F480331

General Info

Members Datasets Scaffolds Average Seq Length
776 482 1553 116

Family's Representative Sequence

Representative Sequence 3300046474|Ga0495605_0014548|Ga0495605_0014548_1736_2128
Length 130
Sequence MAETTRELLTAGGWKDLVFEPFRQDVTIHWIKPFEGDQPGVALLKYEAGAAVPRHLHQGLETILVLEGTQSDETGDYGKGSYIVNAIGTEHSVWSDTGCVVLIQWDRPVRILEEEAAFGRLCSSGISRQR

Samples

Sample ID Description Type Environment
1 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
21 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
62 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
72 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
73 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
74 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
75 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
78 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
82 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
116 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
117 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
118 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
119 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
120 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
121 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
122 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
123 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
124 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
125 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
126 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
127 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
128 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
129 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
130 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
131 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
132 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
133 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
134 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
135 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
136 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
137 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
138 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
139 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
140 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
146 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
147 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
148 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
149 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
150 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
155 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
156 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
159 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
160 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
161 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
170 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
181 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
182 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
191 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
192 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
193 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
194 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
210 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
213 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
214 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
215 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
218 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
227 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
228 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
229 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
230 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
231 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
232 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
233 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
237 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
238 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
239 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
240 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
241 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
242 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
243 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
244 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
245 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
246 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
247 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
248 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
249 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
250 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
251 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
252 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
253 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
254 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
255 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
256 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
257 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
258 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
259 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
260 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
261 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
262 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
264 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
265 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
266 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
267 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
268 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
269 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
270 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
271 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
272 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
273 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
274 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
275 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
276 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
277 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
278 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
279 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
280 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
281 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
282 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
283 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
284 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
285 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
286 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
287 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
288 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
289 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
290 2519899620 Rhizobium sp. Pop5 Isolate Nodule
291 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
292 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
293 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
294 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
295 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
296 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
297 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
298 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
299 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
300 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
301 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
302 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
303 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
304 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
305 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
306 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
307 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
308 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
309 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
310 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
311 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
312 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
313 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
314 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
315 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
316 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
317 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
318 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
319 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
320 2643221558 Rhizobium sp. Root149 Isolate Unclassified
321 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
322 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
323 2643221719 Rhizobium sp. Root274 Isolate Unclassified
324 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
325 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
326 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
327 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
328 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
329 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
330 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
331 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
332 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
333 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
334 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
335 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
336 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
337 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
338 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
339 2738541293 Rhizobium sp. GV031 Isolate Unclassified
340 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
341 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
342 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
343 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
344 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
345 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
346 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
347 2791355260 Rhizobium sp. L9 Isolate Nodule
348 2791355261 Rhizobium sp. J15 Isolate Nodule
349 2791355263 Rhizobium chutanense C5 Isolate Nodule
350 2791355264 Rhizobium sp. S9 Isolate Nodule
351 2791355265 Rhizobium sp. H4 Isolate Nodule
352 2791355266 Rhizobium sp. L43 Isolate Nodule
353 2791355267 Rhizobium sp. L18 Isolate Nodule
354 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
355 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
356 2802429633 Rhizobium anhuiense J3 Isolate Nodule
357 2802429634 Rhizobium anhuiense S10 Isolate Nodule
358 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
359 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
360 2802429637 Rhizobium anhuiense C15 Isolate Nodule
361 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
362 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
363 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
364 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
365 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
366 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
367 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
368 2838048938 Rhizobium pisi 27/80 Isolate Nodule
369 2838061910 Rhizobium phaseoli L15 Isolate Nodule
370 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
371 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
372 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
373 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
374 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
375 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
376 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
377 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
378 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
379 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
380 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
381 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
382 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
383 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
384 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
385 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
386 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
387 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
388 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
389 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
390 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
391 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
392 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
393 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
394 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
395 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
396 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
397 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
398 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
399 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
400 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
401 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
402 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
403 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
404 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
405 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
406 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
407 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
408 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
409 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
410 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
411 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
412 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
413 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
414 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
415 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
416 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
417 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
418 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
419 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
420 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
421 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
422 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
423 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
424 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
425 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
426 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
427 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
428 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
429 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
430 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
431 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
432 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
433 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
434 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
435 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
436 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
437 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
438 2933599457 Rhizobium phaseoli M3 Isolate Nodule
439 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
440 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
441 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
442 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
443 2936381700 Rhizobium chutanense C16 Isolate Unclassified
444 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
445 2996887358 Rhizobium sp. R711 Isolate Nodule
446 2996893221 Rhizobium sp. R635 Isolate Nodule
447 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
448 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
449 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
450 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
451 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
452 8005258706 Rhizobium sp. R693 Isolate Nodule
453 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
454 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
455 8005321885 Rhizobium sp. R72 Isolate Nodule
456 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
457 8005382845 Rhizobium sp. R634 Isolate Nodule
458 8005395548 Rhizobium sp. R339 Isolate Nodule
459 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
460 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
461 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
462 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
463 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
464 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
465 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
466 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
467 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
468 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
469 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
470 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
471 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
472 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
473 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
474 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
475 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
476 8024501048 Rhizobium sp. H4 Isolate Nodule
477 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
478 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
479 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
480 8056382006 Rhizobium croatiense 13T Isolate Nodule
481 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
482 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 71.78
Metatranscriptomes 0
Isolates 28.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.51
Nodule 21.52
Rhizoplane 2.84
Rhizosphere 29.25
Stem 0
Stem Tuber 0
Unclassified 0.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495605_0014548 3300046474 Bacteria 4304
2 JGI24740J21852_10000003 3300001979 Bacteria 127453
3 JGI25155J39150_1000017 3300002704 Bacteria 159274
4 JGI25156J39149_1000034 3300002705 Bacteria 114036
5 JGI25162J39368_1000069 3300002737 Bacteria 125244
6 JGI25154J39366_1000034 3300002738 Bacteria 176764
7 JGI25158J39367_1000132 3300002739 Bacteria 17517
8 JGI25157J39369_1000092 3300002741 Bacteria 76674
9 JGI25152J39213_1001418 3300002773 Bacteria 10379
10 JGI25152J39213_1002382 3300002773 Bacteria 7195
11 JGI25152J39213_1005221 3300002773 Bacteria 3863
12 JGI25152J39213_1014529 3300002773 Bacteria 1593
13 JGI25152J39213_1051624 3300002773 Bacteria 534
14 JGI25152J39213_1051633 3300002773 Bacteria 534
15 JGI25150J39212_1000010 3300002774 Bacteria 236260
16 JGI25150J39212_1017894 3300002774 Bacteria 1137
17 JGI25159J45721_1000421 3300002987 Bacteria 19571
18 JGI25159J45721_1001354 3300002987 Bacteria 10259
19 JGI25151J46595_10000026 3300003187 Bacteria 211045
20 JGI25151J46595_10000383 3300003187 Bacteria 45964
21 JGI25151J46595_10093007 3300003187 Bacteria 834
22 JGI25165J46597_1000018 3300003214 Bacteria 374701
23 JGI25165J46597_1014227 3300003214 Bacteria 1085
24 JGI25153J46596_10000858 3300003215 Bacteria 18539
25 JGI25153J46596_10005939 3300003215 Bacteria 6292
26 JGI25153J46596_10013444 3300003215 Bacteria 3456
27 JGI25153J46596_10035348 3300003215 Bacteria 1620
28 JGI25153J46596_10090646 3300003215 Bacteria 739
29 JGI25153J46596_10102720 3300003215 Bacteria 670
30 JGI25153J46596_10137924 3300003215 Bacteria 534
31 JGI25153J46596_10137947 3300003215 Bacteria 534
32 rootH1_10016543 3300003316 Bacteria 1192
33 rootH1_10040367 3300003316 Bacteria 11432
34 rootH2_10083368 3300003320 Bacteria 2788
35 rootL2_10009173 3300003322 Bacteria 30207
36 rootL2_10070897 3300003322 Bacteria 1605
37 rootH1_10020310 3300003316 Bacteria 3119
38 rootH1_10020310 3300003323 Bacteria 4096
39 JGI25160J50197_1000599 3300003354 Bacteria 20168
40 JGI25160J50197_1003370 3300003354 Bacteria 7165
41 JGI25160J50197_1004142 3300003354 Bacteria 6320
42 JGI25160J50197_1034304 3300003354 Bacteria 1262
43 JGI25160J50197_1038120 3300003354 Bacteria 1142
44 JGI25161J50226_1000050 3300003374 Bacteria 110628
45 JGI25161J50226_1000424 3300003374 Bacteria 20168
46 JGI25161J50226_1002379 3300003374 Bacteria 4846
47 Ga0055539_1022794 3300003752 Bacteria 738
48 Ga0055526_1000661 3300003771 Bacteria 26488
49 Ga0055526_1001610 3300003771 Bacteria 15842
50 Ga0055526_1002306 3300003771 Bacteria 13015
51 Ga0055526_1007407 3300003771 Bacteria 5709
52 Ga0055526_1017301 3300003771 Bacteria 2760
53 Ga0055526_1021612 3300003771 Bacteria 2229
54 Ga0055526_1031463 3300003771 Bacteria 1520
55 Ga0055524_1000936 3300003775 Bacteria 18722
56 Ga0055524_1001468 3300003775 Bacteria 13460
57 Ga0055524_1002754 3300003775 Bacteria 8838
58 Ga0055524_1005288 3300003775 Bacteria 5796
59 Ga0055524_1045897 3300003775 Bacteria 1045
60 Ga0055536_1001115 3300003781 Bacteria 16861
61 Ga0055528_1000096 3300003790 Bacteria 70375
62 Ga0055528_1000681 3300003790 Bacteria 24503
63 Ga0055528_1003470 3300003790 Bacteria 7879
64 Ga0055528_1009316 3300003790 Bacteria 4112
65 Ga0055528_1009508 3300003790 Bacteria 4051
66 Ga0055528_1009927 3300003790 Bacteria 3927
67 Ga0055528_1027264 3300003790 Bacteria 1614
68 Ga0055528_1060574 3300003790 Bacteria 717
69 Ga0055530_10028614 3300003791 Bacteria 1501
70 Ga0055540_1000728 3300003792 Bacteria 22432
71 Ga0055540_1009933 3300003792 Bacteria 3219
72 Ga0055540_1018639 3300003792 Bacteria 1896
73 Ga0055540_1020467 3300003792 Bacteria 1748
74 Ga0055540_1039119 3300003792 Bacteria 1035
75 Ga0055531_10005662 3300003794 Bacteria 7258
76 Ga0055543_1000023 3300004625 Bacteria 140513
77 Ga0055543_1000576 3300004625 Bacteria 20206
78 Ga0055543_1004138 3300004625 Bacteria 4033
79 Ga0055543_1005969 3300004625 Bacteria 3024
80 Ga0055543_1067750 3300004625 Bacteria 564
81 Ga0065165_1002596 3300005262 Bacteria 14818
82 Ga0065165_1021771 3300005262 Bacteria 2216
83 Ga0065165_1024177 3300005262 Bacteria 2046
84 Ga0065165_1147045 3300005262 Bacteria 552
85 Ga0065165_1147375 3300005262 Bacteria 551
86 Ga0070658_10441811 3300005327 Bacteria 1120
87 Ga0070670_100036429 3300005331 Bacteria 4234
88 Ga0070666_10253898 3300005335 Bacteria 1245
89 Ga0070661_101755997 3300005344 Bacteria 526
90 Ga0070667_100276016 3300005367 Bacteria 1508
91 Ga0070663_101742622 3300005455 Bacteria 557
92 Ga0070665_100014876 3300005548 Bacteria 7810
93 Ga0068855_100236734 3300005563 Bacteria 2041
94 Ga0068854_100030411 3300005578 Bacteria 3746
95 Ga0068851_10031766 3300005834 Bacteria 2624
96 Ga0068862_101679203 3300005844 Bacteria 643
97 Ga0075365_10004903 3300006038 Bacteria 7153
98 Ga0075365_10019303 3300006038 Bacteria 4206
99 Ga0075365_10082343 3300006038 Bacteria 2182
100 Ga0075368_10146953 3300006042 Bacteria 984
101 Ga0075363_100157737 3300006048 Bacteria 1284
102 Ga0075363_100783544 3300006048 Bacteria 579
103 Ga0075362_10000551 3300006177 Bacteria 10907
104 Ga0075362_10397088 3300006177 Bacteria 695
105 Ga0075367_10395603 3300006178 Bacteria 874
106 Ga0075369_10003191 3300006186 Bacteria 5947
107 Ga0075369_10016631 3300006186 Bacteria 2971
108 Ga0075369_10122672 3300006186 Bacteria 1177
109 Ga0075366_10919346 3300006195 Bacteria 545
110 Ga0075370_10209622 3300006353 Bacteria 1150
111 Ga0075370_10679738 3300006353 Bacteria 625
112 Ga0075370_10702873 3300006353 Bacteria 615
113 Ga0075370_10989941 3300006353 Bacteria 515
114 Ga0105251_10110680 3300009011 Bacteria 1251
115 Ga0105244_10102659 3300009036 Bacteria 1397
116 Ga0105244_10291259 3300009036 Bacteria 756
117 Ga0105250_10162888 3300009092 Bacteria 932
118 Ga0105240_10000240 3300009093 Bacteria 109195
119 Ga0105247_10322250 3300009101 Bacteria 1079
120 Ga0105247_10478878 3300009101 Bacteria 903
121 Ga0105243_10167213 3300009148 Bacteria 1902
122 Ga0105248_10183848 3300009177 Bacteria 2356
123 Ga0105248_11044148 3300009177 Bacteria 923
124 Ga0105237_10003272 3300009545 Bacteria 19351
125 Ga0105238_12517054 3300009551 Bacteria 551
126 Ga0123342_1012677 3300009766 Bacteria 8698
127 Ga0123342_1016141 3300009766 Bacteria 6571
128 Ga0105239_10021907 3300010375 Bacteria 7044
129 Ga0157322_1000796 3300012490 Bacteria 1347
130 Ga0157327_1080255 3300012512 Bacteria 523
131 Ga0157373_10129215 3300013100 Bacteria 1776
132 Ga0157373_10944156 3300013100 Unclassified 641
133 Ga0157370_10001696 3300013104 Bacteria 27110
134 Ga0157369_10380172 3300013105 Bacteria 1466
135 Ga0157378_10657127 3300013297 Bacteria 1064
136 Ga0182008_10018574 3300014497 Bacteria 3599
137 Ga0182007_10000406 3300015262 Bacteria 26542
138 Ga0182005_1006240 3300015265 Bacteria 3661
139 Ga0163161_10544431 3300017792 Bacteria 951
140 Ga0214544_1000906 3300021320 Bacteria 58379
141 Ga0214542_1000400 3300021321 Bacteria 76349
142 Ga0214543_1000019 3300021327 Bacteria 267908
143 Ga0209435_100023 3300025206 Bacteria 201972
144 Ga0209436_100031 3300025208 Bacteria 82827
145 Ga0209437_100022 3300025233 Bacteria 625694
146 Ga0207425_1000010 3300025245 Bacteria 572898
147 Ga0207425_1004436 3300025245 Bacteria 4208
148 Ga0207425_1005593 3300025245 Bacteria 3559
149 Ga0207425_1016108 3300025245 Bacteria 1664
150 Ga0209646_1000080 3300025246 Bacteria 201975
151 Ga0209646_1043672 3300025246 Bacteria 556
152 Ga0209026_1000076 3300025250 Bacteria 201975
153 Ga0209677_100499 3300025253 Bacteria 22078
154 Ga0209759_1000059 3300025256 Bacteria 201975
155 Ga0209129_1000197 3300025258 Bacteria 78908
156 Ga0209129_1000625 3300025258 Bacteria 23733
157 Ga0209129_1001067 3300025258 Bacteria 16195
158 Ga0209129_1001986 3300025258 Bacteria 10630
159 Ga0209129_1005724 3300025258 Bacteria 4276
160 Ga0209129_1005870 3300025258 Bacteria 4171
161 Ga0209129_1018438 3300025258 Bacteria 1340
162 Ga0209233_1000031 3300025261 Bacteria 624646
163 Ga0209233_1000203 3300025261 Bacteria 118984
164 Ga0209565_1021431 3300025263 Bacteria 1351
165 Ga0209673_1000063 3300025273 Bacteria 256709
166 Ga0209673_1000252 3300025273 Bacteria 101552
167 Ga0209673_1003927 3300025273 Bacteria 8335
168 Ga0209673_1005480 3300025273 Bacteria 6362
169 Ga0209673_1006322 3300025273 Bacteria 5747
170 Ga0209673_1010561 3300025273 Bacteria 3880
171 Ga0209673_1017618 3300025273 Bacteria 2628
172 Ga0209673_1031851 3300025273 Bacteria 1633
173 Ga0209130_1000031 3300025284 Bacteria 322932
174 Ga0209130_1001091 3300025284 Bacteria 20220
175 Ga0209130_1025614 3300025284 Bacteria 1275
176 Ga0209130_1027836 3300025284 Bacteria 1195
177 Ga0209675_1054312 3300025291 Bacteria 814
178 Ga0209676_1002049 3300025292 Bacteria 15759
179 Ga0209676_1005325 3300025292 Bacteria 6777
180 Ga0209676_1039289 3300025292 Bacteria 1346
181 Ga0209025_1000022 3300025294 Bacteria 574487
182 Ga0209025_1000397 3300025294 Bacteria 89703
183 Ga0209025_1002306 3300025294 Bacteria 20689
184 Ga0209025_1016728 3300025294 Bacteria 4297
185 Ga0209025_1020329 3300025294 Bacteria 3638
186 Ga0209025_1044394 3300025294 Bacteria 1858
187 Ga0209564_1000482 3300025295 Bacteria 66363
188 Ga0209564_1000511 3300025295 Bacteria 63773
189 Ga0209564_1000586 3300025295 Bacteria 57490
190 Ga0209564_1002586 3300025295 Bacteria 13890
191 Ga0209564_1010499 3300025295 Bacteria 4257
192 Ga0209564_1019663 3300025295 Bacteria 2513
193 Ga0209758_1000086 3300025297 Bacteria 254778
194 Ga0209758_1000585 3300025297 Bacteria 56861
195 Ga0209758_1000688 3300025297 Bacteria 50116
196 Ga0209758_1001274 3300025297 Bacteria 31178
197 Ga0209758_1014554 3300025297 Bacteria 4171
198 Ga0209758_1014603 3300025297 Bacteria 4160
199 Ga0209758_1019485 3300025297 Bacteria 3268
200 Ga0209758_1022160 3300025297 Bacteria 2928
201 Ga0209758_1029954 3300025297 Bacteria 2263
202 Ga0209758_1051251 3300025297 Bacteria 1438
203 Ga0209758_1052275 3300025297 Bacteria 1415
204 Ga0209758_1060846 3300025297 Bacteria 1248
205 Ga0209050_1005653 3300025298 Bacteria 7741
206 Ga0209050_1020198 3300025298 Bacteria 2489
207 Ga0209256_1000786 3300025299 Bacteria 40946
208 Ga0209256_1002344 3300025299 Bacteria 15777
209 Ga0209256_1005287 3300025299 Bacteria 7521
210 Ga0209256_1005765 3300025299 Bacteria 6918
211 Ga0209256_1036117 3300025299 Bacteria 1299
212 Ga0209256_1041953 3300025299 Bacteria 1159
213 Ga0209256_1062509 3300025299 Bacteria 862
214 Ga0209256_1087814 3300025299 Bacteria 667
215 Ga0209256_1104670 3300025299 Bacteria 580
216 Ga0209256_1112501 3300025299 Bacteria 545
217 Ga0207426_1000042 3300025302 Bacteria 433289
218 Ga0207426_1000200 3300025302 Bacteria 144028
219 Ga0207426_1000355 3300025302 Bacteria 83450
220 Ga0207426_1002795 3300025302 Bacteria 10477
221 Ga0207426_1053245 3300025302 Bacteria 1195
222 Ga0209051_1000038 3300025303 Bacteria 320926
223 Ga0209051_1002500 3300025303 Bacteria 13097
224 Ga0209051_1007982 3300025303 Bacteria 5683
225 Ga0209051_1104225 3300025303 Bacteria 755
226 Ga0209257_1017762 3300025304 Bacteria 2783
227 Ga0209257_1099623 3300025304 Bacteria 711
228 Ga0207656_10095355 3300025321 Bacteria 1356
229 Ga0207647_10554759 3300025904 Bacteria 637
230 Ga0207695_10000118 3300025913 Bacteria 237085
231 Ga0207671_10000410 3300025914 Bacteria 60046
232 Ga0207650_10001958 3300025925 Bacteria 14473
233 Ga0207709_10579501 3300025935 Bacteria 886
234 Ga0207711_10113169 3300025941 Bacteria 2416
235 Ga0207667_10914406 3300025949 Bacteria 869
236 Ga0207668_10601671 3300025972 Bacteria 958
237 Ga0209813_10288423 3300027866 Bacteria 634
238 Ga0268266_10203661 3300028379 Bacteria 1812
239 Ga0307515_10000375 3300028794 Bacteria 109285
240 Ga0307515_10013166 3300028794 Bacteria 15476
241 Ga0307515_10017859 3300028794 Bacteria 12890
242 Ga0307513_10000335 3300031456 Bacteria 67961
243 Ga0307513_10007331 3300031456 Bacteria 14320
244 Ga0307408_100447129 3300031548 Bacteria 1120
245 Ga0307408_101127243 3300031548 Bacteria 729
246 Ga0307405_10003524 3300031731 Bacteria 7211
247 Ga0307406_10018684 3300031901 Bacteria 4054
248 Ga0307412_10235347 3300031911 Bacteria 1413
249 Ga0307414_12087186 3300032004 Bacteria 529
250 Ga0439436_0051800 3300041404 Bacteria 1158
251 Ga0439438_062811 3300041405 Bacteria 928
252 Ga0439447_023188 3300041407 Bacteria 1619
253 Ga0439466_0046196 3300041411 Bacteria 1439
254 Ga0439465_0001359 3300041413 Bacteria 7878
255 Ga0439465_0012292 3300041413 Bacteria 2679
256 Ga0439465_0018277 3300041413 Bacteria 2191
257 Ga0451787_496533 3300041441 Bacteria 1693
258 Ga0451789_1098931 3300041443 Bacteria 1516
259 Ga0451793_0819188 3300041452 Bacteria 1094
260 Ga0451798_0885988 3300041458 Bacteria 1356
261 Ga0451802_1466569 3300041460 Bacteria 1192
262 Ga0451833_0146614 3300041491 Bacteria 3098
263 Ga0451833_0611857 3300041491 Bacteria 1302
264 Ga0451837_0143144 3300041494 Bacteria 2176
265 Ga0451837_1297148 3300041494 Bacteria 1280
266 Ga0451839_0678247 3300041496 Bacteria 2947
267 Ga0451839_1595413 3300041496 Bacteria 565
268 Ga0451841_0305811 3300041498 Bacteria 2100
269 Ga0451847_0140318 3300041503 Bacteria 1281
270 Ga0451847_0707496 3300041503 Bacteria 2218
271 Ga0451849_0597870 3300041505 Bacteria 1295
272 Ga0451851_0868248 3300041507 Bacteria 1110
273 Ga0451851_0972318 3300041507 Bacteria 2272
274 Ga0451843_0515827 3300041509 Bacteria 695
275 Ga0451843_0541337 3300041509 Bacteria 4447
276 Ga0451855_0815332 3300041511 Bacteria 703
277 Ga0451853_0630923 3300041512 Bacteria 1605
278 Ga0451853_3746137 3300041512 Bacteria 824
279 Ga0439449_0029950 3300042007 Bacteria 2028
280 Ga0450919_017637 3300042121 Bacteria 805
281 Ga0450920_010004 3300042122 Bacteria 1754
282 Ga0450906_002063 3300042145 Bacteria 4392
283 Ga0450918_034223 3300042531 Bacteria 902
284 Ga0495627_115648 3300046453 Bacteria 759
285 Ga0495592_0135462 3300046454 Bacteria 1718
286 Ga0495629_0155593 3300046459 Bacteria 1588
287 Ga0495638_0000084 3300046460 Bacteria 153168
288 Ga0495638_0000420 3300046460 Bacteria 51327
289 Ga0495638_0105980 3300046460 Bacteria 1675
290 Ga0495653_0829829 3300046463 Bacteria 554
291 Ga0495650_0017101 3300046471 Bacteria 3647
292 Ga0495650_0022686 3300046471 Bacteria 3007
293 Ga0495650_0072982 3300046471 Bacteria 1342
294 Ga0495605_0018386 3300046474 Bacteria 3747
295 Ga0495639_0142964 3300046475 Bacteria 1151
296 Ga0495662_0001314 3300046476 Bacteria 12303
297 Ga0495664_0109113 3300046477 Bacteria 1670
298 Ga0495584_0231810 3300046491 Bacteria 939
299 Ga0495585_0006217 3300046492 Bacteria 7439
300 Ga0495585_0072173 3300046492 Bacteria 1881
301 Ga0495607_0037149 3300046501 Bacteria 2927
302 Ga0495607_0089125 3300046501 Bacteria 1675
303 Ga0495607_0129012 3300046501 Bacteria 1318
304 Ga0495607_0226581 3300046501 Bacteria 911
305 Ga0495607_0344494 3300046501 Bacteria 689
306 Ga0495583_0004969 3300046506 Bacteria 9228
307 Ga0495583_0011616 3300046506 Bacteria 5046
308 Ga0495583_0021146 3300046506 Bacteria 3352
309 Ga0495606_0000848 3300046507 Bacteria 45957
310 Ga0495606_0004464 3300046507 Bacteria 13955
311 Ga0495606_0086935 3300046507 Bacteria 1931
312 Ga0495606_0138583 3300046507 Bacteria 1439
313 Ga0495606_0190090 3300046507 Bacteria 1177
314 Ga0495610_0000694 3300046512 Bacteria 32397
315 Ga0495610_0010647 3300046512 Bacteria 5696
316 Ga0495610_0180434 3300046512 Bacteria 878
317 Ga0495610_0241339 3300046512 Bacteria 720
318 Ga0495616_0066349 3300046513 Bacteria 1756
319 Ga0495616_0216754 3300046513 Bacteria 835
320 Ga0495620_0011307 3300046515 Bacteria 4657
321 Ga0495620_0014856 3300046515 Bacteria 3947
322 Ga0495620_0036518 3300046515 Bacteria 2198
323 Ga0495620_0108977 3300046515 Bacteria 1099
324 Ga0495628_1009529 3300046516 Bacteria 572
325 Ga0495631_0008921 3300046518 Bacteria 5029
326 Ga0495631_0041639 3300046518 Bacteria 2032
327 Ga0495631_0076886 3300046518 Bacteria 1440
328 Ga0495632_0004193 3300046519 Bacteria 9860
329 Ga0495632_0022250 3300046519 Bacteria 3400
330 Ga0495632_0166049 3300046519 Bacteria 1015
331 Ga0495637_0007239 3300046520 Bacteria 5518
332 Ga0495643_0003806 3300046522 Bacteria 10904
333 Ga0495643_0007745 3300046522 Bacteria 6877
334 Ga0495643_0010332 3300046522 Bacteria 5747
335 Ga0495643_0032932 3300046522 Bacteria 2871
336 Ga0495643_0089349 3300046522 Bacteria 1591
337 Ga0495648_0013425 3300046524 Bacteria 6057
338 Ga0495648_0014179 3300046524 Bacteria 5848
339 Ga0495648_0071036 3300046524 Bacteria 2020
340 Ga0495663_0001716 3300046525 Bacteria 6806
341 Ga0495652_0078663 3300046529 Bacteria 2729
342 Ga0495654_0000114 3300046530 Bacteria 91751
343 Ga0495640_0235010 3300046533 Bacteria 1152
344 Ga0495587_0170504 3300046536 Bacteria 1236
345 Ga0495609_0027131 3300046538 Bacteria 2619
346 Ga0495609_0161450 3300046538 Bacteria 949
347 Ga0495597_0044037 3300046542 Bacteria 1985
348 Ga0495633_0004140 3300046558 Bacteria 9326
349 Ga0495656_0028607 3300046615 Bacteria 2237
350 Ga0495656_0052905 3300046615 Bacteria 1743
351 Ga0495668_0003832 3300046616 Bacteria 11012
352 Ga0495668_0056851 3300046616 Bacteria 2159
353 Ga0495668_0185231 3300046616 Bacteria 1140
354 Ga0495611_0024632 3300046648 Bacteria 2619
355 Ga0495625_0009342 3300046660 Bacteria 8214
356 Ga0495625_0015205 3300046660 Bacteria 6105
357 Ga0495625_0059273 3300046660 Bacteria 2716
358 Ga0495625_0176621 3300046660 Bacteria 1423
359 Ga0495625_0340039 3300046660 Bacteria 951
360 Ga0495625_0653791 3300046660 Bacteria 625
361 Ga0495661_0179773 3300046665 Bacteria 1122
362 Ga0495588_0000378 3300046674 Bacteria 25869
363 Ga0495588_0281046 3300046674 Bacteria 877
364 Ga0495588_0511565 3300046674 Bacteria 629
365 Ga0495657_0194627 3300046675 Bacteria 1238
366 Ga0495658_0015634 3300046683 Bacteria 3895
367 Ga0495670_0014478 3300046691 Bacteria 3878
368 Ga0495670_0108305 3300046691 Bacteria 1436
369 Ga0495671_0000867 3300046692 Bacteria 21672
370 Ga0495671_0054422 3300046692 Bacteria 1984
371 Ga0495671_0256497 3300046692 Bacteria 844
372 Ga0495671_0314018 3300046692 Bacteria 753
373 Ga0495649_0018726 3300046694 Bacteria 3890
374 Ga0495649_0033601 3300046694 Bacteria 2823
375 Ga0495649_0043522 3300046694 Bacteria 2451
376 Ga0495589_0039636 3300046794 Bacteria 2354
377 Ga0495600_0076570 3300046809 Bacteria 2184
378 Ga0495660_0087704 3300046810 Bacteria 1622
379 Ga0495660_0161377 3300046810 Bacteria 1099
380 Ga0495660_0200618 3300046810 Bacteria 952
381 Ga0495604_0194220 3300047317 Bacteria 1412
382 Ga0495636_0047695 3300047318 Bacteria 1789
383 Ga0495636_0057672 3300047318 Bacteria 1636
384 Ga0495674_0285533 3300047319 Bacteria 1351
385 Ga0495672_0023628 3300047320 Bacteria 3975
386 Ga0495676_0505585 3300047321 Bacteria 793
387 Ga0495683_0128552 3300047323 Bacteria 1197
388 Ga0495687_006530 3300047443 Bacteria 7125
389 Ga0495687_066046 3300047443 Bacteria 1470
390 Ga0495685_024438 3300047447 Bacteria 2080
391 Ga0495673_0068514 3300047469 Bacteria 1499
392 Ga0495673_0109708 3300047469 Bacteria 1105
393 Ga0495681_0000678 3300047470 Bacteria 25887
394 Ga0495681_0021104 3300047470 Bacteria 3516
395 Ga0495681_0053765 3300047470 Bacteria 1884
396 Ga0495681_0058730 3300047470 Bacteria 1781
397 Ga0495681_0337402 3300047470 Bacteria 576
398 Ga0495686_0000296 3300047472 Bacteria 86346
399 Ga0495686_0011203 3300047472 Bacteria 6327
400 Ga0495686_0022801 3300047472 Bacteria 4137
401 Ga0495686_0240160 3300047472 Bacteria 1022
402 Ga0495686_0377466 3300047472 Bacteria 765
403 Ga0495626_0071269 3300048091 Bacteria 1562
404 Ga0495626_0273955 3300048091 Bacteria 672
405 Ga0496100_0040378 3300048903 Bacteria 2968
406 Ga0496100_0518902 3300048903 Bacteria 919
407 Ga0496100_0829165 3300048903 Bacteria 725
408 Ga0496102_0016095 3300048905 Bacteria 6530
409 Ga0496102_0083303 3300048905 Bacteria 2951
410 Ga0496103_0020495 3300048906 Bacteria 3971
411 Ga0496104_0585150 3300048907 Bacteria 1026
412 Ga0496105_0208532 3300048908 Bacteria 1593
413 Ga0496106_0001056 3300048909 Bacteria 20286
414 Ga0496106_0265173 3300048909 Bacteria 1375
415 Ga0496106_1565609 3300048909 Bacteria 506
416 Ga0496107_0219298 3300048910 Bacteria 1415
417 Ga0496110_0154656 3300048913 Bacteria 2077
418 Ga0496110_0885243 3300048913 Bacteria 799
419 Ga0496113_0026868 3300048916 Bacteria 4120
420 Ga0496116_0003396 3300048919 Bacteria 15767
421 Ga0496116_0013786 3300048919 Bacteria 6493
422 Ga0496116_0020125 3300048919 Bacteria 5079
423 Ga0496116_0030645 3300048919 Bacteria 3861
424 Ga0496116_0040659 3300048919 Bacteria 3199
425 Ga0496117_0001380 3300048920 Bacteria 35320
426 Ga0496117_0012124 3300048920 Bacteria 7643
427 Ga0496117_0013898 3300048920 Bacteria 6979
428 Ga0496117_0019559 3300048920 Bacteria 5557
429 Ga0496117_0092120 3300048920 Bacteria 1948
430 Ga0496118_0001922 3300048921 Bacteria 29492
431 Ga0496118_0006564 3300048921 Bacteria 12721
432 Ga0496118_0021379 3300048921 Bacteria 5697
433 Ga0496118_0022580 3300048921 Bacteria 5494
434 Ga0496118_0064044 3300048921 Bacteria 2701
435 Ga0496118_0152397 3300048921 Bacteria 1445
436 Ga0496119_0014776 3300048922 Bacteria 6077
437 Ga0496119_0017450 3300048922 Bacteria 5395
438 Ga0496119_0018901 3300048922 Bacteria 5103
439 Ga0496119_0042973 3300048922 Bacteria 2861
440 Ga0496119_0079060 3300048922 Bacteria 1901
441 Ga0496119_0477244 3300048922 Bacteria 583
442 Ga0496120_0018031 3300048923 Bacteria 4560
443 Ga0496120_0022015 3300048923 Bacteria 4015
444 Ga0496120_0037056 3300048923 Bacteria 2898
445 Ga0496120_0135362 3300048923 Bacteria 1257
446 Ga0496121_0001817 3300048924 Bacteria 34409
447 Ga0496121_0004588 3300048924 Bacteria 18420
448 Ga0496121_0022112 3300048924 Bacteria 6188
449 Ga0496121_0031641 3300048924 Bacteria 4829
450 Ga0496121_0051672 3300048924 Bacteria 3459
451 Ga0496121_0072426 3300048924 Bacteria 2766
452 Ga0496121_0158055 3300048924 Bacteria 1661
453 Ga0496121_0176053 3300048924 Bacteria 1549
454 Ga0496121_0300282 3300048924 Bacteria 1090
455 Ga0496121_0310114 3300048924 Bacteria 1067
456 Ga0496122_0006070 3300048925 Bacteria 14077
457 Ga0496122_0022093 3300048925 Bacteria 5668
458 Ga0496122_0047377 3300048925 Bacteria 3319
459 Ga0496122_0051586 3300048925 Bacteria 3124
460 Ga0496122_0085855 3300048925 Bacteria 2169
461 Ga0496122_0324758 3300048925 Bacteria 816
462 Ga0496122_0326723 3300048925 Bacteria 812
463 Ga0496123_0004386 3300048926 Bacteria 14875
464 Ga0496123_0015998 3300048926 Bacteria 6116
465 Ga0496123_0019205 3300048926 Bacteria 5394
466 Ga0496123_0023238 3300048926 Bacteria 4749
467 Ga0496123_0048989 3300048926 Bacteria 2837
468 Ga0496124_0004324 3300048927 Bacteria 16651
469 Ga0496124_0006892 3300048927 Bacteria 12211
470 Ga0496124_0010829 3300048927 Bacteria 9184
471 Ga0496124_0013839 3300048927 Bacteria 7846
472 Ga0496124_0048309 3300048927 Bacteria 3637
473 Ga0496124_0049581 3300048927 Bacteria 3581
474 Ga0496124_0066739 3300048927 Bacteria 2995
475 Ga0496124_0145019 3300048927 Bacteria 1869
476 Ga0496124_0171846 3300048927 Bacteria 1677
477 Ga0496125_0004658 3300048928 Bacteria 15641
478 Ga0496125_0032139 3300048928 Bacteria 4665
479 Ga0496125_0032561 3300048928 Bacteria 4630
480 Ga0496125_0056456 3300048928 Bacteria 3188
481 Ga0496125_0335939 3300048928 Bacteria 909
482 Ga0496126_0042292 3300048929 Bacteria 4209
483 Ga0496126_0371164 3300048929 Bacteria 1166
484 Ga0495678_001350 3300049459 Bacteria 19638
485 Ga0495678_026013 3300049459 Bacteria 2505
486 Ga0495678_106515 3300049459 Bacteria 963
487 Ga0495682_0005253 3300049460 Bacteria 5412
488 Ga0495682_0025279 3300049460 Bacteria 2211
489 Ga0501032_0050994 3300049569 Bacteria 2790
490 Ga0501034_0043885 3300049571 Bacteria 4522
491 Ga0501036_1064638 3300049572 Bacteria 661
492 Ga0501046_0047291 3300049580 Bacteria 3411
493 Ga0501047_0142028 3300049581 Bacteria 2279
494 Ga0501068_0052620 3300049584 Bacteria 2464
495 Ga0501080_1882106 3300049742 Bacteria 501
496 Ga0501280_041395 3300049776 Bacteria 748
497 nmdc:mga03n38_344896_c1 3300050490 Bacteria 809
498 nmdc:mga03n38_661507_c1 3300050490 Bacteria 599
499 nmdc:mga0yw44_1019742_c1 3300050492 Bacteria 560
500 nmdc:mga0yw44_1123799_c1 3300050492 Bacteria 531
501 nmdc:mga0yw44_18982_c1 3300050492 Bacteria 3781
502 nmdc:mga0yw44_23732_c1 3300050492 Bacteria 3460
503 nmdc:mga0k408_58320_c1 3300050493 Bacteria 2242
504 nmdc:mga06z11_62685_c1 3300050494 Bacteria 1943
505 nmdc:mga04h51_30035_c1 3300050495 Bacteria 1707
506 nmdc:mga07m45_196919_c1 3300050496 Bacteria 1172
507 nmdc:mga07m45_292243_c1 3300050496 Bacteria 948
508 nmdc:mga07m45_352003_c1 3300050496 Bacteria 856
509 nmdc:mga0sz30_174151_c1 3300050516 Bacteria 954
510 nmdc:mga0sz30_51978_c1 3300050516 Bacteria 1739
511 nmdc:mga0sz30_7667_c1 3300050516 Bacteria 4052
512 Ga0495601_0512867 3300053077 Bacteria 773
513 Ga0500610_0007217 3300053079 Bacteria 4741
514 Ga0500610_0179008 3300053079 Bacteria 1040
515 Ga0495619_0174917 3300053085 Bacteria 1485
516 Ga0500578_0146576 3300053086 Bacteria 1472
517 Ga0500578_0363556 3300053086 Bacteria 843
518 Ga0500646_0332573 3300053090 Bacteria 551
519 Ga0500651_0418622 3300053093 Bacteria 750
520 Ga0500566_0457030 3300053094 Bacteria 558
521 Ga0500555_110014 3300053103 Bacteria 694
522 Ga0500569_336813 3300053109 Bacteria 503
523 Ga0500572_057416 3300053111 Bacteria 1175
524 Ga0500572_163371 3300053111 Bacteria 729
525 Ga0500594_0003798 3300053118 Bacteria 3323
526 Ga0500594_0035474 3300053118 Bacteria 1338
527 Ga0500608_071714 3300053122 Bacteria 1646
528 Ga0500608_164039 3300053122 Bacteria 960
529 Ga0500614_061029 3300053123 Bacteria 1014
530 Ga0500618_000031 3300053125 Bacteria 129550
531 Ga0500618_000296 3300053125 Bacteria 37750
532 Ga0500618_013202 3300053125 Bacteria 2143
533 Ga0500621_205605 3300053126 Bacteria 694
534 Ga0500658_0000877 3300053134 Bacteria 12346
535 Ga0500658_0007391 3300053134 Bacteria 4058
536 Ga0500658_0035803 3300053134 Bacteria 1967
537 Ga0500559_0522051 3300053136 Bacteria 544
538 Ga0500568_0000200 3300053139 Bacteria 52499
539 Ga0500568_0002409 3300053139 Bacteria 11035
540 Ga0500568_0384752 3300053139 Bacteria 508
541 Ga0500577_0188286 3300053142 Bacteria 887
542 Ga0500588_0282182 3300053146 Bacteria 627
543 Ga0500590_000137 3300053148 Bacteria 20276
544 Ga0500604_0032854 3300053151 Bacteria 1531
545 Ga0500616_0000102 3300053153 Bacteria 168834
546 Ga0500616_0000795 3300053153 Bacteria 36180
547 Ga0500616_0004137 3300053153 Bacteria 10499
548 Ga0500620_226901 3300053155 Bacteria 629
549 Ga0500622_0000559 3300053156 Bacteria 34086
550 Ga0500622_0045245 3300053156 Bacteria 2279
551 Ga0500624_009571 3300053157 Bacteria 1380
552 Ga0500627_0178875 3300053158 Bacteria 954
553 Ga0500633_0017299 3300053160 Bacteria 2112
554 Ga0500633_0106695 3300053160 Bacteria 1035
555 Ga0500633_0163626 3300053160 Bacteria 835
556 Ga0500636_0000011 3300053177 Bacteria 140769
557 Ga0500636_0000121 3300053177 Bacteria 40628
558 Ga0501082_0047207 3300060353 Bacteria 3711
559 2509390923 2509276021 Bacteria 7634384
560 2509445336 2509276033 Bacteria 7180565
561 2510137521 2510065019 Bacteria 6903379
562 2510841026 2510461069 Bacteria 5505000
563 2510893417 2510461076 Bacteria 8618824
564 2511173282 2510917026 Bacteria 7046020
565 2511183730 2510917028 Bacteria 6185411
566 2511200233 2510917030 Bacteria 7460662
567 2513573925 2513237084 Bacteria 7231967
568 2513575921 2513237085 Bacteria 7695351
569 2513599373 2513237088 Bacteria 6927906
570 2513633646 2513237093 Bacteria 7545552
571 2513712235 2513237103 Bacteria 7647401
572 2513867796 2513237138 Bacteria 7368160
573 2513910076 2513237144 Bacteria 7530820
574 2513924811 2513237146 Bacteria 7166346
575 2514019132 2513237162 Bacteria 7468464
576 2515109592 2515075009 Bacteria 7288508
577 2515634357 2515154113 Bacteria 7807172
578 2515641764 2515154114 Bacteria 7848616
579 2515658968 2515154116 Bacteria 7552979
580 2515742667 2515154134 Bacteria 7220242
581 2517042659 2516653077 Bacteria 7555578
582 2517081378 2516653085 Bacteria 7346596
583 2517100239 2517093000 Bacteria 7412387
584 2517411150 2517287029 Bacteria 6905599
585 2520378976 2519899620 Bacteria 6499161
586 2530648665 2529292951 Bacteria 6916614
587 2535520721 2534681796 Bacteria 7146037
588 2558865254 2558860100 Bacteria 8458965
589 2585199943 2582581294 Bacteria 6626667
590 2585222388 2582581298 Bacteria 7315509
591 2585230232 2582581299 Bacteria 6518058
592 2585254480 2582581304 Bacteria 5831370
593 2585265891 2582581306 Bacteria 6450535
594 2585278522 2582581308 Bacteria 7413247
595 2585324622 2582581315 Bacteria 7318924
596 2585395352 2582581866 Bacteria 6859583
597 2585403138 2582581867 Bacteria 7184437
598 2585526465 2585427526 Bacteria 7258840
599 2585535437 2585427527 Bacteria 7273426
600 2585538718 2585427528 Bacteria 6842387
601 2585544660 2585427529 Bacteria 7395659
602 2585556824 2585427530 Bacteria 7383882
603 2585563881 2585427531 Bacteria 6992870
604 2585823961 2585427590 Bacteria 6824633
605 2585836671 2585427593 Bacteria 7141551
606 2585845932 2585427594 Bacteria 6180594
607 2585902514 2585427608 Bacteria 6544331
608 2585996270 2585427633 Bacteria 6413184
609 2586000881 2585427634 Bacteria 6455027
610 2599334509 2599185156 Bacteria 5403036
611 2599416373 2599185170 Bacteria 7295545
612 2616294727 2615840624 Bacteria 6557588
613 2616308040 2615840626 Bacteria 7921970
614 2617384578 2617270742 Bacteria 6808054
615 2643814707 2643221558 Bacteria 5460675
616 2644239348 2643221643 Bacteria 5749658
617 2644298189 2643221653 Bacteria 4569637
618 2644656441 2643221719 Bacteria 4568197
619 2671113199 2667528174 Bacteria 6435400
620 2719668354 2718217997 Bacteria 6740740
621 2720489047 2718218199 Bacteria 6740745
622 2720609740 2718218232 Bacteria 6720332
623 2720617171 2718218233 Bacteria 6662049
624 2720628303 2718218235 Bacteria 6630699
625 2720772267 2718218269 Bacteria 6906114
626 2723029687 2721755556 Bacteria 6745503
627 2723564056 2721755684 Bacteria 6859907
628 2723569591 2721755685 Bacteria 6704835
629 2724092296 2721755819 Bacteria 6906405
630 2724101138 2721755822 Bacteria 6726041
631 2724112663 2721755823 Bacteria 6752556
632 2725950907 2724679232 Bacteria 7646494
633 2730110220 2728369352 Bacteria 6745171
634 2738801903 2738541293 Bacteria 7065685
635 2739034141 2738541333 Bacteria 7106503
636 2766068214 2765235942 Bacteria 7445910
637 2776912543 2775507049 Bacteria 6284736
638 2778173912 2775507266 Bacteria 7392367
639 2792624480 2791355091 Bacteria 6135441
640 2792630584 2791355092 Bacteria 6248105
641 2793317749 2791355259 Bacteria 7254731
642 2793321626 2791355260 Bacteria 6598818
643 2793329498 2791355261 Bacteria 6661293
644 2793343357 2791355263 Bacteria 6872478
645 2793346105 2791355264 Bacteria 6429314
646 2793355997 2791355265 Bacteria 6539969
647 2793359959 2791355266 Bacteria 7116587
648 2793367352 2791355267 Bacteria 7222458
649 2805930677 2802429605 Bacteria 6875453
650 2805934137 2802429606 Bacteria 6346811
651 2806042938 2802429633 Bacteria 7341974
652 2806050891 2802429634 Bacteria 7083200
653 2806057941 2802429635 Bacteria 7650140
654 2806065346 2802429636 Bacteria 7597525
655 2806076829 2802429637 Bacteria 7067217
656 2819611845 2818991448 Bacteria 6772224
657 2819640969 2818991453 Bacteria 7181617
658 2838016429 2838016132 Bacteria 6577831
659 2838024946 2838022645 Bacteria 6494267
660 2838031719 2838029111 Bacteria 6603031
661 2838036488 2838035591 Bacteria 7166484
662 2838045339 2838042994 Bacteria 6046894
663 2838050127 2838048938 Bacteria 6044578
664 2838065159 2838061910 Bacteria 6794874
665 2838068965 2838068647 Bacteria 6208656
666 2838662530 2838661181 Bacteria 7385261
667 2838671319 2838668709 Bacteria 6671819
668 2838685755 2838680041 Bacteria 6545511
669 2838688395 2838686498 Bacteria 7807632
670 2838700337 2838694306 Bacteria 6853137
671 2838703500 2838701080 Bacteria 6669771
672 2838713592 2838707686 Bacteria 6619912
673 2838734470 2838729681 Bacteria 7400765
674 2838746929 2838742623 Bacteria 7396178
675 2841852136 2841851746 Bacteria 7532261
676 2841865744 2841864319 Bacteria 6742987
677 2842082763 2842077413 Bacteria 6508645
678 2842111608 2842110456 Bacteria 7656360
679 2842123881 2842118031 Bacteria 7033875
680 2842149498 2842146304 Bacteria 5957337
681 2842158789 2842156927 Bacteria 6894975
682 2842166218 2842163707 Bacteria 6916235
683 2842182403 2842180545 Bacteria 6888678
684 2842197734 2842192696 Bacteria 6147454
685 2842202030 2842198810 Bacteria 6608673
686 2842222457 2842217011 Bacteria 7497767
687 2842234584 2842229732 Bacteria 7475766
688 2842242995 2842237096 Bacteria 6620661
689 2842248317 2842243621 Bacteria 7421798
690 2842253864 2842250916 Bacteria 6579627
691 2842262510 2842257432 Bacteria 7401195
692 2842265302 2842264693 Bacteria 6472963
693 2842272655 2842271015 Bacteria 7807131
694 2842288042 2842285085 Bacteria 6011953
695 2842297078 2842291075 Bacteria 7076806
696 2842307904 2842304105 Bacteria 7023636
697 2842313460 2842311132 Bacteria 6616990
698 2842321572 2842317721 Bacteria 6793725
699 2842345693 2842341865 Bacteria 7003929
700 2842363989 2842363717 Bacteria 6844742
701 2842376408 2842370503 Bacteria 7038661
702 2842383469 2842377471 Bacteria 7140707
703 2842390638 2842384541 Bacteria 7057858
704 2842405308 2842402390 Bacteria 6681310
705 2842411935 2842409023 Bacteria 6687331
706 2842418538 2842415677 Bacteria 6596907
707 2842423111 2842422224 Bacteria 6239196
708 2842428645 2842428310 Bacteria 6767288
709 2842435259 2842434925 Bacteria 6502746
710 2842441878 2842441272 Bacteria 6769273
711 2842448073 2842447887 Bacteria 6754142
712 2842463071 2842462802 Bacteria 6588055
713 2842469591 2842469257 Bacteria 6752936
714 2842478451 2842475841 Bacteria 6603183
715 2842493093 2842489311 Bacteria 6620893
716 2842499339 2842495871 Bacteria 6820686
717 2842505603 2842502639 Bacteria 6604161
718 2842514438 2842509118 Bacteria 6850950
719 2842526819 2842521101 Bacteria 6569494
720 2842925281 2842922631 Bacteria 5824079
721 2844461553 2844454524 Bacteria 7952546
722 2852394778 2852387548 Bacteria 8025568
723 2857520625 2857516855 Bacteria 7787325
724 2899808406 2899803654 Bacteria 5577784
725 2913301582 2913295892 Bacteria 6333755
726 2919102962 2919100787 Bacteria 7710546
727 2919174642 2919171160 Bacteria 6499771
728 2919412967 2919408235 Bacteria 6149349
729 2923559358 2923556063 Bacteria 6793593
730 2933020684 2933016740 Bacteria 6355406
731 2933574355 2933570622 Bacteria 7023390
732 2933590814 2933586486 Bacteria 7667493
733 2933599632 2933599457 Bacteria 5858799
734 2935900201 2935894831 Bacteria 6620579
735 2935907900 2935901341 Bacteria 7341747
736 2936373695 2936367885 Bacteria 7324495
737 2936377219 2936375103 Bacteria 6652732
738 2936386477 2936381700 Bacteria 7006523
739 2989776856 2989776772 Bacteria 4843317
740 2996887815 2996887358 Bacteria 5795980
741 2996895548 2996893221 Bacteria 5823108
742 3003934201 3003930520 Bacteria 5667563
743 3005450880 3005445848 Bacteria 6906074
744 3005454069 3005452660 Bacteria 5889319
745 639650947 639633055 Bacteria 7751309
746 643822261 643692032 Bacteria 6891900
747 8005259161 8005258706 Bacteria 6184835
748 8005307299 8005301065 Bacteria 6614431
749 8005311978 8005307578 Bacteria 7395396
750 8005322342 8005321885 Bacteria 5795980
751 8005382379 8005376324 Bacteria 6590079
752 8005383618 8005382845 Bacteria 6732062
753 8005398132 8005395548 Bacteria 6806915
754 8005466140 8005460587 Bacteria 7157962
755 8005502560 8005497431 Bacteria 6477605
756 8005548488 8005542996 Bacteria 7077758
757 8005563066 8005556819 Bacteria 6908598
758 8005564914 8005563573 Bacteria 7153261
759 8005575791 8005570704 Bacteria 6957481
760 8005623770 8005619151 Bacteria 7030230
761 8005626328 8005626139 Bacteria 6534237
762 8005647543 8005645114 Bacteria 6950293
763 8005673988 8005668836 Bacteria 6953162
764 8005688860 8005688590 Bacteria 6610080
765 8005695403 8005695170 Bacteria 6912330
766 8018131929 8018127388 Bacteria 7351159
767 8018169962 8018163183 Bacteria 7277977
768 8023685968 8023680758 Bacteria 7729763
769 8024486408 8024479707 Bacteria 6954785
770 8024487578 8024486573 Bacteria 6540512
771 8024506123 8024501048 Bacteria 6427847
772 8046771324 8046767195 Bacteria 7547379
773 8054563354 8054558443 Bacteria 5204801
774 8056381838 8056375014 Bacteria 7006639
775 8056382924 8056382006 Bacteria 6408074
776 8057581327 8057575449 Bacteria 7367519
777 8057876240 8057874678 Bacteria 7494653
778 Ga0495605_0014548
779 JGI24740J21852_10000003
780 JGI25155J39150_1000017
781 JGI25156J39149_1000034
782 JGI25162J39368_1000069
783 JGI25154J39366_1000034
784 JGI25158J39367_1000132
785 JGI25157J39369_1000092
786 JGI25152J39213_1001418
787 JGI25152J39213_1002382
788 JGI25152J39213_1005221
789 JGI25152J39213_1014529
790 JGI25152J39213_1051624
791 JGI25152J39213_1051633
792 JGI25150J39212_1000010
793 JGI25150J39212_1017894
794 JGI25159J45721_1000421
795 JGI25159J45721_1001354
796 JGI25151J46595_10000026
797 JGI25151J46595_10000383
798 JGI25151J46595_10093007
799 JGI25165J46597_1000018
800 JGI25165J46597_1014227
801 JGI25153J46596_10000858
802 JGI25153J46596_10005939
803 JGI25153J46596_10013444
804 JGI25153J46596_10035348
805 JGI25153J46596_10090646
806 JGI25153J46596_10102720
807 JGI25153J46596_10137924
808 JGI25153J46596_10137947
809 rootH1_10016543
810 rootH1_10040367
811 rootH2_10083368
812 rootL2_10009173
813 rootL2_10070897
814 rootH1_10020310
815 JGI25160J50197_1000599
816 JGI25160J50197_1003370
817 JGI25160J50197_1004142
818 JGI25160J50197_1034304
819 JGI25160J50197_1038120
820 JGI25161J50226_1000050
821 JGI25161J50226_1000424
822 JGI25161J50226_1002379
823 Ga0055539_1022794
824 Ga0055526_1000661
825 Ga0055526_1001610
826 Ga0055526_1002306
827 Ga0055526_1007407
828 Ga0055526_1017301
829 Ga0055526_1021612
830 Ga0055526_1031463
831 Ga0055524_1000936
832 Ga0055524_1001468
833 Ga0055524_1002754
834 Ga0055524_1005288
835 Ga0055524_1045897
836 Ga0055536_1001115
837 Ga0055528_1000096
838 Ga0055528_1000681
839 Ga0055528_1003470
840 Ga0055528_1009316
841 Ga0055528_1009508
842 Ga0055528_1009927
843 Ga0055528_1027264
844 Ga0055528_1060574
845 Ga0055530_10028614
846 Ga0055540_1000728
847 Ga0055540_1009933
848 Ga0055540_1018639
849 Ga0055540_1020467
850 Ga0055540_1039119
851 Ga0055531_10005662
852 Ga0055543_1000023
853 Ga0055543_1000576
854 Ga0055543_1004138
855 Ga0055543_1005969
856 Ga0055543_1067750
857 Ga0065165_1002596
858 Ga0065165_1021771
859 Ga0065165_1024177
860 Ga0065165_1147045
861 Ga0065165_1147375
862 Ga0070658_10441811
863 Ga0070670_100036429
864 Ga0070666_10253898
865 Ga0070661_101755997
866 Ga0070667_100276016
867 Ga0070663_101742622
868 Ga0070665_100014876
869 Ga0068855_100236734
870 Ga0068854_100030411
871 Ga0068851_10031766
872 Ga0068862_101679203
873 Ga0075365_10004903
874 Ga0075365_10019303
875 Ga0075365_10082343
876 Ga0075368_10146953
877 Ga0075363_100157737
878 Ga0075363_100783544
879 Ga0075362_10000551
880 Ga0075362_10397088
881 Ga0075367_10395603
882 Ga0075369_10003191
883 Ga0075369_10016631
884 Ga0075369_10122672
885 Ga0075366_10919346
886 Ga0075370_10209622
887 Ga0075370_10679738
888 Ga0075370_10702873
889 Ga0075370_10989941
890 Ga0105251_10110680
891 Ga0105244_10102659
892 Ga0105244_10291259
893 Ga0105250_10162888
894 Ga0105240_10000240
895 Ga0105247_10322250
896 Ga0105247_10478878
897 Ga0105243_10167213
898 Ga0105248_10183848
899 Ga0105248_11044148
900 Ga0105237_10003272
901 Ga0105238_12517054
902 Ga0123342_1012677
903 Ga0123342_1016141
904 Ga0105239_10021907
905 Ga0157322_1000796
906 Ga0157327_1080255
907 Ga0157373_10129215
908 Ga0157373_10944156
909 Ga0157370_10001696
910 Ga0157369_10380172
911 Ga0157378_10657127
912 Ga0182008_10018574
913 Ga0182007_10000406
914 Ga0182005_1006240
915 Ga0163161_10544431
916 Ga0214544_1000906
917 Ga0214542_1000400
918 Ga0214543_1000019
919 Ga0209435_100023
920 Ga0209436_100031
921 Ga0209437_100022
922 Ga0207425_1000010
923 Ga0207425_1004436
924 Ga0207425_1005593
925 Ga0207425_1016108
926 Ga0209646_1000080
927 Ga0209646_1043672
928 Ga0209026_1000076
929 Ga0209677_100499
930 Ga0209759_1000059
931 Ga0209129_1000197
932 Ga0209129_1000625
933 Ga0209129_1001067
934 Ga0209129_1001986
935 Ga0209129_1005724
936 Ga0209129_1005870
937 Ga0209129_1018438
938 Ga0209233_1000031
939 Ga0209233_1000203
940 Ga0209565_1021431
941 Ga0209673_1000063
942 Ga0209673_1000252
943 Ga0209673_1003927
944 Ga0209673_1005480
945 Ga0209673_1006322
946 Ga0209673_1010561
947 Ga0209673_1017618
948 Ga0209673_1031851
949 Ga0209130_1000031
950 Ga0209130_1001091
951 Ga0209130_1025614
952 Ga0209130_1027836
953 Ga0209675_1054312
954 Ga0209676_1002049
955 Ga0209676_1005325
956 Ga0209676_1039289
957 Ga0209025_1000022
958 Ga0209025_1000397
959 Ga0209025_1002306
960 Ga0209025_1016728
961 Ga0209025_1020329
962 Ga0209025_1044394
963 Ga0209564_1000482
964 Ga0209564_1000511
965 Ga0209564_1000586
966 Ga0209564_1002586
967 Ga0209564_1010499
968 Ga0209564_1019663
969 Ga0209758_1000086
970 Ga0209758_1000585
971 Ga0209758_1000688
972 Ga0209758_1001274
973 Ga0209758_1014554
974 Ga0209758_1014603
975 Ga0209758_1019485
976 Ga0209758_1022160
977 Ga0209758_1029954
978 Ga0209758_1051251
979 Ga0209758_1052275
980 Ga0209758_1060846
981 Ga0209050_1005653
982 Ga0209050_1020198
983 Ga0209256_1000786
984 Ga0209256_1002344
985 Ga0209256_1005287
986 Ga0209256_1005765
987 Ga0209256_1036117
988 Ga0209256_1041953
989 Ga0209256_1062509
990 Ga0209256_1087814
991 Ga0209256_1104670
992 Ga0209256_1112501
993 Ga0207426_1000042
994 Ga0207426_1000200
995 Ga0207426_1000355
996 Ga0207426_1002795
997 Ga0207426_1053245
998 Ga0209051_1000038
999 Ga0209051_1002500
1000 Ga0209051_1007982
1001 Ga0209051_1104225
1002 Ga0209257_1017762
1003 Ga0209257_1099623
1004 Ga0207656_10095355
1005 Ga0207647_10554759
1006 Ga0207695_10000118
1007 Ga0207671_10000410
1008 Ga0207650_10001958
1009 Ga0207709_10579501
1010 Ga0207711_10113169
1011 Ga0207667_10914406
1012 Ga0207668_10601671
1013 Ga0209813_10288423
1014 Ga0268266_10203661
1015 Ga0307515_10000375
1016 Ga0307515_10013166
1017 Ga0307515_10017859
1018 Ga0307513_10000335
1019 Ga0307513_10007331
1020 Ga0307408_100447129
1021 Ga0307408_101127243
1022 Ga0307405_10003524
1023 Ga0307406_10018684
1024 Ga0307412_10235347
1025 Ga0307414_12087186
1026 Ga0439436_0051800
1027 Ga0439438_062811
1028 Ga0439447_023188
1029 Ga0439466_0046196
1030 Ga0439465_0001359
1031 Ga0439465_0012292
1032 Ga0439465_0018277
1033 Ga0451787_496533
1034 Ga0451789_1098931
1035 Ga0451793_0819188
1036 Ga0451798_0885988
1037 Ga0451802_1466569
1038 Ga0451833_0146614
1039 Ga0451833_0611857
1040 Ga0451837_0143144
1041 Ga0451837_1297148
1042 Ga0451839_0678247
1043 Ga0451839_1595413
1044 Ga0451841_0305811
1045 Ga0451847_0140318
1046 Ga0451847_0707496
1047 Ga0451849_0597870
1048 Ga0451851_0868248
1049 Ga0451851_0972318
1050 Ga0451843_0515827
1051 Ga0451843_0541337
1052 Ga0451855_0815332
1053 Ga0451853_0630923
1054 Ga0451853_3746137
1055 Ga0439449_0029950
1056 Ga0450919_017637
1057 Ga0450920_010004
1058 Ga0450906_002063
1059 Ga0450918_034223
1060 Ga0495627_115648
1061 Ga0495592_0135462
1062 Ga0495629_0155593
1063 Ga0495638_0000084
1064 Ga0495638_0000420
1065 Ga0495638_0105980
1066 Ga0495653_0829829
1067 Ga0495650_0017101
1068 Ga0495650_0022686
1069 Ga0495650_0072982
1070 Ga0495605_0018386
1071 Ga0495639_0142964
1072 Ga0495662_0001314
1073 Ga0495664_0109113
1074 Ga0495584_0231810
1075 Ga0495585_0006217
1076 Ga0495585_0072173
1077 Ga0495607_0037149
1078 Ga0495607_0089125
1079 Ga0495607_0129012
1080 Ga0495607_0226581
1081 Ga0495607_0344494
1082 Ga0495583_0004969
1083 Ga0495583_0011616
1084 Ga0495583_0021146
1085 Ga0495606_0000848
1086 Ga0495606_0004464
1087 Ga0495606_0086935
1088 Ga0495606_0138583
1089 Ga0495606_0190090
1090 Ga0495610_0000694
1091 Ga0495610_0010647
1092 Ga0495610_0180434
1093 Ga0495610_0241339
1094 Ga0495616_0066349
1095 Ga0495616_0216754
1096 Ga0495620_0011307
1097 Ga0495620_0014856
1098 Ga0495620_0036518
1099 Ga0495620_0108977
1100 Ga0495628_1009529
1101 Ga0495631_0008921
1102 Ga0495631_0041639
1103 Ga0495631_0076886
1104 Ga0495632_0004193
1105 Ga0495632_0022250
1106 Ga0495632_0166049
1107 Ga0495637_0007239
1108 Ga0495643_0003806
1109 Ga0495643_0007745
1110 Ga0495643_0010332
1111 Ga0495643_0032932
1112 Ga0495643_0089349
1113 Ga0495648_0013425
1114 Ga0495648_0014179
1115 Ga0495648_0071036
1116 Ga0495663_0001716
1117 Ga0495652_0078663
1118 Ga0495654_0000114
1119 Ga0495640_0235010
1120 Ga0495587_0170504
1121 Ga0495609_0027131
1122 Ga0495609_0161450
1123 Ga0495597_0044037
1124 Ga0495633_0004140
1125 Ga0495656_0028607
1126 Ga0495656_0052905
1127 Ga0495668_0003832
1128 Ga0495668_0056851
1129 Ga0495668_0185231
1130 Ga0495611_0024632
1131 Ga0495625_0009342
1132 Ga0495625_0015205
1133 Ga0495625_0059273
1134 Ga0495625_0176621
1135 Ga0495625_0340039
1136 Ga0495625_0653791
1137 Ga0495661_0179773
1138 Ga0495588_0000378
1139 Ga0495588_0281046
1140 Ga0495588_0511565
1141 Ga0495657_0194627
1142 Ga0495658_0015634
1143 Ga0495670_0014478
1144 Ga0495670_0108305
1145 Ga0495671_0000867
1146 Ga0495671_0054422
1147 Ga0495671_0256497
1148 Ga0495671_0314018
1149 Ga0495649_0018726
1150 Ga0495649_0033601
1151 Ga0495649_0043522
1152 Ga0495589_0039636
1153 Ga0495600_0076570
1154 Ga0495660_0087704
1155 Ga0495660_0161377
1156 Ga0495660_0200618
1157 Ga0495604_0194220
1158 Ga0495636_0047695
1159 Ga0495636_0057672
1160 Ga0495674_0285533
1161 Ga0495672_0023628
1162 Ga0495676_0505585
1163 Ga0495683_0128552
1164 Ga0495687_006530
1165 Ga0495687_066046
1166 Ga0495685_024438
1167 Ga0495673_0068514
1168 Ga0495673_0109708
1169 Ga0495681_0000678
1170 Ga0495681_0021104
1171 Ga0495681_0053765
1172 Ga0495681_0058730
1173 Ga0495681_0337402
1174 Ga0495686_0000296
1175 Ga0495686_0011203
1176 Ga0495686_0022801
1177 Ga0495686_0240160
1178 Ga0495686_0377466
1179 Ga0495626_0071269
1180 Ga0495626_0273955
1181 Ga0496100_0040378
1182 Ga0496100_0518902
1183 Ga0496100_0829165
1184 Ga0496102_0016095
1185 Ga0496102_0083303
1186 Ga0496103_0020495
1187 Ga0496104_0585150
1188 Ga0496105_0208532
1189 Ga0496106_0001056
1190 Ga0496106_0265173
1191 Ga0496106_1565609
1192 Ga0496107_0219298
1193 Ga0496110_0154656
1194 Ga0496110_0885243
1195 Ga0496113_0026868
1196 Ga0496116_0003396
1197 Ga0496116_0013786
1198 Ga0496116_0020125
1199 Ga0496116_0030645
1200 Ga0496116_0040659
1201 Ga0496117_0001380
1202 Ga0496117_0012124
1203 Ga0496117_0013898
1204 Ga0496117_0019559
1205 Ga0496117_0092120
1206 Ga0496118_0001922
1207 Ga0496118_0006564
1208 Ga0496118_0021379
1209 Ga0496118_0022580
1210 Ga0496118_0064044
1211 Ga0496118_0152397
1212 Ga0496119_0014776
1213 Ga0496119_0017450
1214 Ga0496119_0018901
1215 Ga0496119_0042973
1216 Ga0496119_0079060
1217 Ga0496119_0477244
1218 Ga0496120_0018031
1219 Ga0496120_0022015
1220 Ga0496120_0037056
1221 Ga0496120_0135362
1222 Ga0496121_0001817
1223 Ga0496121_0004588
1224 Ga0496121_0022112
1225 Ga0496121_0031641
1226 Ga0496121_0051672
1227 Ga0496121_0072426
1228 Ga0496121_0158055
1229 Ga0496121_0176053
1230 Ga0496121_0300282
1231 Ga0496121_0310114
1232 Ga0496122_0006070
1233 Ga0496122_0022093
1234 Ga0496122_0047377
1235 Ga0496122_0051586
1236 Ga0496122_0085855
1237 Ga0496122_0324758
1238 Ga0496122_0326723
1239 Ga0496123_0004386
1240 Ga0496123_0015998
1241 Ga0496123_0019205
1242 Ga0496123_0023238
1243 Ga0496123_0048989
1244 Ga0496124_0004324
1245 Ga0496124_0006892
1246 Ga0496124_0010829
1247 Ga0496124_0013839
1248 Ga0496124_0048309
1249 Ga0496124_0049581
1250 Ga0496124_0066739
1251 Ga0496124_0145019
1252 Ga0496124_0171846
1253 Ga0496125_0004658
1254 Ga0496125_0032139
1255 Ga0496125_0032561
1256 Ga0496125_0056456
1257 Ga0496125_0335939
1258 Ga0496126_0042292
1259 Ga0496126_0371164
1260 Ga0495678_001350
1261 Ga0495678_026013
1262 Ga0495678_106515
1263 Ga0495682_0005253
1264 Ga0495682_0025279
1265 Ga0501032_0050994
1266 Ga0501034_0043885
1267 Ga0501036_1064638
1268 Ga0501046_0047291
1269 Ga0501047_0142028
1270 Ga0501068_0052620
1271 Ga0501080_1882106
1272 Ga0501280_041395
1273 nmdc:mga03n38_344896_c1
1274 nmdc:mga03n38_661507_c1
1275 nmdc:mga0yw44_1019742_c1
1276 nmdc:mga0yw44_1123799_c1
1277 nmdc:mga0yw44_18982_c1
1278 nmdc:mga0yw44_23732_c1
1279 nmdc:mga0k408_58320_c1
1280 nmdc:mga06z11_62685_c1
1281 nmdc:mga04h51_30035_c1
1282 nmdc:mga07m45_196919_c1
1283 nmdc:mga07m45_292243_c1
1284 nmdc:mga07m45_352003_c1
1285 nmdc:mga0sz30_174151_c1
1286 nmdc:mga0sz30_51978_c1
1287 nmdc:mga0sz30_7667_c1
1288 Ga0495601_0512867
1289 Ga0500610_0007217
1290 Ga0500610_0179008
1291 Ga0495619_0174917
1292 Ga0500578_0146576
1293 Ga0500578_0363556
1294 Ga0500646_0332573
1295 Ga0500651_0418622
1296 Ga0500566_0457030
1297 Ga0500555_110014
1298 Ga0500569_336813
1299 Ga0500572_057416
1300 Ga0500572_163371
1301 Ga0500594_0003798
1302 Ga0500594_0035474
1303 Ga0500608_071714
1304 Ga0500608_164039
1305 Ga0500614_061029
1306 Ga0500618_000031
1307 Ga0500618_000296
1308 Ga0500618_013202
1309 Ga0500621_205605
1310 Ga0500658_0000877
1311 Ga0500658_0007391
1312 Ga0500658_0035803
1313 Ga0500559_0522051
1314 Ga0500568_0000200
1315 Ga0500568_0002409
1316 Ga0500568_0384752
1317 Ga0500577_0188286
1318 Ga0500588_0282182
1319 Ga0500590_000137
1320 Ga0500604_0032854
1321 Ga0500616_0000102
1322 Ga0500616_0000795
1323 Ga0500616_0004137
1324 Ga0500620_226901
1325 Ga0500622_0000559
1326 Ga0500622_0045245
1327 Ga0500624_009571
1328 Ga0500627_0178875
1329 Ga0500633_0017299
1330 Ga0500633_0106695
1331 Ga0500633_0163626
1332 Ga0500636_0000011
1333 Ga0500636_0000121
1334 Ga0501082_0047207
1335 2509390923
1336 2509445336
1337 2510137521
1338 2510841026
1339 2510893417
1340 2511173282
1341 2511183730
1342 2511200233
1343 2513573925
1344 2513575921
1345 2513599373
1346 2513633646
1347 2513712235
1348 2513867796
1349 2513910076
1350 2513924811
1351 2514019132
1352 2515109592
1353 2515634357
1354 2515641764
1355 2515658968
1356 2515742667
1357 2517042659
1358 2517081378
1359 2517100239
1360 2517411150
1361 2520378976
1362 2530648665
1363 2535520721
1364 2558865254
1365 2585199943
1366 2585222388
1367 2585230232
1368 2585254480
1369 2585265891
1370 2585278522
1371 2585324622
1372 2585395352
1373 2585403138
1374 2585526465
1375 2585535437
1376 2585538718
1377 2585544660
1378 2585556824
1379 2585563881
1380 2585823961
1381 2585836671
1382 2585845932
1383 2585902514
1384 2585996270
1385 2586000881
1386 2599334509
1387 2599416373
1388 2616294727
1389 2616308040
1390 2617384578
1391 2643814707
1392 2644239348
1393 2644298189
1394 2644656441
1395 2671113199
1396 2719668354
1397 2720489047
1398 2720609740
1399 2720617171
1400 2720628303
1401 2720772267
1402 2723029687
1403 2723564056
1404 2723569591
1405 2724092296
1406 2724101138
1407 2724112663
1408 2725950907
1409 2730110220
1410 2738801903
1411 2739034141
1412 2766068214
1413 2776912543
1414 2778173912
1415 2792624480
1416 2792630584
1417 2793317749
1418 2793321626
1419 2793329498
1420 2793343357
1421 2793346105
1422 2793355997
1423 2793359959
1424 2793367352
1425 2805930677
1426 2805934137
1427 2806042938
1428 2806050891
1429 2806057941
1430 2806065346
1431 2806076829
1432 2819611845
1433 2819640969
1434 2838016429
1435 2838024946
1436 2838031719
1437 2838036488
1438 2838045339
1439 2838050127
1440 2838065159
1441 2838068965
1442 2838662530
1443 2838671319
1444 2838685755
1445 2838688395
1446 2838700337
1447 2838703500
1448 2838713592
1449 2838734470
1450 2838746929
1451 2841852136
1452 2841865744
1453 2842082763
1454 2842111608
1455 2842123881
1456 2842149498
1457 2842158789
1458 2842166218
1459 2842182403
1460 2842197734
1461 2842202030
1462 2842222457
1463 2842234584
1464 2842242995
1465 2842248317
1466 2842253864
1467 2842262510
1468 2842265302
1469 2842272655
1470 2842288042
1471 2842297078
1472 2842307904
1473 2842313460
1474 2842321572
1475 2842345693
1476 2842363989
1477 2842376408
1478 2842383469
1479 2842390638
1480 2842405308
1481 2842411935
1482 2842418538
1483 2842423111
1484 2842428645
1485 2842435259
1486 2842441878
1487 2842448073
1488 2842463071
1489 2842469591
1490 2842478451
1491 2842493093
1492 2842499339
1493 2842505603
1494 2842514438
1495 2842526819
1496 2842925281
1497 2844461553
1498 2852394778
1499 2857520625
1500 2899808406
1501 2913301582
1502 2919102962
1503 2919174642
1504 2919412967
1505 2923559358
1506 2933020684
1507 2933574355
1508 2933590814
1509 2933599632
1510 2935900201
1511 2935907900
1512 2936373695
1513 2936377219
1514 2936386477
1515 2989776856
1516 2996887815
1517 2996895548
1518 3003934201
1519 3005450880
1520 3005454069
1521 639650947
1522 643822261
1523 8005259161
1524 8005307299
1525 8005311978
1526 8005322342
1527 8005382379
1528 8005383618
1529 8005398132
1530 8005466140
1531 8005502560
1532 8005548488
1533 8005563066
1534 8005564914
1535 8005575791
1536 8005623770
1537 8005626328
1538 8005647543
1539 8005673988
1540 8005688860
1541 8005695403
1542 8018131929
1543 8018169962
1544 8023685968
1545 8024486408
1546 8024487578
1547 8024506123
1548 8046771324
1549 8054563354
1550 8056381838
1551 8056382924
1552 8057581327
1553 8057876240

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12973

Cupin_7

ChrR Cupin-like domain

11

107

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yu2-assembly1.cif.gz_A crystal structure of hjhdm1a without a-ketoglutarate 0.9324 41 105
3o14-assembly2.cif.gz_B crystal structure of an anti-ecfsigma factor, chrr (maqu_0586) from marinobacter aquaeolei vt8 at 1.70 a resolution 0.9228 15 105
3cjx-assembly11.cif.gz_B crystal structure of a protein of unknown function with a cupin-like fold (reut_b4571) from ralstonia eutropha jmp134 at 2.60 a resolution 0.9226 25 109
7uv9-assembly1.cif.gz_K kdm2a-nucleosome structure stabilized by h3k36c-unc8015 covalent conjugate 0.9198 41 105
2yu1-assembly1.cif.gz_A crystal structure of hjhdm1a complexed with a-ketoglutarate 0.917 41 105
ID Description Score Start End Superfamily
af_O94603_133_414_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9235 41 105 2.60.120.650
4qx8A01 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9201 41 105 2.60.120.650
af_A0A0P0XHH9_265_498_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9197 40 105 2.60.120.650
af_Q95Q98_1_277_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9151 41 105 2.60.120.650
af_A0A0R0KME4_229_450_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9059 41 105 2.60.120.650
ID Description Score Start End GO Terms
AF-A0A0M3GCC3-F1-model_v4 deleted 0.9961 12 113
AF-A0A521QXR3-F1-model_v4 ChrR-like cupin domain-containing protein 0.9885 39 113
AF-A0A531M5Y2-F1-model_v4 Allophanate hydrolase 0.9845 45 115 GO:0016787
AF-A0A246SYR6-F1-model_v4 Allophanate hydrolase 0.9824 1 113 GO:0016787
AF-A0A2E9AKC5-F1-model_v4 Transcription negative regulator ChrR 0.9792 19 112

Map