004 | 3300053108 | Bacteria | 270087 |
| 721 | Ga0500658_0000009 | 3300053134 | Bacteria | 270303 |
| 722 | Ga0500559_0022554 | 3300053136 | Bacteria | 2670 |
| 723 | Ga0500559_0027012 | 3300053136 | Bacteria | 2449 |
| 724 | Ga0500568_0000532 | 3300053139 | Bacteria | 28130 |
| 725 | Ga0500568_0008028 | 3300053139 | Bacteria | 5123 |
| 726 | Ga0500568_0196063 | 3300053139 | Unclassified | 740 |
| 727 | Ga0500573_0167869 | 3300053140 | Bacteria | 1189 |
| 728 | Ga0500589_289441 | 3300053147 | Bacteria | 584 |
| 729 | Ga0500622_0002806 | 3300053156 | Bacteria | 12242 |
| 730 | Ga0500622_0008787 | 3300053156 | Bacteria | 5624 |
| 731 | Ga0500634_0032521 | 3300053161 | Bacteria | 2845 |
| 732 | Ga0500611_011038 | 3300053727 | Unclassified | 1482 |
| 733 | Ga0500645_004061 | 3300053730 | Bacteria | 5738 |
| 734 | Ga0500645_157191 | 3300053730 | Bacteria | 624 |
| 735 | Ga0500587_060646 | 3300053739 | Unclassified | 578 |
| 736 | Ga0501084_0853563 | 3300054114 | Bacteria | 766 |
| 737 | Ga0501084_1125166 | 3300054114 | Bacteria | 659 |
| 738 | Ga0501084_1287643 | 3300054114 | Bacteria | 613 |
| 739 | Ga0501082_0036807 | 3300060353 | Bacteria | 4215 |
| 740 | Ga0501082_0055123 | 3300060353 | Bacteria | 3425 |
| 741 | Ga0501082_0674795 | 3300060353 | Bacteria | 904 |
| 742 | Ga0501082_0996436 | 3300060353 | Bacteria | 733 |
| 743 | Ga0530510_0006162 | 3300061734 | Bacteria | 8333 |
| 744 | Ga0530510_0016925 | 3300061734 | Bacteria | 5164 |
| 745 | 2644373396 | 2643221667 | Bacteria | 5627472 |
| 746 | 2644679066 | 2643221724 | Bacteria | 3593515 |
| 747 | 2644683518 | 2643221725 | Bacteria | 5087956 |
| 748 | 2730228563 | 2728369380 | Bacteria | 3620317 |
| 749 | 2738728484 | 2738541278 | Bacteria | 9755573 |
| 750 | 2738733508 | 2738541279 | Bacteria | 6149495 |
| 751 | 2738766046 | 2738541285 | Bacteria | 6150075 |
| 752 | 2739215089 | 2738543007 | Bacteria | 6149845 |
| 753 | 2740002188 | 2739367857 | Bacteria | 5433684 |
| 754 | 2740007004 | 2739367858 | Bacteria | 5432813 |
| 755 | 2740058408 | 2739367874 | Bacteria | 4872888 |
| 756 | 2747954443 | 2747842429 | Bacteria | 3914386 |
| 757 | 2787438502 | 2786546517 | Bacteria | 6614109 |
| 758 | 2802652597 | 2802428842 | Bacteria | 4926114 |
| 759 | 2817417164 | 2816332280 | Bacteria | 5109718 |
| 760 | 2857616073 | 2857613821 | Bacteria | 4917088 |
| 761 | 2857620161 | 2857618242 | Bacteria | 5635925 |
| 762 | 2881362891 | 2881359912 | Bacteria | 4935907 |
| 763 | 2881957219 | 2881955468 | Bacteria | 3545609 |
| 764 | 2902049993 | 2902048731 | Bacteria | 4976191 |
| 765 | 2903898110 | 2903895155 | Bacteria | 5258610 |
| 766 | 2904422262 | 2904419702 | Bacteria | 5166287 |
| 767 | 2919512830 | 2919509842 | Bacteria | 4104664 |
| 768 | 2919691409 | 2919688452 | Bacteria | 4595932 |
| 769 | 2929154938 | 2929154850 | Bacteria | 6753285 |
| 770 | 2929180200 | 2929177148 | Bacteria | 7883697 |
| 771 | 2945982604 | 2945977869 | Bacteria | 7777518 |
| 772 | 2946018000 | 2946013367 | Bacteria | 7766675 |
| 773 | 2958459331 | 2958458903 | Bacteria | 5301041 |
| 774 | 2958515711 | 2958512119 | Bacteria | 4528530 |
| 775 | 2977271307 | 2977268062 | Bacteria | 5243061 |
| 776 | 8055422768 | 8055419101 | Bacteria | 5289643 |
| 777 | Ga0157373_10106587 | |||
| 778 | ARcpr5yngRDRAFT_c004230 | |||
| 779 | JGI24739J22299_10002038 | |||
| 780 | JGI25158J39367_1012611 | |||
| 781 | JGI25153J46596_10015700 | |||
| 782 | JGI25153J46596_10019196 | |||
| 783 | rootH1_10103492 | |||
| 784 | rootL2_10104087 | |||
| 785 | rootL2_10105973 | |||
| 786 | rootL2_10119672 | |||
| 787 | rootL2_10158095 | |||
| 788 | rootH1_10079681 | |||
| 789 | rootH1_10347417 | |||
| 790 | JGI25160J50197_1007932 | |||
| 791 | Ga0055526_1010199 | |||
| 792 | Ga0055531_10000198 | |||
| 793 | Ga0065712_10106611 | |||
| 794 | Ga0070676_10019445 | |||
| 795 | Ga0070676_10167147 | |||
| 796 | Ga0070683_100006379 | |||
| 797 | Ga0070683_100016678 | |||
| 798 | Ga0070683_100059315 | |||
| 799 | Ga0070683_100159745 | |||
| 800 | Ga0070683_100314924 | |||
| 801 | Ga0070683_100482193 | |||
| 802 | Ga0070683_100866581 | |||
| 803 | Ga0070690_100083176 | |||
| 804 | Ga0070690_100084555 | |||
| 805 | Ga0070690_100182641 | |||
| 806 | Ga0070690_100325291 | |||
| 807 | Ga0070690_100326847 | |||
| 808 | Ga0070677_10822660 | |||
| 809 | Ga0068869_100012359 | |||
| 810 | Ga0068869_100106101 | |||
| 811 | Ga0068869_100210369 | |||
| 812 | Ga0068869_101887554 | |||
| 813 | Ga0070666_10017465 | |||
| 814 | Ga0070666_10330248 | |||
| 815 | Ga0070666_10546448 | |||
| 816 | Ga0070666_10781377 | |||
| 817 | Ga0070666_11099765 | |||
| 818 | Ga0070680_100782161 | |||
| 819 | Ga0070682_100187710 | |||
| 820 | Ga0070682_100204344 | |||
| 821 | Ga0068868_100002169 | |||
| 822 | Ga0068868_100023827 | |||
| 823 | Ga0068868_100080731 | |||
| 824 | Ga0068868_100148690 | |||
| 825 | Ga0068868_100713010 | |||
| 826 | Ga0070689_100041733 | |||
| 827 | Ga0070689_100073368 | |||
| 828 | Ga0070689_100091049 | |||
| 829 | Ga0070689_100301642 | |||
| 830 | Ga0070689_100884844 | |||
| 831 | Ga0070687_100119449 | |||
| 832 | Ga0070687_101224015 | |||
| 833 | Ga0070661_100016114 | |||
| 834 | Ga0070661_100090324 | |||
| 835 | Ga0070668_100061129 | |||
| 836 | Ga0070668_100300872 | |||
| 837 | Ga0070668_100906050 | |||
| 838 | Ga0070669_100087000 | |||
| 839 | Ga0070669_100209378 | |||
| 840 | Ga0070669_100344017 | |||
| 841 | Ga0070669_100532123 | |||
| 842 | Ga0070675_100013847 | |||
| 843 | Ga0070675_100643818 | |||
| 844 | Ga0070675_101999431 | |||
| 845 | Ga0070671_100081905 | |||
| 846 | Ga0070671_100093118 | |||
| 847 | Ga0070671_100119075 | |||
| 848 | Ga0070671_100562148 | |||
| 849 | Ga0070674_100216534 | |||
| 850 | Ga0070674_100575762 | |||
| 851 | Ga0070673_100045506 | |||
| 852 | Ga0070673_100051448 | |||
| 853 | Ga0070688_100004273 | |||
| 854 | Ga0070688_100369908 | |||
| 855 | Ga0070688_100553745 | |||
| 856 | Ga0070688_101294561 | |||
| 857 | Ga0070659_100003088 | |||
| 858 | Ga0070659_100214647 | |||
| 859 | Ga0070659_100270364 | |||
| 860 | Ga0070659_100327987 | |||
| 861 | Ga0070667_100376109 | |||
| 862 | Ga0070667_100472833 | |||
| 863 | Ga0070667_100742586 | |||
| 864 | Ga0070667_100867715 | |||
| 865 | Ga0070713_101435857 | |||
| 866 | Ga0070701_10014865 | |||
| 867 | Ga0070701_10770683 | |||
| 868 | Ga0070711_100013432 | |||
| 869 | Ga0070700_101059141 | |||
| 870 | Ga0070694_101602466 | |||
| 871 | Ga0070663_100312784 | |||
| 872 | Ga0070663_100481650 | |||
| 873 | Ga0070663_100498951 | |||
| 874 | Ga0070678_100084777 | |||
| 875 | Ga0070678_100672540 | |||
| 876 | Ga0070662_100109004 | |||
| 877 | Ga0070662_100331882 | |||
| 878 | Ga0070662_100401930 | |||
| 879 | Ga0070662_100454018 | |||
| 880 | Ga0070662_101439311 | |||
| 881 | Ga0070662_101458647 | |||
| 882 | Ga0070681_10049698 | |||
| 883 | Ga0070681_10343751 | |||
| 884 | Ga0068867_100024456 | |||
| 885 | Ga0068867_100509901 | |||
| 886 | Ga0068867_100641219 | |||
| 887 | Ga0068867_101003731 | |||
| 888 | Ga0068867_101347319 | |||
| 889 | Ga0070685_10046768 | |||
| 890 | Ga0070685_10284767 | |||
| 891 | Ga0070698_100014985 | |||
| 892 | Ga0070698_102018695 | |||
| 893 | Ga0070699_100268874 | |||
| 894 | Ga0070679_100116762 | |||
| 895 | Ga0070684_100001466 | |||
| 896 | Ga0070684_100021811 | |||
| 897 | Ga0070684_100086213 | |||
| 898 | Ga0070684_100143719 | |||
| 899 | Ga0070684_100641464 | |||
| 900 | Ga0068853_100003944 | |||
| 901 | Ga0068853_100005794 | |||
| 902 | Ga0068853_100026313 | |||
| 903 | Ga0068853_100331602 | |||
| 904 | Ga0068853_102051936 | |||
| 905 | Ga0068853_102487444 | |||
| 906 | Ga0070672_100119647 | |||
| 907 | Ga0070672_100242177 | |||
| 908 | Ga0070672_100323824 | |||
| 909 | Ga0070672_102064323 | |||
| 910 | Ga0070686_100041186 | |||
| 911 | Ga0070686_100277074 | |||
| 912 | Ga0070665_100000093 | |||
| 913 | Ga0070665_100417419 | |||
| 914 | Ga0070664_100004395 | |||
| 915 | Ga0070664_100005000 | |||
| 916 | Ga0068857_100037682 | |||
| 917 | Ga0068857_100054783 | |||
| 918 | Ga0068857_100144206 | |||
| 919 | Ga0068857_100176185 | |||
| 920 | Ga0068857_100760168 | |||
| 921 | Ga0068854_100195424 | |||
| 922 | Ga0068854_100281775 | |||
| 923 | Ga0068854_101447579 | |||
| 924 | Ga0068854_101547216 | |||
| 925 | Ga0068856_100016755 | |||
| 926 | Ga0068856_100088141 | |||
| 927 | Ga0068852_100019269 | |||
| 928 | Ga0068852_100564730 | |||
| 929 | Ga0068859_100037001 | |||
| 930 | Ga0068859_100037557 | |||
| 931 | Ga0068859_100096370 | |||
| 932 | Ga0068859_100599145 | |||
| 933 | Ga0068859_100729250 | |||
| 934 | Ga0068859_101461808 | |||
| 935 | Ga0068864_100003839 | |||
| 936 | Ga0068864_100585376 | |||
| 937 | Ga0068864_100695572 | |||
| 938 | Ga0068864_102149569 | |||
| 939 | Ga0068866_10002365 | |||
| 940 | Ga0068866_10067909 | |||
| 941 | Ga0068866_10219631 | |||
| 942 | Ga0068866_10851881 | |||
| 943 | Ga0068861_100027092 | |||
| 944 | Ga0068861_100081668 | |||
| 945 | Ga0068861_100339172 | |||
| 946 | Ga0068861_100983836 | |||
| 947 | Ga0068861_102436635 | |||
| 948 | Ga0068851_10000107 | |||
| 949 | Ga0068851_10046249 | |||
| 950 | Ga0068851_10048862 | |||
| 951 | Ga0068863_100164825 | |||
| 952 | Ga0068863_100709277 | |||
| 953 | Ga0068858_100253238 | |||
| 954 | Ga0068858_100638106 | |||
| 955 | Ga0068858_101326699 | |||
| 956 | Ga0068858_101472542 | |||
| 957 | Ga0068860_100001707 | |||
| 958 | Ga0068860_100071637 | |||
| 959 | Ga0068860_100071679 | |||
| 960 | Ga0068860_100499234 | |||
| 961 | Ga0068860_100676314 | |||
| 962 | Ga0068860_100967656 | |||
| 963 | Ga0068860_102482966 | |||
| 964 | Ga0068862_100156272 | |||
| 965 | Ga0068862_100162205 | |||
| 966 | Ga0068862_100197255 | |||
| 967 | Ga0075365_10239562 | |||
| 968 | Ga0075364_10001124 | |||
| 969 | Ga0075364_10170367 | |||
| 970 | Ga0075364_10657882 | |||
| 971 | Ga0075369_10088842 | |||
| 972 | Ga0075366_10099140 | |||
| 973 | Ga0075366_10171835 | |||
| 974 | Ga0097621_100009919 | |||
| 975 | Ga0097621_100066221 | |||
| 976 | Ga0068871_100014830 | |||
| 977 | Ga0068871_100654884 | |||
| 978 | Ga0068871_101415042 | |||
| 979 | Ga0075428_100158926 | |||
| 980 | Ga0075431_100661251 | |||
| 981 | Ga0075433_10611409 | |||
| 982 | Ga0075434_100336849 | |||
| 983 | Ga0075434_100966708 | |||
| 984 | Ga0075434_102631977 | |||
| 985 | Ga0075429_100911229 | |||
| 986 | Ga0068865_100102867 | |||
| 987 | Ga0068865_100151860 | |||
| 988 | Ga0068865_100271068 | |||
| 989 | Ga0068865_100504537 | |||
| 990 | Ga0075436_100406222 | |||
| 991 | Ga0097620_100037002 | |||
| 992 | Ga0097620_100037557 | |||
| 993 | Ga0097620_100096370 | |||
| 994 | Ga0097620_100599218 | |||
| 995 | Ga0097620_100729334 | |||
| 996 | Ga0097620_101461444 | |||
| 997 | Ga0099824_1000985 | |||
| 998 | Ga0099826_10011055 | |||
| 999 | Ga0075435_101117114 | |||
| 1000 | Ga0105251_10126907 | |||
| 1001 | Ga0105244_10000002 | |||
| 1002 | Ga0105240_11033273 | |||
| 1003 | Ga0111539_10274661 | |||
| 1004 | Ga0111539_10737312 | |||
| 1005 | Ga0111539_10804592 | |||
| 1006 | Ga0111539_11785608 | |||
| 1007 | Ga0111539_13161590 | |||
| 1008 | Ga0105245_10039235 | |||
| 1009 | Ga0105247_10126684 | |||
| 1010 | Ga0105247_10333136 | |||
| 1011 | Ga0114129_10019457 | |||
| 1012 | Ga0114129_11024080 | |||
| 1013 | Ga0105241_10735341 | |||
| 1014 | Ga0105241_10881380 | |||
| 1015 | Ga0105241_11164503 | |||
| 1016 | Ga0105241_11622058 | |||
| 1017 | Ga0105242_10020009 | |||
| 1018 | Ga0105242_10562664 | |||
| 1019 | Ga0105242_10867910 | |||
| 1020 | Ga0105242_11415276 | |||
| 1021 | Ga0105242_11552995 | |||
| 1022 | Ga0105242_12917390 | |||
| 1023 | Ga0105248_10210070 | |||
| 1024 | Ga0105248_11399140 | |||
| 1025 | Ga0105248_11469838 | |||
| 1026 | Ga0105248_12442562 | |||
| 1027 | Ga0105237_10516039 | |||
| 1028 | Ga0105237_10794951 | |||
| 1029 | Ga0105237_11609407 | |||
| 1030 | Ga0105249_10285576 | |||
| 1031 | Ga0105249_10309758 | |||
| 1032 | Ga0105249_10465296 | |||
| 1033 | Ga0105249_10548580 | |||
| 1034 | Ga0105249_10966506 | |||
| 1035 | Ga0105249_11804425 | |||
| 1036 | Ga0105249_12059939 | |||
| 1037 | Ga0105030_103579 | |||
| 1038 | Ga0105028_102950 | |||
| 1039 | Ga0105239_10012803 | |||
| 1040 | Ga0105239_10174399 | |||
| 1041 | Ga0105239_10199086 | |||
| 1042 | Ga0105239_10402406 | |||
| 1043 | Ga0105239_10655231 | |||
| 1044 | Ga0105239_10725687 | |||
| 1045 | Ga0105239_11186955 | |||
| 1046 | Ga0105239_12296783 | |||
| 1047 | Ga0105246_10499363 | |||
| 1048 | Ga0157373_10000001 | |||
| 1049 | Ga0157373_10033673 | |||
| 1050 | Ga0157373_10640601 | |||
| 1051 | Ga0157373_11514959 | |||
| 1052 | Ga0157371_10122289 | |||
| 1053 | Ga0157371_10273584 | |||
| 1054 | Ga0157371_10527442 | |||
| 1055 | Ga0157370_10000489 | |||
| 1056 | Ga0157370_10001280 | |||
| 1057 | Ga0157370_10071002 | |||
| 1058 | Ga0157370_11011941 | |||
| 1059 | Ga0157370_11763754 | |||
| 1060 | Ga0157369_10054684 | |||
| 1061 | Ga0157369_12591628 | |||
| 1062 | Ga0157374_10000002 | |||
| 1063 | Ga0157374_10009412 | |||
| 1064 | Ga0157374_10025109 | |||
| 1065 | Ga0157374_10029675 | |||
| 1066 | Ga0157374_10114510 | |||
| 1067 | Ga0157374_10669842 | |||
| 1068 | Ga0157374_12771913 | |||
| 1069 | Ga0157378_10002639 | |||
| 1070 | Ga0157378_10008109 | |||
| 1071 | Ga0157378_10044506 | |||
| 1072 | Ga0157378_10058138 | |||
| 1073 | Ga0157378_10142346 | |||
| 1074 | Ga0157378_10363768 | |||
| 1075 | Ga0157378_10758992 | |||
| 1076 | Ga0163162_10000254 | |||
| 1077 | Ga0163162_10007176 | |||
| 1078 | Ga0163162_10008484 | |||
| 1079 | Ga0163162_10009840 | |||
| 1080 | Ga0163162_10223918 | |||
| 1081 | Ga0163162_10886185 | |||
| 1082 | Ga0157372_10007573 | |||
| 1083 | Ga0157372_10104222 | |||
| 1084 | Ga0157372_10161952 | |||
| 1085 | Ga0157372_10281114 | |||
| 1086 | Ga0157372_10732963 | |||
| 1087 | Ga0157372_11282640 | |||
| 1088 | Ga0157372_11933268 | |||
| 1089 | Ga0157375_10024352 | |||
| 1090 | Ga0157375_10036428 | |||
| 1091 | Ga0157375_10129687 | |||
| 1092 | Ga0157375_10175685 | |||
| 1093 | Ga0157375_10361940 | |||
| 1094 | Ga0157375_10556304 | |||
| 1095 | Ga0157375_11839703 | |||
| 1096 | Ga0157514_124540 | |||
| 1097 | Ga0163163_10000982 | |||
| 1098 | Ga0163163_10211146 | |||
| 1099 | Ga0163163_10961520 | |||
| 1100 | Ga0163163_11038910 | |||
| 1101 | Ga0157380_10001909 | |||
| 1102 | Ga0157380_10353377 | |||
| 1103 | Ga0157380_10613928 | |||
| 1104 | Ga0157380_10678969 | |||
| 1105 | Ga0157380_11245544 | |||
| 1106 | Ga0157380_13271170 | |||
| 1107 | Ga0157377_10003474 | |||
| 1108 | Ga0157377_10007460 | |||
| 1109 | Ga0157379_10051108 | |||
| 1110 | Ga0157379_10403400 | |||
| 1111 | Ga0157379_10768322 | |||
| 1112 | Ga0157376_10007019 | |||
| 1113 | Ga0157376_10345503 | |||
| 1114 | Ga0182006_1001457 | |||
| 1115 | Ga0182006_1030786 | |||
| 1116 | Ga0182006_1030872 | |||
| 1117 | Ga0163161_10213813 | |||
| 1118 | Ga0163161_10388803 | |||
| 1119 | Ga0209436_100584 | |||
| 1120 | Ga0209130_1002010 | |||
| 1121 | Ga0209564_1001302 | |||
| 1122 | Ga0209758_1000465 | |||
| 1123 | Ga0209758_1004804 | |||
| 1124 | Ga0207426_1000002 | |||
| 1125 | Ga0207426_1000148 | |||
| 1126 | Ga0207426_1007198 | |||
| 1127 | Ga0209257_1000008 | |||
| 1128 | Ga0207697_10244352 | |||
| 1129 | Ga0207656_10000280 | |||
| 1130 | Ga0207655_1000012 | |||
| 1131 | Ga0207713_1082415 | |||
| 1132 | Ga0207642_10182088 | |||
| 1133 | Ga0207642_10188122 | |||
| 1134 | Ga0207688_10019324 | |||
| 1135 | Ga0207680_10042960 | |||
| 1136 | Ga0207680_10676067 | |||
| 1137 | Ga0207680_10698111 | |||
| 1138 | Ga0207647_10088385 | |||
| 1139 | Ga0207645_10005747 | |||
| 1140 | Ga0207645_10007796 | |||
| 1141 | Ga0207645_10025876 | |||
| 1142 | Ga0207654_10261372 | |||
| 1143 | Ga0207707_10301213 | |||
| 1144 | Ga0207707_10607303 | |||
| 1145 | Ga0207671_10202388 | |||
| 1146 | Ga0207671_10515279 | |||
| 1147 | Ga0207663_10361733 | |||
| 1148 | Ga0207660_10295226 | |||
| 1149 | Ga0207662_10005164 | |||
| 1150 | Ga0207662_10065398 | |||
| 1151 | Ga0207662_10491331 | |||
| 1152 | Ga0207657_10006495 | |||
| 1153 | Ga0207657_10426651 | |||
| 1154 | Ga0207649_10007914 | |||
| 1155 | Ga0207649_10035518 | |||
| 1156 | Ga0207649_11096146 | |||
| 1157 | Ga0207652_10161445 | |||
| 1158 | Ga0207681_10054744 | |||
| 1159 | Ga0207681_10222151 | |||
| 1160 | Ga0207681_10261818 | |||
| 1161 | Ga0207681_10312480 | |||
| 1162 | Ga0207694_10000948 | |||
| 1163 | Ga0207659_10016053 | |||
| 1164 | Ga0207687_10578269 | |||
| 1165 | Ga0207700_11196990 | |||
| 1166 | Ga0207644_10145629 | |||
| 1167 | Ga0207644_10401943 | |||
| 1168 | Ga0207644_10407730 | |||
| 1169 | Ga0207644_10992832 | |||
| 1170 | Ga0207690_10204182 | |||
| 1171 | Ga0207690_10426165 | |||
| 1172 | Ga0207690_10517977 | |||
| 1173 | Ga0207706_10007318 | |||
| 1174 | Ga0207706_10007765 | |||
| 1175 | Ga0207706_10013786 | |||
| 1176 | Ga0207706_10142304 | |||
| 1177 | Ga0207706_10429955 | |||
| 1178 | Ga0207706_10480780 | |||
| 1179 | Ga0207686_10161376 | |||
| 1180 | Ga0207686_10284594 | |||
| 1181 | Ga0207686_10460607 | |||
| 1182 | Ga0207709_11814517 | |||
| 1183 | Ga0207670_10178845 | |||
| 1184 | Ga0207670_10274678 | |||
| 1185 | Ga0207670_10994451 | |||
| 1186 | Ga0207669_10429924 | |||
| 1187 | Ga0207669_10470811 | |||
| 1188 | Ga0207704_10032386 | |||
| 1189 | Ga0207704_10300539 | |||
| 1190 | Ga0207704_10393765 | |||
| 1191 | Ga0207665_10642262 | |||
| 1192 | Ga0207691_10010037 | |||
| 1193 | Ga0207691_10023371 | |||
| 1194 | Ga0207691_11190176 | |||
| 1195 | Ga0207689_10001172 | |||
| 1196 | Ga0207689_10018213 | |||
| 1197 | Ga0207689_10028413 | |||
| 1198 | Ga0207689_10280510 | |||
| 1199 | Ga0207689_10374791 | |||
| 1200 | Ga0207689_10944516 | |||
| 1201 | Ga0207661_10142848 | |||
| 1202 | Ga0207661_10406158 | |||
| 1203 | Ga0207661_10453445 | |||
| 1204 | Ga0207679_10007316 | |||
| 1205 | Ga0207679_10155071 | |||
| 1206 | Ga0207667_10168373 | |||
| 1207 | Ga0207651_10501605 | |||
| 1208 | Ga0207712_10211488 | |||
| 1209 | Ga0207712_10274543 | |||
| 1210 | Ga0207712_10320577 | |||
| 1211 | Ga0207712_10386777 | |||
| 1212 | Ga0207712_10518134 | |||
| 1213 | Ga0207712_10531791 | |||
| 1214 | Ga0207712_11146040 | |||
| 1215 | Ga0207668_10045410 | |||
| 1216 | Ga0207640_10209621 | |||
| 1217 | Ga0207640_10319870 | |||
| 1218 | Ga0207640_10452386 | |||
| 1219 | Ga0207640_10866924 | |||
| 1220 | Ga0207640_11404673 | |||
| 1221 | Ga0207640_11616211 | |||
| 1222 | Ga0207658_10149251 | |||
| 1223 | Ga0207658_10175788 | |||
| 1224 | Ga0207658_10535847 | |||
| 1225 | Ga0207658_11149975 | |||
| 1226 | Ga0207677_10023067 | |||
| 1227 | Ga0207677_10050125 | |||
| 1228 | Ga0207677_10227946 | |||
| 1229 | Ga0207677_10276879 | |||
| 1230 | Ga0207677_10344379 | |||
| 1231 | Ga0207677_10377209 | |||
| 1232 | Ga0207677_10927163 | |||
| 1233 | Ga0207677_11695293 | |||
| 1234 | Ga0207703_10721829 | |||
| 1235 | Ga0207703_11132196 | |||
| 1236 | Ga0207703_12000299 | |||
| 1237 | Ga0207639_10229808 | |||
| 1238 | Ga0207639_10790723 | |||
| 1239 | Ga0207678_10041135 | |||
| 1240 | Ga0207678_10233971 | |||
| 1241 | Ga0207678_10470689 | |||
| 1242 | Ga0207678_11136471 | |||
| 1243 | Ga0207708_10076086 | |||
| 1244 | Ga0207708_10164802 | |||
| 1245 | Ga0207708_11169931 | |||
| 1246 | Ga0207702_10489798 | |||
| 1247 | Ga0207641_10083867 | |||
| 1248 | Ga0207641_10373477 | |||
| 1249 | Ga0207641_10985808 | |||
| 1250 | Ga0207641_11892343 | |||
| 1251 | Ga0207648_10002675 | |||
| 1252 | Ga0207648_10271086 | |||
| 1253 | Ga0207648_10797787 | |||
| 1254 | Ga0207676_10069494 | |||
| 1255 | Ga0207676_10086205 | |||
| 1256 | Ga0207676_10502240 | |||
| 1257 | Ga0207676_10706343 | |||
| 1258 | Ga0207676_12073637 | |||
| 1259 | Ga0207674_10051237 | |||
| 1260 | Ga0207674_10159823 | |||
| 1261 | Ga0207674_10200470 | |||
| 1262 | Ga0207674_10257473 | |||
| 1263 | Ga0207674_10998212 | |||
| 1264 | Ga0207675_100033169 | |||
| 1265 | Ga0207675_100503919 | |||
| 1266 | Ga0207675_100525727 | |||
| 1267 | Ga0207675_101003382 | |||
| 1268 | Ga0207683_10075015 | |||
| 1269 | Ga0207683_10298434 | |||
| 1270 | Ga0207698_10028188 | |||
| 1271 | Ga0207698_10224102 | |||
| 1272 | Ga0207698_11000901 | |||
| 1273 | Ga0209489_114058 | |||
| 1274 | Ga0209282_1011751 | |||
| 1275 | Ga0268266_10000060 | |||
| 1276 | Ga0268266_10347474 | |||
| 1277 | Ga0268265_10043355 | |||
| 1278 | Ga0268265_10133564 | |||
| 1279 | Ga0268264_10000175 | |||
| 1280 | Ga0268264_10002457 | |||
| 1281 | Ga0268264_10061921 | |||
| 1282 | Ga0268264_10128301 | |||
| 1283 | Ga0268264_10454190 | |||
| 1284 | Ga0268264_10485335 | |||
| 1285 | Ga0268264_10490604 | |||
| 1286 | Ga0268264_10501902 | |||
| 1287 | Ga0268264_11258856 | |||
| 1288 | Ga0268264_11989058 | |||
| 1289 | Ga0265338_10462911 | |||
| 1290 | Ga0316179_1000130 | |||
| 1291 | Ga0265327_10000031 | |||
| 1292 | Ga0265327_10467551 | |||
| 1293 | Ga0307513_10675953 | |||
| 1294 | Ga0307509_10954741 | |||
| 1295 | Ga0307408_100000481 | |||
| 1296 | Ga0307405_10327773 | |||
| 1297 | Ga0307413_10177152 | |||
| 1298 | Ga0307410_10000018 | |||
| 1299 | Ga0307406_10000171 | |||
| 1300 | Ga0307406_10001227 | |||
| 1301 | Ga0307406_10776148 | |||
| 1302 | Ga0307407_10096261 | |||
| 1303 | Ga0307407_11064737 | |||
| 1304 | Ga0307412_10001812 | |||
| 1305 | Ga0307412_10233753 | |||
| 1306 | Ga0307412_10701903 | |||
| 1307 | Ga0307409_102070604 | |||
| 1308 | Ga0307416_100000955 | |||
| 1309 | Ga0307416_100236492 | |||
| 1310 | Ga0307416_100455525 | |||
| 1311 | Ga0307416_102750313 | |||
| 1312 | Ga0307414_10000008 | |||
| 1313 | Ga0307414_10061286 | |||
| 1314 | Ga0307414_10066564 | |||
| 1315 | Ga0307414_10241783 | |||
| 1316 | Ga0307414_11141080 | |||
| 1317 | Ga0307411_10000008 | |||
| 1318 | Ga0307411_10004815 | |||
| 1319 | Ga0307411_10148067 | |||
| 1320 | Ga0307415_100509472 | |||
| 1321 | Ga0373938_0092517 | |||
| 1322 | Ga0373929_0119621 | |||
| 1323 | Ga0373941_0207651 | |||
| 1324 | Ga0373946_0340730 | |||
| 1325 | Ga0373961_0146694 | |||
| 1326 | Ga0373931_0404239 | |||
| 1327 | Ga0373935_1089906 | |||
| 1328 | Ga0373927_0005513 | |||
| 1329 | Ga0373947_0145111 | |||
| 1330 | Ga0373925_0001575 | |||
| 1331 | Ga0395899_0000040 | |||
| 1332 | Ga0436365_1058329 | |||
| 1333 | Ga0439447_006620 | |||
| 1334 | Ga0439466_0044957 | |||
| 1335 | Ga0439465_0028386 | |||
| 1336 | Ga0451791_0586514 | |||
| 1337 | Ga0451798_0178282 | |||
| 1338 | Ga0451802_1556064 | |||
| 1339 | Ga0451807_2576305 | |||
| 1340 | Ga0451837_0691837 | |||
| 1341 | Ga0451841_0107162 | |||
| 1342 | Ga0451841_0726177 | |||
| 1343 | Ga0451845_0770630 | |||
| 1344 | Ga0451843_0552928 | |||
| 1345 | Ga0451855_0355676 | |||
| 1346 | Ga0451853_2279928 | |||
| 1347 | Ga0451853_2382366 | |||
| 1348 | Ga0451577_0000179 | |||
| 1349 | Ga0451577_0002444 | |||
| 1350 | Ga0451577_0004275 | |||
| 1351 | Ga0451577_0086963 | |||
| 1352 | Ga0451577_0653898 | |||
| 1353 | Ga0451577_0655905 | |||
| 1354 | Ga0451577_0809693 | |||
| 1355 | Ga0466972_0005842 | |||
| 1356 | Ga0453683_0016706 | |||
| 1357 | Ga0453683_0036470 | |||
| 1358 | Ga0453684_0000033 | |||
| 1359 | Ga0453684_0005055 | |||
| 1360 | Ga0453684_0007112 | |||
| 1361 | Ga0453684_0148017 | |||
| 1362 | Ga0453684_0247003 | |||
| 1363 | Ga0451576_0000003 | |||
| 1364 | Ga0451576_0001481 | |||
| 1365 | Ga0451576_0004415 | |||
| 1366 | Ga0451576_0112400 | |||
| 1367 | Ga0451576_1208426 | |||
| 1368 | Ga0466967_0220951 | |||
| 1369 | Ga0495627_006222 | |||
| 1370 | Ga0495638_0234429 | |||
| 1371 | Ga0495582_0461364 | |||
| 1372 | Ga0495606_0007856 | |||
| 1373 | Ga0495630_0801382 | |||
| 1374 | Ga0495663_0001124 | |||
| 1375 | Ga0495586_0583449 | |||
| 1376 | Ga0495633_0289767 | |||
| 1377 | Ga0495611_0021462 | |||
| 1378 | Ga0495625_0257618 | |||
| 1379 | Ga0495613_0908126 | |||
| 1380 | Ga0495670_0439736 | |||
| 1381 | Ga0495649_0348026 | |||
| 1382 | Ga0495636_0000025 | |||
| 1383 | Ga0495672_0007222 | |||
| 1384 | Ga0495676_0184240 | |||
| 1385 | Ga0496104_0288337 | |||
| 1386 | Ga0496112_1059278 | |||
| 1387 | Ga0496114_0624226 | |||
| 1388 | Ga0496115_1456152 | |||
| 1389 | Ga0496117_0000618 | |||
| 1390 | Ga0496117_0139173 | |||
| 1391 | Ga0496118_0081732 | |||
| 1392 | Ga0496121_0534448 | |||
| 1393 | Ga0496122_0041880 | |||
| 1394 | Ga0496125_0004169 | |||
| 1395 | Ga0496126_0000737 | |||
| 1396 | Ga0496126_0028238 | |||
| 1397 | Ga0501031_0243921 | |||
| 1398 | Ga0501031_0336506 | |||
| 1399 | Ga0501033_0137748 | |||
| 1400 | Ga0501034_0003765 | |||
| 1401 | Ga0501034_0009675 | |||
| 1402 | Ga0501034_0306311 | |||
| 1403 | Ga0501034_0724236 | |||
| 1404 | Ga0501034_1037337 | |||
| 1405 | Ga0501034_1064456 | |||
| 1406 | Ga0501036_0096062 | |||
| 1407 | Ga0501036_0342326 | |||
| 1408 | Ga0501036_0852981 | |||
| 1409 | Ga0501038_0069900 | |||
| 1410 | Ga0501038_1282051 | |||
| 1411 | Ga0501039_0054166 | |||
| 1412 | Ga0501039_0450916 | |||
| 1413 | Ga0501040_0002720 | |||
| 1414 | Ga0501040_0064134 | |||
| 1415 | Ga0501041_0017052 | |||
| 1416 | Ga0501043_0387584 | |||
| 1417 | Ga0501046_0118279 | |||
| 1418 | Ga0501067_0015811 | |||
| 1419 | Ga0501067_0316816 | |||
| 1420 | Ga0501068_0041203 | |||
| 1421 | Ga0501069_0009079 | |||
| 1422 | Ga0501069_0191256 | |||
| 1423 | Ga0501070_0018495 | |||
| 1424 | Ga0501070_0084236 | |||
| 1425 | Ga0501070_0834992 | |||
| 1426 | Ga0501070_0947678 | |||
| 1427 | Ga0501071_0032827 | |||
| 1428 | Ga0501071_0047920 | |||
| 1429 | Ga0501071_0139888 | |||
| 1430 | Ga0501071_1207769 | |||
| 1431 | Ga0501072_0081780 | |||
| 1432 | Ga0501072_1605367 | |||
| 1433 | Ga0501073_0006596 | |||
| 1434 | Ga0501073_0075953 | |||
| 1435 | Ga0501073_0607763 | |||
| 1436 | Ga0501074_0216159 | |||
| 1437 | Ga0501074_0528081 | |||
| 1438 | Ga0501074_0920910 | |||
| 1439 | Ga0501075_0019345 | |||
| 1440 | Ga0501075_0028896 | |||
| 1441 | Ga0501076_0433041 | |||
| 1442 | Ga0501076_0785177 | |||
| 1443 | Ga0501076_0827313 | |||
| 1444 | Ga0501076_1603265 | |||
| 1445 | Ga0501077_0333967 | |||
| 1446 | Ga0501077_0421807 | |||
| 1447 | Ga0501259_050204 | |||
| 1448 | Ga0501261_026977 | |||
| 1449 | Ga0501079_1567903 | |||
| 1450 | Ga0501080_0023191 | |||
| 1451 | Ga0501080_0083244 | |||
| 1452 | Ga0501080_0520421 | |||
| 1453 | Ga0501081_0028432 | |||
| 1454 | Ga0501083_0047827 | |||
| 1455 | Ga0501083_0071798 | |||
| 1456 | Ga0501083_0104106 | |||
| 1457 | Ga0501083_0230893 | |||
| 1458 | Ga0501241_001809 | |||
| 1459 | Ga0501241_119787 | |||
| 1460 | Ga0501266_000004 | |||
| 1461 | Ga0501269_010167 | |||
| 1462 | Ga0501280_000847 | |||
| 1463 | Ga0501035_0556996 | |||
| 1464 | Ga0501045_0253280 | |||
| 1465 | nmdc:mga00v17_1338_c1 | |||
| 1466 | nmdc:mga0yw44_637247_c1 | |||
| 1467 | nmdc:mga0yw44_854959_c1 | |||
| 1468 | nmdc:mga0k408_128118_c1 | |||
| 1469 | nmdc:mga05p37_3491_c2 | |||
| 1470 | nmdc:mga05p37_748844_c1 | |||
| 1471 | nmdc:mga09592_1099382_c1 | |||
| 1472 | nmdc:mga08y16_1148100_c1 | |||
| 1473 | nmdc:mga08y16_1699626_c1 | |||
| 1474 | nmdc:mga08y16_552540_c1 | |||
| 1475 | nmdc:mga0n895_325214_c1 | |||
| 1476 | nmdc:mga0rr50_609395_c1 | |||
| 1477 | nmdc:mga0rr50_714278_c1 | |||
| 1478 | nmdc:mga0rr50_944110_c1 | |||
| 1479 | nmdc:mga08x19_1346249_c1 | |||
| 1480 | nmdc:mga0sz30_51443_c1 | |||
| 1481 | Ga0500643_000009 | |||
| 1482 | Ga0500643_068296 | |||
| 1483 | Ga0500643_081112 | |||
| 1484 | Ga0500644_0000682 | |||
| 1485 | Ga0500644_0002702 | |||
| 1486 | Ga0500644_0399863 | |||
| 1487 | Ga0500646_0028727 | |||
| 1488 | Ga0500646_0044538 | |||
| 1489 | Ga0500646_0050005 | |||
| 1490 | Ga0500583_0000084 | |||
| 1491 | Ga0500583_0000798 | |||
| 1492 | Ga0500583_0001253 | |||
| 1493 | Ga0500583_0047512 | |||
| 1494 | Ga0500641_0000003 | |||
| 1495 | Ga0500650_0111741 | |||
| 1496 | Ga0500562_000004 | |||
| 1497 | Ga0500658_0000009 | |||
| 1498 | Ga0500559_0022554 | |||
| 1499 | Ga0500559_0027012 | |||
| 1500 | Ga0500568_0000532 | |||
| 1501 | Ga0500568_0008028 | |||
| 1502 | Ga0500568_0196063 | |||
| 1503 | Ga0500573_0167869 | |||
| 1504 | Ga0500589_289441 | |||
| 1505 | Ga0500622_0002806 | |||
| 1506 | Ga0500622_0008787 | |||
| 1507 | Ga0500634_0032521 | |||
| 1508 | Ga0500611_011038 | |||
| 1509 | Ga0500645_004061 | |||
| 1510 | Ga0500645_157191 | |||
| 1511 | Ga0500587_060646 | |||
| 1512 | Ga0501084_0853563 | |||
| 1513 | Ga0501084_1125166 | |||
| 1514 | Ga0501084_1287643 | |||
| 1515 | Ga0501082_0036807 | |||
| 1516 | Ga0501082_0055123 | |||
| 1517 | Ga0501082_0674795 | |||
| 1518 | Ga0501082_0996436 | |||
| 1519 | Ga0530510_0006162 | |||
| 1520 | Ga0530510_0016925 | |||
| 1521 | 2644373396 | |||
| 1522 | 2644679066 | |||
| 1523 | 2644683518 | |||
| 1524 | 2730228563 | |||
| 1525 | 2738728484 | |||
| 1526 | 2738733508 | |||
| 1527 | 2738766046 | |||
| 1528 | 2739215089 | |||
| 1529 | 2740002188 | |||
| 1530 | 2740007004 | |||
| 1531 | 2740058408 | |||
| 1532 | 2747954443 | |||
| 1533 | 2787438502 | |||
| 1534 | 2802652597 | |||
| 1535 | 2817417164 | |||
| 1536 | 2857616073 | |||
| 1537 | 2857620161 | |||
| 1538 | 2881362891 | |||
| 1539 | 2881957219 | |||
| 1540 | 2902049993 | |||
| 1541 | 2903898110 | |||
| 1542 | 2904422262 | |||
| 1543 | 2919512830 | |||
| 1544 | 2919691409 | |||
| 1545 | 2929154938 | |||
| 1546 | 2929180200 | |||
| 1547 | 2945982604 | |||
| 1548 | 2946018000 | |||
| 1549 | 2958459331 | |||
| 1550 | 2958515711 | |||
| 1551 | 2977271307 | |||
| 1552 | 8055422768 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2i8d-assembly1.cif.gz_B | crystal structure of an uncharacterized conserved protein of cog5646 (zp_00384875.1) from lactobacillus casei atcc 334 at 1.69 a resolution | 0.7978 | 11 | 68 |
| 1q7h-assembly1.cif.gz_A | structure of a conserved pua domain protein from thermoplasma acidophilum | 0.7371 | 38 | 58 |
| 2kl4-assembly1.cif.gz_A | nmr structure of the protein nb7804a | 0.7316 | 11 | 114 |
| 2fki-assembly1.cif.gz_A | nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 | 0.7004 | 25 | 114 |
| 2oc6-assembly2.cif.gz_B | crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution | 0.6731 | 6 | 126 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FVG5_6_119_3.90.1150.200 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; | 0.8515 | 6 | 112 | 3.90.1150.200 |
| af_Q2FVG5_6_119_3.90.1150.200 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; | 0.7973 | 6 | 112 | 3.90.1150.200 |
| af_P0AF50_1_117_3.90.1150.30 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; | 0.7299 | 25 | 112 | 3.90.1150.30 |
| af_P0AAT2_2_121_3.90.1150.30 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; | 0.7105 | 20 | 112 | 3.90.1150.30 |
| 2oc6B01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; | 0.674 | 6 | 125 | 3.90.1150.200 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1M7IM37-F1-model_v4 | deleted | 0.9986 | 3 | 133 |
|
| AF-A0A1H5Y3J6-F1-model_v4 | deleted | 0.9968 | 43 | 133 |
|
| AF-A0A4Q1FE77-F1-model_v4 | Uncharacterized protein | 0.9964 | 5 | 133 |
|
| AF-A0A5C8IFL5-F1-model_v4 | DUF1801 domain-containing protein | 0.9955 | 22 | 131 |
|
| AF-A0A5M6ZQG1-F1-model_v4 | DUF1801 domain-containing protein | 0.9933 | 23 | 133 |
|