F480337

General Info

Members Datasets Scaffolds Average Seq Length
776 567 1552 644

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0025269|Ga0496121_0025269_2987_5032
Length 681
Sequence MTDMSTSNDSKHQRHSGARDSANPESRDSGSGADAPSRNDGGSYLEQDQFLTILSREEALARFEAALFPRQWPSETRRLADALGRALAEDVVAPIDVPPFDRSNVDGFAVRSADLVRAGEAAPVQLALNDETISCGTAPTRPVLPGTATAIATGGPVPRGADAIVMVEHTQPAGNGAIEVRRAASPGQFVSYAGSDIARGEALLRAGTIIGSREIGMLAACGIAEVVVVRRPRVAILSTGDELVQPGEVLRPAAIYDTNGAIVTAAIAENGGDAHFLGAIADDEALLEAAMRKALAESDMLVLSGGTSKGAGDVSHRIIARLGEPGIIAHGVALKPGKPLCLAVCDGKPVVILPGFPTSAMFTFHDMIVPVLRRMAGLPPRPDAKVAAKVPVRIASELGRTEFVMVSLVEGADGLIAYPSGKGSGAITSFAQADGFLKIEALADQLPAGSDAEVTLFTPHVRVPDLVIVGSHCTGLDLVTAPLAHAGLVVRSIAVGSLGGLAAAKRGECDLAPIHLLDDKTETYNTPYLADGLELVPGWRRMQGIVFRRDDQRFVGLSAQQAVRAALADPACIMVNRNQGAGTRILIDRLLAGSRPDGYWNQPRSHNAVAAAVAQHRADWGMTIAPVAAASGLGFIPLAEEHYDFALVTARKQRPAVQAFLEALASDEGRAALIEAGFRPA

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
62 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
82 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
83 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
84 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
87 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
134 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
135 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
136 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
137 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
138 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
143 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
153 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
154 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
155 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
156 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
157 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
158 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
185 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
191 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
192 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
193 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
194 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
195 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
196 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
200 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
201 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
204 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
205 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
206 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
207 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
212 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
213 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
217 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
218 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
221 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
222 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
223 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
224 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
225 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
235 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
236 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
237 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
254 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
255 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
256 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
257 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
258 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
259 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
260 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
261 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
271 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
272 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
273 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
274 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
277 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
278 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
279 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
280 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
281 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
282 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
283 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
284 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
285 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
288 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
289 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
290 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
291 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
292 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
293 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
294 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
295 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
296 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
297 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
298 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
299 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
300 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
301 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
302 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
303 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
304 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
305 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
306 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
307 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
308 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
309 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
310 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
311 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
312 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
313 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
314 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
315 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
316 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
317 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
318 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
319 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
320 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
321 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
322 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
323 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
324 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
325 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
326 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
327 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
328 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
329 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
330 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
331 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
332 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
333 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
334 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
335 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
336 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
337 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
338 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
339 2643221651 Afipia sp. Root123D2 Isolate Unclassified
340 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
341 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
342 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
343 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
344 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
345 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
346 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
347 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
348 2791355199
349 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
350 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
351 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
352 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
353 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
354 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
355 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
356 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
357 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
358 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
359 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
360 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
361 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
362 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
363 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
364 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
365 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
366 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
367 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
368 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
369 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
370 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
371 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
372 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
373 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
374 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
375 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
376 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
377 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
378 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
379 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
380 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
381 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
382 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
383 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
384 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
385 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
386 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
387 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
388 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
389 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
390 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
391 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
392 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
393 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
394 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
395 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
396 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
397 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
398 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
399 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
400 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
401 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
402 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
403 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
404 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
405 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
406 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
407 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
408 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
409 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
410 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
411 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
412 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
413 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
414 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
415 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
416 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
417 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
418 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
419 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
420 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
421 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
422 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
423 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
424 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
425 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
426 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
427 2906610324
428 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
429 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
430 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
431 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
432 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
433 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
434 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
435 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
436 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
437 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
438 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
439 2922368715
440 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
441 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
442 2922425934
443 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
444 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
445 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
446 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
447 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
448 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
449 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
450 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
451 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
452 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
453 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
454 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
455 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
456 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
457 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
458 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
459 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
460 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
461 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
462 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
463 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
464 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
465 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
466 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
467 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
468 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
469 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
470 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
471 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
472 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
473 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
474 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
475 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
476 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
477 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
478 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
479 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
480 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
481 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
482 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
483 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
484 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
485 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
486 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
487 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
488 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
489 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
490 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
491 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
492 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
493 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
494 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
495 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
496 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
497 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
498 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
499 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
500 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
501 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
502 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
503 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
504 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
505 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
506 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
507 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
508 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
509 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
510 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
511 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
512 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
513 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
514 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
515 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
516 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
517 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
518 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
519 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
520 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
521 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
522 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
523 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
524 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
525 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
526 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
527 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
528 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
529 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
530 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
531 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
532 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
533 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
534 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
535 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
536 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
537 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
538 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
539 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
540 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
541 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
542 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
543 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
544 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
545 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
546 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
547 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
548 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
549 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
550 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
551 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
552 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
553 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
554 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
555 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
556 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
557 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
558 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
559 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
560 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
561 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
562 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
563 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
564 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
565 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
566 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
567 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 66.32
Metatranscriptomes 0.13
Isolates 33.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.31
Nodule 26.8
Rhizoplane 7.73
Rhizosphere 44.97
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0025269 3300048924 Bacteria 5643
2 JGI25406J46586_10000022 3300003203 Bacteria 79225
3 JGI25153J46596_10004117 3300003215 Bacteria 7912
4 JGI25153J46596_10004387 3300003215 Bacteria 7611
5 Ga0055542_1004255 3300003762 Bacteria 3538
6 Ga0055531_10005784 3300003794 Bacteria 7160
7 Ga0065165_1000054 3300005262 Bacteria 187351
8 Ga0065165_1002102 3300005262 Bacteria 18202
9 Ga0065165_1006247 3300005262 Bacteria 6330
10 Ga0070683_100071815 3300005329 Bacteria 3230
11 Ga0068869_100004580 3300005334 Bacteria 8615
12 Ga0070680_100004188 3300005336 Bacteria 10813
13 Ga0070680_100020948 3300005336 Bacteria 5191
14 Ga0068868_100068083 3300005338 Bacteria 2834
15 Ga0070660_100013688 3300005339 Bacteria 5829
16 Ga0070660_100050007 3300005339 Bacteria 3216
17 Ga0070691_10031562 3300005341 Bacteria 2485
18 Ga0070668_100034701 3300005347 Bacteria 3844
19 Ga0070668_100079742 3300005347 Bacteria 2564
20 Ga0070671_100043306 3300005355 Bacteria 3741
21 Ga0070688_100006731 3300005365 Bacteria 6160
22 Ga0070659_100020118 3300005366 Bacteria 5067
23 Ga0070659_100101847 3300005366 Bacteria 2312
24 Ga0070714_100006412 3300005435 Bacteria 9087
25 Ga0070713_100005380 3300005436 Bacteria 8746
26 Ga0070713_100007126 3300005436 Bacteria 7818
27 Ga0070711_100002557 3300005439 Bacteria 10418
28 Ga0070711_100005586 3300005439 Bacteria 7525
29 Ga0070711_100033703 3300005439 Bacteria 3411
30 Ga0070700_100020913 3300005441 Bacteria 3799
31 Ga0070708_100035961 3300005445 Bacteria 4318
32 Ga0070663_100000901 3300005455 Bacteria 16135
33 Ga0070678_100055336 3300005456 Bacteria 2896
34 Ga0070662_100000752 3300005457 Bacteria 19873
35 Ga0070681_10039622 3300005458 Bacteria 4722
36 Ga0068867_100006986 3300005459 Bacteria 7979
37 Ga0070685_10022936 3300005466 Bacteria 3410
38 Ga0070679_100009603 3300005530 Bacteria 9151
39 Ga0070679_100015566 3300005530 Bacteria 7308
40 Ga0070684_100028144 3300005535 Bacteria 4751
41 Ga0070697_100021880 3300005536 Bacteria 5070
42 Ga0068853_100003918 3300005539 Bacteria 11422
43 Ga0068853_100060269 3300005539 Bacteria 3279
44 Ga0068853_100082212 3300005539 Bacteria 2821
45 Ga0070672_100012261 3300005543 Bacteria 6009
46 Ga0070672_100040663 3300005543 Bacteria 3569
47 Ga0070695_100005829 3300005545 Bacteria 7265
48 Ga0070696_100033656 3300005546 Bacteria 3523
49 Ga0068855_100058917 3300005563 Bacteria 4495
50 Ga0068856_100018079 3300005614 Bacteria 6834
51 Ga0068852_100002087 3300005616 Bacteria 13650
52 Ga0068852_100065941 3300005616 Bacteria 3160
53 Ga0068859_100037124 3300005617 Bacteria 4890
54 Ga0068859_100101883 3300005617 Bacteria 2928
55 Ga0068864_100058790 3300005618 Bacteria 3324
56 Ga0068861_100001850 3300005719 Bacteria 13615
57 Ga0068861_100005067 3300005719 Bacteria 8886
58 Ga0068861_100016570 3300005719 Bacteria 5217
59 Ga0068861_100021141 3300005719 Bacteria 4676
60 Ga0068863_100131641 3300005841 Bacteria 2388
61 Ga0068858_100004653 3300005842 Bacteria 13447
62 Ga0068858_100004735 3300005842 Bacteria 13325
63 Ga0068858_100152594 3300005842 Bacteria 2172
64 Ga0068860_100000277 3300005843 Bacteria 73951
65 Ga0068860_100025718 3300005843 Bacteria 5677
66 Ga0068860_100081517 3300005843 Bacteria 3077
67 Ga0068862_100006742 3300005844 Bacteria 9521
68 Ga0068862_100043012 3300005844 Bacteria 3850
69 Ga0068862_100116093 3300005844 Bacteria 2354
70 Ga0081455_10001999 3300005937 Bacteria 24349
71 Ga0081455_10010785 3300005937 Bacteria 9234
72 Ga0081455_10025122 3300005937 Bacteria 5504
73 Ga0081538_10022549 3300005981 Bacteria 4560
74 Ga0081538_10043187 3300005981 Bacteria 2834
75 Ga0081540_1001855 3300005983 Bacteria 17700
76 Ga0081540_1004234 3300005983 Bacteria 11021
77 Ga0081539_10000172 3300005985 Bacteria 151505
78 Ga0081539_10000945 3300005985 Bacteria 54444
79 Ga0070717_10003388 3300006028 Bacteria 11396
80 Ga0070717_10087614 3300006028 Bacteria 2622
81 Ga0075365_10007637 3300006038 Bacteria 6075
82 Ga0070716_100032473 3300006173 Bacteria 2847
83 Ga0070712_100011182 3300006175 Bacteria 5682
84 Ga0075367_10006551 3300006178 Bacteria 5894
85 Ga0075367_10028753 3300006178 Bacteria 3173
86 Ga0075428_100024441 3300006844 Bacteria 6686
87 Ga0075428_100038474 3300006844 Bacteria 5264
88 Ga0075430_100006589 3300006846 Bacteria 9787
89 Ga0075430_100027825 3300006846 Bacteria 4802
90 Ga0075431_100012265 3300006847 Bacteria 8650
91 Ga0075431_100131776 3300006847 Bacteria 2578
92 Ga0075433_10005101 3300006852 Bacteria 10301
93 Ga0075434_100025341 3300006871 Bacteria 5803
94 Ga0075434_100061736 3300006871 Unclassified 3730
95 Ga0075429_100068896 3300006880 Bacteria 3080
96 Ga0097620_100037124 3300006931 Bacteria 4890
97 Ga0097620_100101888 3300006931 Bacteria 2928
98 Ga0099824_1020061 3300006942 Bacteria 5021
99 Ga0099823_1041746 3300006944 Bacteria 3247
100 Ga0105240_10005830 3300009093 Bacteria 18268
101 Ga0105240_10023440 3300009093 Bacteria 8160
102 Ga0105245_10019148 3300009098 Bacteria 5994
103 Ga0114129_10169209 3300009147 Bacteria 2980
104 Ga0105241_10033346 3300009174 Bacteria 3865
105 Ga0105241_10039081 3300009174 Bacteria 3579
106 Ga0105248_10002458 3300009177 Bacteria 20592
107 Ga0105248_10004400 3300009177 Bacteria 15593
108 Ga0105237_10002080 3300009545 Bacteria 25314
109 Ga0105237_10008069 3300009545 Bacteria 11447
110 Ga0105238_10012510 3300009551 Bacteria 8561
111 Ga0105238_10021902 3300009551 Bacteria 6511
112 Ga0105249_10106077 3300009553 Bacteria 2650
113 Ga0105239_10013790 3300010375 Bacteria 8970
114 Ga0105239_10036436 3300010375 Bacteria 5401
115 Ga0105239_10071320 3300010375 Bacteria 3817
116 Ga0157370_10118182 3300013104 Bacteria 2476
117 Ga0157369_10004231 3300013105 Bacteria 17000
118 Ga0157369_10006416 3300013105 Bacteria 13631
119 Ga0163162_10002075 3300013306 Bacteria 18823
120 Ga0163162_10088404 3300013306 Bacteria 3178
121 Ga0157375_10004230 3300013308 Bacteria 12447
122 Ga0163163_10056315 3300014325 Bacteria 3886
123 Ga0157380_10005593 3300014326 Bacteria 8780
124 Ga0157377_10001577 3300014745 Bacteria 9915
125 Ga0157377_10039086 3300014745 Bacteria 2623
126 Ga0157379_10002780 3300014968 Bacteria 14751
127 Ga0157379_10004214 3300014968 Bacteria 12278
128 Ga0206353_10233418 3300020082 Bacteria 3312
129 Ga0214544_1004900 3300021320 Bacteria 26442
130 Ga0214542_1000773 3300021321 Bacteria 61121
131 Ga0214545_1000546 3300021324 Bacteria 61121
132 Ga0214543_1000740 3300021327 Bacteria 57975
133 Ga0213876_10003824 3300021384 Bacteria 8525
134 Ga0228711_1003354 3300022739 Bacteria 24820
135 Ga0228710_1020734 3300022740 Bacteria 5504
136 Ga0228710_1022532 3300022740 Bacteria 4825
137 Ga0209148_1000769 3300025254 Bacteria 24248
138 Ga0209233_1003546 3300025261 Bacteria 5486
139 Ga0209455_1006431 3300025272 Bacteria 3467
140 Ga0209564_1006085 3300025295 Bacteria 6637
141 Ga0209758_1000117 3300025297 Bacteria 198325
142 Ga0209758_1000131 3300025297 Bacteria 184259
143 Ga0209758_1000715 3300025297 Bacteria 49020
144 Ga0209758_1001613 3300025297 Bacteria 25735
145 Ga0209758_1003904 3300025297 Bacteria 13015
146 Ga0209758_1013413 3300025297 Bacteria 4469
147 Ga0209758_1014597 3300025297 Bacteria 4161
148 Ga0209256_1004180 3300025299 Bacteria 9304
149 Ga0207426_1000223 3300025302 Bacteria 132636
150 Ga0207426_1000649 3300025302 Bacteria 42959
151 Ga0207426_1004531 3300025302 Bacteria 6724
152 Ga0209257_1001759 3300025304 Bacteria 24004
153 Ga0207692_10021870 3300025898 Bacteria 2934
154 Ga0207642_10026510 3300025899 Bacteria 2360
155 Ga0207680_10011656 3300025903 Bacteria 4450
156 Ga0207699_10003051 3300025906 Bacteria 7948
157 Ga0207705_10036647 3300025909 Bacteria 3509
158 Ga0207707_10001119 3300025912 Bacteria 25478
159 Ga0207695_10000136 3300025913 Bacteria 217596
160 Ga0207695_10112821 3300025913 Bacteria 2695
161 Ga0207693_10001156 3300025915 Bacteria 23542
162 Ga0207693_10002856 3300025915 Bacteria 14960
163 Ga0207693_10013014 3300025915 Bacteria 6713
164 Ga0207663_10000774 3300025916 Bacteria 14300
165 Ga0207660_10014006 3300025917 Bacteria 5263
166 Ga0207662_10016337 3300025918 Bacteria 4188
167 Ga0207657_10001946 3300025919 Bacteria 22297
168 Ga0207657_10008393 3300025919 Bacteria 10485
169 Ga0207657_10043192 3300025919 Bacteria 3973
170 Ga0207649_10047383 3300025920 Bacteria 2645
171 Ga0207659_10006028 3300025926 Bacteria 7395
172 Ga0207659_10013584 3300025926 Bacteria 5221
173 Ga0207659_10048325 3300025926 Bacteria 3013
174 Ga0207687_10102805 3300025927 Bacteria 2106
175 Ga0207700_10007838 3300025928 Bacteria 6566
176 Ga0207700_10113235 3300025928 Bacteria 2187
177 Ga0207644_10017691 3300025931 Bacteria 4820
178 Ga0207690_10023485 3300025932 Bacteria 3848
179 Ga0207706_10001109 3300025933 Bacteria 27405
180 Ga0207686_10013283 3300025934 Unclassified 4553
181 Ga0207709_10008026 3300025935 Bacteria 5848
182 Ga0207665_10001062 3300025939 Bacteria 18496
183 Ga0207665_10020678 3300025939 Bacteria 4327
184 Ga0207691_10003060 3300025940 Bacteria 16318
185 Ga0207711_10005831 3300025941 Bacteria 10405
186 Ga0207689_10000605 3300025942 Bacteria 34379
187 Ga0207689_10040014 3300025942 Bacteria 3880
188 Ga0207661_10000190 3300025944 Bacteria 39991
189 Ga0207661_10014300 3300025944 Bacteria 5813
190 Ga0207667_10034430 3300025949 Bacteria 5438
191 Ga0207651_10009638 3300025960 Bacteria 5304
192 Ga0207703_10002781 3300026035 Bacteria 14975
193 Ga0207703_10036825 3300026035 Bacteria 3896
194 Ga0207703_10125999 3300026035 Bacteria 2205
195 Ga0207678_10000497 3300026067 Bacteria 35757
196 Ga0207678_10014542 3300026067 Bacteria 6923
197 Ga0207708_10058409 3300026075 Bacteria 2943
198 Ga0207702_10000052 3300026078 Bacteria 137784
199 Ga0207648_10000190 3300026089 Bacteria 64762
200 Ga0207674_10032664 3300026116 Bacteria 5457
201 Ga0207675_100000193 3300026118 Bacteria 55695
202 Ga0207675_100000926 3300026118 Bacteria 29286
203 Ga0207675_100012201 3300026118 Bacteria 8025
204 Ga0207683_10025958 3300026121 Bacteria 5057
205 Ga0207698_10062725 3300026142 Bacteria 2904
206 Ga0209281_1000265 3300027111 Bacteria 100905
207 Ga0209389_1000028 3300027296 Bacteria 140401
208 Ga0209389_1000056 3300027296 Bacteria 107673
209 Ga0209589_1000007 3300027357 Bacteria 425699
210 Ga0209589_1000034 3300027357 Bacteria 138086
211 Ga0209489_100008 3300027361 Bacteria 425699
212 Ga0209489_100009 3300027361 Bacteria 263873
213 Ga0209489_102012 3300027361 Bacteria 41849
214 Ga0209700_100009 3300027363 Bacteria 425699
215 Ga0209700_100022 3300027363 Bacteria 229977
216 Ga0209282_1000206 3300027666 Bacteria 31601
217 Ga0268266_10000519 3300028379 Bacteria 54346
218 Ga0268266_10024302 3300028379 Bacteria 5155
219 Ga0268266_10045265 3300028379 Bacteria 3764
220 Ga0268265_10014628 3300028380 Bacteria 5350
221 Ga0268265_10031212 3300028380 Bacteria 3846
222 Ga0268264_10000153 3300028381 Bacteria 157298
223 Ga0268264_10010798 3300028381 Bacteria 7544
224 Ga0307517_10000035 3300028786 Bacteria 172762
225 Ga0265330_10018504 3300031235 Bacteria 3199
226 Ga0265339_10001704 3300031249 Bacteria 16196
227 Ga0307509_10062973 3300031507 Bacteria 3908
228 Ga0307508_10000013 3300031616 Bacteria 242867
229 Ga0307508_10038746 3300031616 Bacteria 4283
230 Ga0265314_10002700 3300031711 Bacteria 17767
231 Ga0307516_10006924 3300031730 Bacteria 13165
232 Ga0307516_10021829 3300031730 Bacteria 6579
233 Ga0307516_10042066 3300031730 Bacteria 4535
234 Ga0307516_10090999 3300031730 Bacteria 2879
235 Ga0307406_10065244 3300031901 Bacteria 2366
236 Ga0315914_1001715 3300031967 Bacteria 33297
237 Ga0307414_10033791 3300032004 Bacteria 3384
238 Ga0307507_10014602 3300033179 Bacteria 9343
239 Ga0307510_10005609 3300033180 Bacteria 14962
240 Ga0307510_10008381 3300033180 Bacteria 12314
241 Ga0307510_10013793 3300033180 Bacteria 9581
242 Ga0315913_1001231 3300033430 Bacteria 27472
243 Ga0315911_1000031 3300033442 Bacteria 74171
244 Ga0315915_1000032 3300033464 Bacteria 87024
245 Ga0373940_0002091 3300035088 Bacteria 3801
246 Ga0373954_0000659 3300035118 Bacteria 13205
247 Ga0373943_0015393 3300035170 Bacteria 3473
248 Ga0373955_0000335 3300035172 Bacteria 19651
249 Ga0373924_0007736 3300035410 Bacteria 3885
250 Ga0373931_0000495 3300035691 Bacteria 16089
251 Ga0373931_0001170 3300035691 Bacteria 11177
252 Ga0373931_0002473 3300035691 Bacteria 8191
253 Ga0373931_0008164 3300035691 Bacteria 4960
254 Ga0373931_0049221 3300035691 Bacteria 2237
255 Ga0373935_0001283 3300035692 Bacteria 13847
256 Ga0373935_0007817 3300035692 Bacteria 6410
257 Ga0373935_0040819 3300035692 Bacteria 2913
258 Ga0373927_0000515 3300035695 Bacteria 29473
259 Ga0373933_0000106 3300035724 Bacteria 53181
260 Ga0373937_0001397 3300036401 Bacteria 20152
261 Ga0373937_0069333 3300036401 Bacteria 3251
262 Ga0373925_0001116 3300037068 Bacteria 23846
263 Ga0373925_0001962 3300037068 Bacteria 17023
264 Ga0395900_0009415 3300037418 Bacteria 10015
265 Ga0395900_0031469 3300037418 Bacteria 5452
266 Ga0395898_0019871 3300037466 Bacteria 6832
267 Ga0395898_0022935 3300037466 Bacteria 6311
268 Ga0395898_0119894 3300037466 Bacteria 2520
269 Ga0395905_0008098 3300037471 Bacteria 10382
270 Ga0395905_0029509 3300037471 Bacteria 5167
271 Ga0436364_1078792 3300037853 Bacteria 3585
272 Ga0436364_1526996 3300037853 Bacteria 7973
273 Ga0395901_0009062 3300038443 Bacteria 10077
274 Ga0395901_0034707 3300038443 Bacteria 5210
275 Ga0436365_0160289 3300039437 Bacteria 39593
276 Ga0436365_1466852 3300039437 Bacteria 29036
277 Ga0436363_0520596 3300039450 Bacteria 6670
278 Ga0436362_1000225 3300039453 Bacteria 8762
279 Ga0466972_0000110 3300044658 Bacteria 71304
280 Ga0466972_0025825 3300044658 Bacteria 2910
281 Ga0466966_0000101 3300044684 Bacteria 51920
282 Ga0466961_0000031 3300044693 Bacteria 85869
283 Ga0453684_0052569 3300044712 Bacteria 5325
284 Ga0466960_0018773 3300044901 Bacteria 3035
285 Ga0466959_0006172 3300045049 Bacteria 8280
286 Ga0466958_0037008 3300045836 Bacteria 2923
287 Ga0466967_0044184 3300045976 Bacteria 3863
288 Ga0495592_0006367 3300046454 Bacteria 8792
289 Ga0495603_0000156 3300046455 Bacteria 34369
290 Ga0495603_0004630 3300046455 Bacteria 8216
291 Ga0495629_0000297 3300046459 Bacteria 42433
292 Ga0495629_0002353 3300046459 Bacteria 14564
293 Ga0495629_0003900 3300046459 Bacteria 11221
294 Ga0495629_0076616 3300046459 Bacteria 2335
295 Ga0495638_0008062 3300046460 Bacteria 7499
296 Ga0495641_0003033 3300046461 Bacteria 12847
297 Ga0495651_0004028 3300046462 Bacteria 11230
298 Ga0495651_0057379 3300046462 Bacteria 2989
299 Ga0495582_0000087 3300046473 Bacteria 47529
300 Ga0495639_0000153 3300046475 Bacteria 35461
301 Ga0495639_0019616 3300046475 Bacteria 2951
302 Ga0495662_0002946 3300046476 Bacteria 8591
303 Ga0495664_0003105 3300046477 Bacteria 9008
304 Ga0495594_0001275 3300046499 Bacteria 13162
305 Ga0495606_0001387 3300046507 Bacteria 32754
306 Ga0495608_0007141 3300046511 Bacteria 7901
307 Ga0495628_0030286 3300046516 Bacteria 4382
308 Ga0495628_0042075 3300046516 Bacteria 3645
309 Ga0495630_0000735 3300046517 Bacteria 23119
310 Ga0495632_0019027 3300046519 Bacteria 3750
311 Ga0495644_0011683 3300046523 Bacteria 3381
312 Ga0495648_0003807 3300046524 Bacteria 13105
313 Ga0495648_0021682 3300046524 Bacteria 4445
314 Ga0495648_0036405 3300046524 Bacteria 3176
315 Ga0495652_0003411 3300046529 Bacteria 15714
316 Ga0495652_0004109 3300046529 Bacteria 14044
317 Ga0495652_0036519 3300046529 Bacteria 4271
318 Ga0495665_0000117 3300046531 Bacteria 37802
319 Ga0495640_0002597 3300046533 Bacteria 14524
320 Ga0495640_0004127 3300046533 Bacteria 11621
321 Ga0495640_0015267 3300046533 Bacteria 5782
322 Ga0495586_0035513 3300046535 Bacteria 2678
323 Ga0495587_0001788 3300046536 Bacteria 14356
324 Ga0495587_0039054 3300046536 Bacteria 2843
325 Ga0495621_0009743 3300046539 Bacteria 2927
326 Ga0495645_0018518 3300046543 Bacteria 5003
327 Ga0495622_0001116 3300046557 Bacteria 14039
328 Ga0495667_0003464 3300046559 Bacteria 10572
329 Ga0495667_0009440 3300046559 Bacteria 6609
330 Ga0495656_0002929 3300046615 Bacteria 5723
331 Ga0495656_0020656 3300046615 Bacteria 2556
332 Ga0495668_0024397 3300046616 Bacteria 3439
333 Ga0495634_0030614 3300046642 Bacteria 3716
334 Ga0495634_0033433 3300046642 Bacteria 3534
335 Ga0495635_0004107 3300046663 Bacteria 10098
336 Ga0495635_0010975 3300046663 Bacteria 6349
337 Ga0495635_0032682 3300046663 Bacteria 3608
338 Ga0495657_0002601 3300046675 Bacteria 15103
339 Ga0495657_0003718 3300046675 Bacteria 12347
340 Ga0495623_0027760 3300046679 Bacteria 3644
341 Ga0495646_0017874 3300046680 Bacteria 4492
342 Ga0495647_0000365 3300046681 Bacteria 12760
343 Ga0495658_0000644 3300046683 Bacteria 18891
344 Ga0495658_0004432 3300046683 Bacteria 6908
345 Ga0495669_0000982 3300046684 Bacteria 11908
346 Ga0495613_0005220 3300046689 Bacteria 9755
347 Ga0495613_0032617 3300046689 Bacteria 3870
348 Ga0495613_0081747 3300046689 Bacteria 2347
349 Ga0495624_0016256 3300046690 Bacteria 5010
350 Ga0495670_0018752 3300046691 Bacteria 3408
351 Ga0495649_0027690 3300046694 Bacteria 3143
352 Ga0495589_0031484 3300046794 Bacteria 2670
353 Ga0495600_0000869 3300046809 Bacteria 16143
354 Ga0495600_0019722 3300046809 Bacteria 4309
355 Ga0495581_0000543 3300047315 Bacteria 19442
356 Ga0495604_0000751 3300047317 Bacteria 27241
357 Ga0495674_0000177 3300047319 Bacteria 50030
358 Ga0495674_0004259 3300047319 Bacteria 13781
359 Ga0495676_0034415 3300047321 Bacteria 4252
360 Ga0495680_0001530 3300047322 Bacteria 24762
361 Ga0495680_0034539 3300047322 Bacteria 4081
362 Ga0495680_0061142 3300047322 Bacteria 2899
363 Ga0495687_007739 3300047443 Bacteria 6263
364 Ga0495675_0001832 3300047444 Bacteria 12677
365 Ga0495675_0003409 3300047444 Bacteria 9576
366 Ga0495673_0024131 3300047469 Bacteria 2945
367 Ga0495684_0002187 3300047471 Bacteria 15656
368 Ga0495684_0085665 3300047471 Bacteria 2389
369 Ga0495593_0000156 3300047673 Bacteria 34308
370 Ga0495593_0001736 3300047673 Bacteria 12917
371 Ga0495593_0038852 3300047673 Bacteria 2569
372 Ga0495593_0045484 3300047673 Bacteria 2342
373 Ga0495602_0006495 3300048088 Bacteria 12268
374 Ga0496100_0033503 3300048903 Bacteria 3215
375 Ga0496101_0001236 3300048904 Bacteria 15279
376 Ga0496101_0010462 3300048904 Bacteria 6126
377 Ga0496101_0015994 3300048904 Bacteria 5063
378 Ga0496101_0044342 3300048904 Bacteria 3182
379 Ga0496101_0076242 3300048904 Bacteria 2470
380 Ga0496102_0010192 3300048905 Bacteria 8077
381 Ga0496102_0018514 3300048905 Bacteria 6122
382 Ga0496102_0020699 3300048905 Bacteria 5813
383 Ga0496102_0030554 3300048905 Bacteria 4823
384 Ga0496104_0000596 3300048907 Bacteria 30880
385 Ga0496104_0003679 3300048907 Bacteria 13243
386 Ga0496104_0007390 3300048907 Bacteria 9708
387 Ga0496104_0014958 3300048907 Bacteria 7017
388 Ga0496104_0019617 3300048907 Bacteria 6189
389 Ga0496105_0001079 3300048908 Bacteria 18889
390 Ga0496105_0003448 3300048908 Bacteria 11706
391 Ga0496105_0004451 3300048908 Bacteria 10549
392 Ga0496105_0024331 3300048908 Bacteria 4920
393 Ga0496106_0001932 3300048909 Bacteria 15544
394 Ga0496106_0004263 3300048909 Bacteria 10642
395 Ga0496106_0015640 3300048909 Bacteria 5612
396 Ga0496106_0034457 3300048909 Bacteria 3781
397 Ga0496107_0005436 3300048910 Bacteria 8721
398 Ga0496107_0006381 3300048910 Bacteria 8106
399 Ga0496108_0000606 3300048911 Bacteria 28078
400 Ga0496108_0001980 3300048911 Bacteria 16402
401 Ga0496108_0024443 3300048911 Bacteria 4974
402 Ga0496109_0012968 3300048912 Bacteria 7204
403 Ga0496109_0014368 3300048912 Bacteria 6889
404 Ga0496109_0015563 3300048912 Bacteria 6632
405 Ga0496109_0044041 3300048912 Bacteria 4047
406 Ga0496109_0050586 3300048912 Bacteria 3784
407 Ga0496110_0002320 3300048913 Bacteria 14224
408 Ga0496110_0005352 3300048913 Bacteria 10053
409 Ga0496110_0014649 3300048913 Bacteria 6517
410 Ga0496110_0026977 3300048913 Bacteria 4920
411 Ga0496110_0047998 3300048913 Bacteria 3741
412 Ga0496111_0005127 3300048914 Bacteria 8346
413 Ga0496111_0030464 3300048914 Bacteria 3836
414 Ga0496111_0031417 3300048914 Bacteria 3783
415 Ga0496111_0038516 3300048914 Bacteria 3426
416 Ga0496112_0000057 3300048915 Bacteria 77700
417 Ga0496112_0003534 3300048915 Bacteria 12969
418 Ga0496112_0004346 3300048915 Bacteria 11981
419 Ga0496112_0004485 3300048915 Bacteria 11845
420 Ga0496112_0022545 3300048915 Bacteria 6001
421 Ga0496112_0028641 3300048915 Bacteria 5378
422 Ga0496112_0093837 3300048915 Bacteria 2971
423 Ga0496113_0018879 3300048916 Bacteria 4812
424 Ga0496113_0070029 3300048916 Bacteria 2665
425 Ga0496113_0073940 3300048916 Bacteria 2598
426 Ga0496114_0067416 3300048917 Bacteria 3002
427 Ga0496115_0003709 3300048918 Bacteria 10987
428 Ga0496115_0005163 3300048918 Bacteria 9498
429 Ga0496115_0012229 3300048918 Bacteria 6454
430 Ga0496115_0027149 3300048918 Bacteria 4475
431 Ga0496115_0044460 3300048918 Bacteria 3542
432 Ga0496115_0053729 3300048918 Bacteria 3233
433 Ga0496116_0009062 3300048919 Bacteria 8534
434 Ga0496117_0004621 3300048920 Bacteria 15000
435 Ga0496118_0007562 3300048921 Bacteria 11469
436 Ga0496119_0012830 3300048922 Bacteria 6757
437 Ga0496120_0037737 3300048923 Bacteria 2864
438 Ga0496121_0000287 3300048924 Bacteria 104774
439 Ga0496121_0000689 3300048924 Bacteria 62997
440 Ga0496121_0008649 3300048924 Bacteria 11906
441 Ga0496121_0011016 3300048924 Bacteria 10094
442 Ga0496121_0021790 3300048924 Bacteria 6257
443 Ga0496124_0005646 3300048927 Bacteria 13982
444 Ga0496125_0000654 3300048928 Bacteria 57851
445 Ga0496125_0007037 3300048928 Bacteria 12025
446 Ga0496125_0036475 3300048928 Bacteria 4292
447 Ga0496126_0001378 3300048929 Bacteria 38419
448 Ga0496126_0003243 3300048929 Bacteria 20798
449 Ga0496126_0011998 3300048929 Bacteria 8906
450 Ga0496126_0017009 3300048929 Bacteria 7256
451 Ga0496126_0023542 3300048929 Bacteria 5967
452 Ga0496126_0025256 3300048929 Bacteria 5720
453 Ga0496126_0030165 3300048929 Bacteria 5141
454 Ga0496126_0036133 3300048929 Bacteria 4622
455 Ga0501032_0024203 3300049569 Bacteria 4194
456 Ga0501033_0005716 3300049570 Bacteria 9806
457 Ga0501033_0037658 3300049570 Bacteria 3619
458 Ga0501033_0094448 3300049570 Bacteria 2187
459 Ga0501034_0000673 3300049571 Bacteria 51868
460 Ga0501038_0097069 3300049574 Bacteria 2458
461 Ga0501039_0063680 3300049575 Bacteria 2857
462 Ga0501039_0099879 3300049575 Bacteria 2265
463 Ga0501040_0096024 3300049576 Bacteria 2063
464 Ga0501043_0008365 3300049579 Bacteria 8145
465 Ga0501047_0042603 3300049581 Bacteria 4386
466 Ga0501047_0043098 3300049581 Bacteria 4360
467 Ga0501048_0029091 3300049582 Bacteria 4009
468 Ga0501073_0008648 3300049589 Bacteria 7543
469 Ga0501073_0019250 3300049589 Bacteria 4931
470 Ga0501076_0085579 3300049592 Bacteria 2533
471 Ga0501077_0008045 3300049593 Bacteria 6517
472 Ga0501079_0022509 3300049741 Bacteria 4833
473 Ga0501079_0034949 3300049741 Bacteria 3867
474 Ga0501035_0002405 3300049822 Bacteria 18344
475 Ga0501044_0004838 3300049823 Bacteria 15058
476 Ga0501045_0011955 3300049824 Bacteria 6103
477 nmdc:mga0yw44_5401_c1 3300050492 Bacteria 6030
478 nmdc:mga05p37_38197_c1 3300050507 Bacteria 5888
479 nmdc:mga09592_60106_c1 3300050508 Bacteria 3213
480 nmdc:mga0qj67_6455_c1 3300050509 Bacteria 8620
481 nmdc:mga06r32_117076_c1 3300050510 Bacteria 2626
482 nmdc:mga0n895_22726_c1 3300050512 Bacteria 5882
483 nmdc:mga0n895_7197_c1 3300050512 Bacteria 9526
484 nmdc:mga0rr50_40512_c2 3300050513 Bacteria 2176
485 Ga0500635_0005138 3300053080 Bacteria 3413
486 Ga0495595_0003363 3300053084 Bacteria 6349
487 Ga0495619_0008790 3300053085 Bacteria 6388
488 Ga0500643_000077 3300053087 Bacteria 105070
489 Ga0500651_0029465 3300053093 Bacteria 3452
490 Ga0500566_0000228 3300053094 Bacteria 29965
491 Ga0500557_000117 3300053105 Bacteria 22427
492 Ga0500595_000743 3300053119 Bacteria 19196
493 Ga0500595_002140 3300053119 Bacteria 10058
494 Ga0500595_002200 3300053119 Bacteria 9908
495 Ga0500595_003844 3300053119 Bacteria 6898
496 Ga0500607_055527 3300053121 Bacteria 2093
497 Ga0500642_0001154 3300053130 Bacteria 7564
498 Ga0500652_000004 3300053131 Bacteria 173428
499 Ga0500652_032248 3300053131 Bacteria 2063
500 Ga0500603_001283 3300053150 Bacteria 5764
501 Ga0500616_0000034 3300053153 Bacteria 396651
502 Ga0500616_0000036 3300053153 Bacteria 390769
503 Ga0500616_0014179 3300053153 Bacteria 4589
504 Ga0500622_0007580 3300053156 Bacteria 6147
505 Ga0500636_0000157 3300053177 Bacteria 35453
506 Ga0500636_0009991 3300053177 Bacteria 5524
507 Ga0500625_004013 3300053729 Bacteria 5932
508 Ga0500601_000133 3300053737 Bacteria 15043
509 Ga0501084_0064169 3300054114 Bacteria 3074
510 Ga0501084_0079761 3300054114 Bacteria 2744
511 Ga0501082_0051378 3300060353 Bacteria 3553
512 Ga0466962_0027149 3300061719 Bacteria 2748
513 Ga0530510_0023100 3300061734 Bacteria 4429
514 2507506855 2507262055 Bacteria 8048963
515 2508540890 2508501009 Bacteria 7784016
516 2508696818 2508501042 Bacteria 8719808
517 2509139770 2508501127 Bacteria 7037543
518 2511399234 2511231028 Bacteria 8046582
519 2513623821 2513237092 Bacteria 8341956
520 2513641485 2513237094 Bacteria 8789602
521 2513650491 2513237095 Bacteria 8976980
522 2513655224 2513237096 Bacteria 8722461
523 2513677640 2513237098 Bacteria 9902361
524 2513693436 2513237101 Bacteria 7952346
525 2513705234 2513237102 Bacteria 7703324
526 2513720122 2513237104 Bacteria 10034502
527 2513861474 2513237137 Bacteria 9558895
528 2513877407 2513237139 Bacteria 8737671
529 2513915752 2513237145 Bacteria 8979722
530 2514013086 2513237161 Bacteria 8871253
531 2514588647 2513237351 Bacteria 6968952
532 2515613060 2515154107 Bacteria 6795637
533 2515629685 2515154112 Bacteria 8294334
534 2517106369 2517093001 Bacteria 9002274
535 2517568133 2517487022 Bacteria 7227575
536 2517894942 2517572143 Bacteria 9484767
537 2524439388 2524023205 Bacteria 8918781
538 2524464947 2524023210 Bacteria 9029266
539 2524534722 2524023228 Bacteria 10118060
540 2528853115 2528768022 Bacteria 10457665
541 2597812482 2597489875 Bacteria 7010078
542 2599105143 2597490356 Bacteria 7030811
543 2617348207 2617270735 Bacteria 9163226
544 2643770910 2643221550 Bacteria 4619371
545 2643838214 2643221564 Bacteria 4193379
546 2643985073 2643221595 Bacteria 6565519
547 2644155814 2643221627 Bacteria 6761570
548 2644287483 2643221651 Bacteria 4798932
549 2671123049 2667528175 Bacteria 7532676
550 2723848330 2721755755 Bacteria 8322773
551 2728748828 2728368998 Bacteria 8720350
552 2738744100 2738541281 Bacteria 5112672
553 2739353330 2738543032 Bacteria 5115625
554 2745078100 2744054633 Bacteria 8678936
555 2793065374 2791355196 Bacteria 7323613
556 2793073964 2791355197 Bacteria 8420563
557 2793079568
558 2802723918 2802428859 Bacteria 6667919
559 2802733739 2802428860 Bacteria 6525526
560 2802740906 2802428861 Bacteria 6534206
561 2805918942 2802429603 Bacteria 8777136
562 2818242088 2816332527 Bacteria 8933356
563 2821448426 2821443989 Bacteria 7658172
564 2824609244 2824600985 Bacteria 8488197
565 2824613602 2824609381 Bacteria 8672835
566 2824620519 2824617872 Bacteria 8814715
567 2824634135 2824626560 Bacteria 8813858
568 2824658144 2824653114 Bacteria 8493680
569 2824664334 2824661429 Bacteria 9877870
570 2824679268 2824671348 Bacteria 8369588
571 2824687701 2824679649 Bacteria 8248951
572 2824696061 2824687955 Bacteria 8360029
573 2824752046 2824746037 Bacteria 7911610
574 2824757518 2824753945 Bacteria 9787441
575 2824768038 2824763712 Bacteria 9792355
576 2824779644 2824773399 Bacteria 8360218
577 2829749792 2829745981 Bacteria 5406054
578 2841945708 2841941048 Bacteria 8688029
579 2841954899 2841949485 Bacteria 8680857
580 2841963254 2841957949 Bacteria 8652217
581 2841972297 2841966195 Bacteria 8673214
582 2841980380 2841974524 Bacteria 8931498
583 2841988545 2841983080 Bacteria 8395090
584 2842044844 2842038055 Bacteria 8002051
585 2842052970 2842045827 Bacteria 8006841
586 2844320758 2844315083 Bacteria 8138177
587 2846955180 2846952575 Bacteria 6587527
588 2847938284 2847930680 Bacteria 9342022
589 2847940203 2847939898 Bacteria 8606328
590 2848858526 2848858292 Bacteria 7391279
591 2849077599 2849076700 Bacteria 7039503
592 2856335969 2856334872 Bacteria 7037011
593 2856345330 2856342000 Bacteria 7176905
594 2857369975 2857367948 Bacteria 6965560
595 2857510828 2857509624 Bacteria 7472071
596 2857529782 2857524615 Bacteria 6615449
597 2861693355 2861691609 Bacteria 5628931
598 2874593998 2874590934 Bacteria 8299676
599 2874607449 2874604998 Bacteria 7834745
600 2874618850 2874612657 Bacteria 8252029
601 2874626010 2874620515 Bacteria 8290088
602 2874630763 2874628541 Bacteria 8630250
603 2874647929 2874645413 Bacteria 8214782
604 2876774136 2876771140 Bacteria 8287509
605 2876814770 2876808645 Bacteria 8824342
606 2876821088 2876818435 Bacteria 8274608
607 2879078913 2879074833 Bacteria 8279565
608 2879086129 2879083081 Bacteria 8587928
609 2879104833 2879099564 Bacteria 10442239
610 2879111082 2879110137 Bacteria 8907982
611 2879127928 2879127579 Bacteria 8294491
612 2879147652 2879142872 Bacteria 8267021
613 2881364336 2881364244 Bacteria 7710352
614 2881666756 2881665667 Bacteria 8175609
615 2885367922 2885366525 Bacteria 8326213
616 2885375365 2885374607 Bacteria 8927485
617 2885388794 2885383462 Bacteria 9473874
618 2885414700 2885409591 Bacteria 9235467
619 2888346433 2888343758 Bacteria 6611049
620 2888386160 2888378607 Bacteria 9652610
621 2888392111 2888388044 Bacteria 7304136
622 2888426308 2888419890 Bacteria 7857137
623 2889037124 2889033259 Bacteria 9099371
624 2889307897 2889306138 Bacteria 6358934
625 2889790883 2889790730 Bacteria 5689708
626 2889915268 2889914905 Bacteria 5702301
627 2899277809 2899275550 Bacteria 3958688
628 2902407853 2902405164 Bacteria 6784948
629 2903728129 2903727486 Bacteria 8281579
630 2903753356 2903748898 Bacteria 9972761
631 2903771155 2903768456 Bacteria 9749579
632 2904672482 2904666416 Bacteria 8226587
633 2904698020 2904690495 Bacteria 9412302
634 2904712917 2904711408 Bacteria 9771557
635 2906605955 2906602504 Bacteria 8295279
636 2906611674
637 2906632858 2906626472 Bacteria 8826946
638 2906639654 2906635258 Bacteria 8601019
639 2906645270 2906643746 Bacteria 8722424
640 2906660603 2906660503 Bacteria 8595048
641 2908745260 2908739725 Bacteria 8628932
642 2908763058 2908756301 Bacteria 8864324
643 2908782385 2908775508 Bacteria 8092255
644 2916067236 2916061851 Bacteria 6737736
645 2917557680 2917554339 Bacteria 4987857
646 2922155843 2922151315 Bacteria 6902399
647 2922361270 2922361189 Bacteria 7436256
648 2922370393
649 2922392902 2922386360 Bacteria 7017218
650 2922399725 2922393267 Bacteria 8285685
651 2922427671
652 2924758554 2924754689 Bacteria 6774424
653 2929621415 2929615660 Bacteria 9193770
654 2929631771 2929624759 Bacteria 9339455
655 2932792548 2932784394 Bacteria 9704911
656 2932798664 2932794094 Bacteria 7915132
657 2932806534 2932801729 Bacteria 7987968
658 2932815366 2932809354 Bacteria 9135765
659 2932824355 2932818245 Bacteria 9955613
660 2932832245 2932828146 Bacteria 9745859
661 2933583560 2933577622 Bacteria 9116884
662 2935615863 2935608549 Bacteria 8203142
663 2935622183 2935616580 Bacteria 9032984
664 2935632378 2935630451 Bacteria 8169952
665 2935646441 2935638405 Bacteria 10015038
666 2935653880 2935648319 Bacteria 8801166
667 2935662629 2935656913 Bacteria 8965014
668 2935669278 2935665750 Bacteria 9571747
669 2935683163 2935675223 Bacteria 9928132
670 2935692105 2935684952 Bacteria 9590419
671 2935702490 2935694250 Bacteria 9291695
672 2935708645 2935703347 Bacteria 10242284
673 2935720656 2935713505 Bacteria 9608509
674 2935729937 2935722832 Bacteria 9608746
675 2935739080 2935732158 Bacteria 9706831
676 2935748379 2935741537 Bacteria 9707219
677 2935758581 2935750917 Bacteria 9590372
678 2935765991 2935760218 Bacteria 9817913
679 2935772259 2935769743 Bacteria 7878163
680 2935783795 2935777560 Bacteria 8077691
681 2935787709 2935785616 Bacteria 7962367
682 2935793734 2935793552 Bacteria 8012592
683 2935805994 2935801545 Bacteria 9301974
684 2935815446 2935810662 Bacteria 9401221
685 2935826810 2935819856 Bacteria 8261050
686 2935835594 2935827899 Bacteria 10038562
687 2935843372 2935837841 Bacteria 9454360
688 2935860430 2935855204 Bacteria 9035059
689 2935867828 2935864058 Bacteria 9784707
690 2935878363 2935873716 Bacteria 9632195
691 2935888627 2935883170 Bacteria 7964738
692 2935914920 2935908558 Bacteria 8568796
693 2935923125 2935916978 Bacteria 9113783
694 2935932401 2935926038 Bacteria 8601059
695 2935940999 2935934488 Bacteria 8602579
696 2935949108 2935942939 Bacteria 8599779
697 2935957803 2935951376 Bacteria 8602333
698 2935964802 2935959822 Bacteria 7869783
699 2935974076 2935967501 Bacteria 8603075
700 2935981367 2935975950 Bacteria 8347125
701 2935990266 2935984226 Bacteria 8302647
702 2935998754 2935992306 Bacteria 9802711
703 2936007059 2936002035 Bacteria 9362176
704 2936015370 2936011229 Bacteria 8801034
705 2936024004 2936019824 Bacteria 8804134
706 2936033019 2936028420 Bacteria 8965941
707 2936040684 2936037263 Bacteria 9446081
708 2936051112 2936046547 Bacteria 8903709
709 2936058489 2936055302 Bacteria 8785755
710 2937000544 2936996657 Bacteria 6298727
711 2937088734 2937084907 Bacteria 6618516
712 2937845558 2937843397 Bacteria 5256375
713 2940564485 2940556831 Bacteria 9590747
714 2941508325 2941507105 Bacteria 8166816
715 2941515169 2941515067 Bacteria 8166720
716 2941524256 2941523033 Bacteria 8169134
717 2941536581 2941531003 Bacteria 7653939
718 2941544918 2941538514 Bacteria 9402094
719 2957380335 2957375807 Bacteria 6425588
720 2958123923 2958122699 Bacteria 7280457
721 2960632126 2960631154 Bacteria 6732508
722 2960699838 2960693952 Bacteria 6749742
723 2965035437 2965032056 Bacteria 6887443
724 2967691668 2967686174 Bacteria 6678622
725 2970032967 2970026789 Bacteria 6785236
726 2970546327 2970540015 Bacteria 6977556
727 2977879166 2977872689 Bacteria 7270173
728 2977965195 2977957713 Bacteria 6877875
729 2996340830 2996336353 Bacteria 5511628
730 3003667845 3003665799 Bacteria 7279786
731 3005477386 3005474847 Bacteria 9259049
732 3005485336 3005483717 Bacteria 7877331
733 3005507676 3005506211 Bacteria 6943378
734 3005593906 3005587118 Bacteria 7794411
735 3005601078 3005594810 Bacteria 8716512
736 3005723851 3005718088 Bacteria 8283608
737 643602867 643348564 Bacteria 8839022
738 8004402504 8004395343 Bacteria 6620908
739 8004695454 8004695233 Bacteria 6731676
740 8006929701 8006926726 Bacteria 6749210
741 8006933877 8006933436 Bacteria 10410654
742 8006969643 8006964411 Bacteria 8966052
743 8006983550 8006973647 Bacteria 10679141
744 8006990638 8006984368 Bacteria 9651211
745 8006998718 8006994254 Bacteria 8309700
746 8016519907 8016511872 Bacteria 9921665
747 8016527819 8016522445 Bacteria 8156687
748 8016532929 8016530956 Bacteria 8155261
749 8016546165 8016539877 Bacteria 8155419
750 8016555960 8016548790 Bacteria 8155074
751 8016564313 8016557553 Bacteria 8154380
752 8016571239 8016566248 Bacteria 8158151
753 8016583724 8016575299 Bacteria 8154085
754 8016583939 8016583857 Bacteria 10421953
755 8016601999 8016595262 Bacteria 8149947
756 8016616643 8016613128 Bacteria 8794220
757 8016624509 8016622563 Bacteria 7999408
758 8016633980 8016630954 Bacteria 9217207
759 8017065637 8017057580 Bacteria 10023680
760 8019532730 8019530166 Bacteria 8155624
761 8019559781 8019555841 Bacteria 9642137
762 8019569887 8019565922 Bacteria 9639779
763 8019585045 8019576017 Bacteria 10049540
764 8019593011 8019586578 Bacteria 10212056
765 8019598453 8019597564 Bacteria 10041141
766 8019632468 8019629233 Bacteria 8687553
767 8019647417 8019638758 Bacteria 9062356
768 8019660385 8019659431 Bacteria 8577854
769 8019669804 8019668869 Bacteria 8791617
770 8019686289 8019678201 Bacteria 8863603
771 8019692446 8019687851 Bacteria 8712826
772 8055744382 8055742211 Bacteria 9226248
773 8056676646 8056673599 Bacteria 7871253
774 8056689644 8056681323 Bacteria 8472857
775 8056694005 8056689827 Bacteria 6712655
776 8056969233 8056967851 Bacteria 9038162
777 Ga0496121_0025269
778 JGI25406J46586_10000022
779 JGI25153J46596_10004117
780 JGI25153J46596_10004387
781 Ga0055542_1004255
782 Ga0055531_10005784
783 Ga0065165_1000054
784 Ga0065165_1002102
785 Ga0065165_1006247
786 Ga0070683_100071815
787 Ga0068869_100004580
788 Ga0070680_100004188
789 Ga0070680_100020948
790 Ga0068868_100068083
791 Ga0070660_100013688
792 Ga0070660_100050007
793 Ga0070691_10031562
794 Ga0070668_100034701
795 Ga0070668_100079742
796 Ga0070671_100043306
797 Ga0070688_100006731
798 Ga0070659_100020118
799 Ga0070659_100101847
800 Ga0070714_100006412
801 Ga0070713_100005380
802 Ga0070713_100007126
803 Ga0070711_100002557
804 Ga0070711_100005586
805 Ga0070711_100033703
806 Ga0070700_100020913
807 Ga0070708_100035961
808 Ga0070663_100000901
809 Ga0070678_100055336
810 Ga0070662_100000752
811 Ga0070681_10039622
812 Ga0068867_100006986
813 Ga0070685_10022936
814 Ga0070679_100009603
815 Ga0070679_100015566
816 Ga0070684_100028144
817 Ga0070697_100021880
818 Ga0068853_100003918
819 Ga0068853_100060269
820 Ga0068853_100082212
821 Ga0070672_100012261
822 Ga0070672_100040663
823 Ga0070695_100005829
824 Ga0070696_100033656
825 Ga0068855_100058917
826 Ga0068856_100018079
827 Ga0068852_100002087
828 Ga0068852_100065941
829 Ga0068859_100037124
830 Ga0068859_100101883
831 Ga0068864_100058790
832 Ga0068861_100001850
833 Ga0068861_100005067
834 Ga0068861_100016570
835 Ga0068861_100021141
836 Ga0068863_100131641
837 Ga0068858_100004653
838 Ga0068858_100004735
839 Ga0068858_100152594
840 Ga0068860_100000277
841 Ga0068860_100025718
842 Ga0068860_100081517
843 Ga0068862_100006742
844 Ga0068862_100043012
845 Ga0068862_100116093
846 Ga0081455_10001999
847 Ga0081455_10010785
848 Ga0081455_10025122
849 Ga0081538_10022549
850 Ga0081538_10043187
851 Ga0081540_1001855
852 Ga0081540_1004234
853 Ga0081539_10000172
854 Ga0081539_10000945
855 Ga0070717_10003388
856 Ga0070717_10087614
857 Ga0075365_10007637
858 Ga0070716_100032473
859 Ga0070712_100011182
860 Ga0075367_10006551
861 Ga0075367_10028753
862 Ga0075428_100024441
863 Ga0075428_100038474
864 Ga0075430_100006589
865 Ga0075430_100027825
866 Ga0075431_100012265
867 Ga0075431_100131776
868 Ga0075433_10005101
869 Ga0075434_100025341
870 Ga0075434_100061736
871 Ga0075429_100068896
872 Ga0097620_100037124
873 Ga0097620_100101888
874 Ga0099824_1020061
875 Ga0099823_1041746
876 Ga0105240_10005830
877 Ga0105240_10023440
878 Ga0105245_10019148
879 Ga0114129_10169209
880 Ga0105241_10033346
881 Ga0105241_10039081
882 Ga0105248_10002458
883 Ga0105248_10004400
884 Ga0105237_10002080
885 Ga0105237_10008069
886 Ga0105238_10012510
887 Ga0105238_10021902
888 Ga0105249_10106077
889 Ga0105239_10013790
890 Ga0105239_10036436
891 Ga0105239_10071320
892 Ga0157370_10118182
893 Ga0157369_10004231
894 Ga0157369_10006416
895 Ga0163162_10002075
896 Ga0163162_10088404
897 Ga0157375_10004230
898 Ga0163163_10056315
899 Ga0157380_10005593
900 Ga0157377_10001577
901 Ga0157377_10039086
902 Ga0157379_10002780
903 Ga0157379_10004214
904 Ga0206353_10233418
905 Ga0214544_1004900
906 Ga0214542_1000773
907 Ga0214545_1000546
908 Ga0214543_1000740
909 Ga0213876_10003824
910 Ga0228711_1003354
911 Ga0228710_1020734
912 Ga0228710_1022532
913 Ga0209148_1000769
914 Ga0209233_1003546
915 Ga0209455_1006431
916 Ga0209564_1006085
917 Ga0209758_1000117
918 Ga0209758_1000131
919 Ga0209758_1000715
920 Ga0209758_1001613
921 Ga0209758_1003904
922 Ga0209758_1013413
923 Ga0209758_1014597
924 Ga0209256_1004180
925 Ga0207426_1000223
926 Ga0207426_1000649
927 Ga0207426_1004531
928 Ga0209257_1001759
929 Ga0207692_10021870
930 Ga0207642_10026510
931 Ga0207680_10011656
932 Ga0207699_10003051
933 Ga0207705_10036647
934 Ga0207707_10001119
935 Ga0207695_10000136
936 Ga0207695_10112821
937 Ga0207693_10001156
938 Ga0207693_10002856
939 Ga0207693_10013014
940 Ga0207663_10000774
941 Ga0207660_10014006
942 Ga0207662_10016337
943 Ga0207657_10001946
944 Ga0207657_10008393
945 Ga0207657_10043192
946 Ga0207649_10047383
947 Ga0207659_10006028
948 Ga0207659_10013584
949 Ga0207659_10048325
950 Ga0207687_10102805
951 Ga0207700_10007838
952 Ga0207700_10113235
953 Ga0207644_10017691
954 Ga0207690_10023485
955 Ga0207706_10001109
956 Ga0207686_10013283
957 Ga0207709_10008026
958 Ga0207665_10001062
959 Ga0207665_10020678
960 Ga0207691_10003060
961 Ga0207711_10005831
962 Ga0207689_10000605
963 Ga0207689_10040014
964 Ga0207661_10000190
965 Ga0207661_10014300
966 Ga0207667_10034430
967 Ga0207651_10009638
968 Ga0207703_10002781
969 Ga0207703_10036825
970 Ga0207703_10125999
971 Ga0207678_10000497
972 Ga0207678_10014542
973 Ga0207708_10058409
974 Ga0207702_10000052
975 Ga0207648_10000190
976 Ga0207674_10032664
977 Ga0207675_100000193
978 Ga0207675_100000926
979 Ga0207675_100012201
980 Ga0207683_10025958
981 Ga0207698_10062725
982 Ga0209281_1000265
983 Ga0209389_1000028
984 Ga0209389_1000056
985 Ga0209589_1000007
986 Ga0209589_1000034
987 Ga0209489_100008
988 Ga0209489_100009
989 Ga0209489_102012
990 Ga0209700_100009
991 Ga0209700_100022
992 Ga0209282_1000206
993 Ga0268266_10000519
994 Ga0268266_10024302
995 Ga0268266_10045265
996 Ga0268265_10014628
997 Ga0268265_10031212
998 Ga0268264_10000153
999 Ga0268264_10010798
1000 Ga0307517_10000035
1001 Ga0265330_10018504
1002 Ga0265339_10001704
1003 Ga0307509_10062973
1004 Ga0307508_10000013
1005 Ga0307508_10038746
1006 Ga0265314_10002700
1007 Ga0307516_10006924
1008 Ga0307516_10021829
1009 Ga0307516_10042066
1010 Ga0307516_10090999
1011 Ga0307406_10065244
1012 Ga0315914_1001715
1013 Ga0307414_10033791
1014 Ga0307507_10014602
1015 Ga0307510_10005609
1016 Ga0307510_10008381
1017 Ga0307510_10013793
1018 Ga0315913_1001231
1019 Ga0315911_1000031
1020 Ga0315915_1000032
1021 Ga0373940_0002091
1022 Ga0373954_0000659
1023 Ga0373943_0015393
1024 Ga0373955_0000335
1025 Ga0373924_0007736
1026 Ga0373931_0000495
1027 Ga0373931_0001170
1028 Ga0373931_0002473
1029 Ga0373931_0008164
1030 Ga0373931_0049221
1031 Ga0373935_0001283
1032 Ga0373935_0007817
1033 Ga0373935_0040819
1034 Ga0373927_0000515
1035 Ga0373933_0000106
1036 Ga0373937_0001397
1037 Ga0373937_0069333
1038 Ga0373925_0001116
1039 Ga0373925_0001962
1040 Ga0395900_0009415
1041 Ga0395900_0031469
1042 Ga0395898_0019871
1043 Ga0395898_0022935
1044 Ga0395898_0119894
1045 Ga0395905_0008098
1046 Ga0395905_0029509
1047 Ga0436364_1078792
1048 Ga0436364_1526996
1049 Ga0395901_0009062
1050 Ga0395901_0034707
1051 Ga0436365_0160289
1052 Ga0436365_1466852
1053 Ga0436363_0520596
1054 Ga0436362_1000225
1055 Ga0466972_0000110
1056 Ga0466972_0025825
1057 Ga0466966_0000101
1058 Ga0466961_0000031
1059 Ga0453684_0052569
1060 Ga0466960_0018773
1061 Ga0466959_0006172
1062 Ga0466958_0037008
1063 Ga0466967_0044184
1064 Ga0495592_0006367
1065 Ga0495603_0000156
1066 Ga0495603_0004630
1067 Ga0495629_0000297
1068 Ga0495629_0002353
1069 Ga0495629_0003900
1070 Ga0495629_0076616
1071 Ga0495638_0008062
1072 Ga0495641_0003033
1073 Ga0495651_0004028
1074 Ga0495651_0057379
1075 Ga0495582_0000087
1076 Ga0495639_0000153
1077 Ga0495639_0019616
1078 Ga0495662_0002946
1079 Ga0495664_0003105
1080 Ga0495594_0001275
1081 Ga0495606_0001387
1082 Ga0495608_0007141
1083 Ga0495628_0030286
1084 Ga0495628_0042075
1085 Ga0495630_0000735
1086 Ga0495632_0019027
1087 Ga0495644_0011683
1088 Ga0495648_0003807
1089 Ga0495648_0021682
1090 Ga0495648_0036405
1091 Ga0495652_0003411
1092 Ga0495652_0004109
1093 Ga0495652_0036519
1094 Ga0495665_0000117
1095 Ga0495640_0002597
1096 Ga0495640_0004127
1097 Ga0495640_0015267
1098 Ga0495586_0035513
1099 Ga0495587_0001788
1100 Ga0495587_0039054
1101 Ga0495621_0009743
1102 Ga0495645_0018518
1103 Ga0495622_0001116
1104 Ga0495667_0003464
1105 Ga0495667_0009440
1106 Ga0495656_0002929
1107 Ga0495656_0020656
1108 Ga0495668_0024397
1109 Ga0495634_0030614
1110 Ga0495634_0033433
1111 Ga0495635_0004107
1112 Ga0495635_0010975
1113 Ga0495635_0032682
1114 Ga0495657_0002601
1115 Ga0495657_0003718
1116 Ga0495623_0027760
1117 Ga0495646_0017874
1118 Ga0495647_0000365
1119 Ga0495658_0000644
1120 Ga0495658_0004432
1121 Ga0495669_0000982
1122 Ga0495613_0005220
1123 Ga0495613_0032617
1124 Ga0495613_0081747
1125 Ga0495624_0016256
1126 Ga0495670_0018752
1127 Ga0495649_0027690
1128 Ga0495589_0031484
1129 Ga0495600_0000869
1130 Ga0495600_0019722
1131 Ga0495581_0000543
1132 Ga0495604_0000751
1133 Ga0495674_0000177
1134 Ga0495674_0004259
1135 Ga0495676_0034415
1136 Ga0495680_0001530
1137 Ga0495680_0034539
1138 Ga0495680_0061142
1139 Ga0495687_007739
1140 Ga0495675_0001832
1141 Ga0495675_0003409
1142 Ga0495673_0024131
1143 Ga0495684_0002187
1144 Ga0495684_0085665
1145 Ga0495593_0000156
1146 Ga0495593_0001736
1147 Ga0495593_0038852
1148 Ga0495593_0045484
1149 Ga0495602_0006495
1150 Ga0496100_0033503
1151 Ga0496101_0001236
1152 Ga0496101_0010462
1153 Ga0496101_0015994
1154 Ga0496101_0044342
1155 Ga0496101_0076242
1156 Ga0496102_0010192
1157 Ga0496102_0018514
1158 Ga0496102_0020699
1159 Ga0496102_0030554
1160 Ga0496104_0000596
1161 Ga0496104_0003679
1162 Ga0496104_0007390
1163 Ga0496104_0014958
1164 Ga0496104_0019617
1165 Ga0496105_0001079
1166 Ga0496105_0003448
1167 Ga0496105_0004451
1168 Ga0496105_0024331
1169 Ga0496106_0001932
1170 Ga0496106_0004263
1171 Ga0496106_0015640
1172 Ga0496106_0034457
1173 Ga0496107_0005436
1174 Ga0496107_0006381
1175 Ga0496108_0000606
1176 Ga0496108_0001980
1177 Ga0496108_0024443
1178 Ga0496109_0012968
1179 Ga0496109_0014368
1180 Ga0496109_0015563
1181 Ga0496109_0044041
1182 Ga0496109_0050586
1183 Ga0496110_0002320
1184 Ga0496110_0005352
1185 Ga0496110_0014649
1186 Ga0496110_0026977
1187 Ga0496110_0047998
1188 Ga0496111_0005127
1189 Ga0496111_0030464
1190 Ga0496111_0031417
1191 Ga0496111_0038516
1192 Ga0496112_0000057
1193 Ga0496112_0003534
1194 Ga0496112_0004346
1195 Ga0496112_0004485
1196 Ga0496112_0022545
1197 Ga0496112_0028641
1198 Ga0496112_0093837
1199 Ga0496113_0018879
1200 Ga0496113_0070029
1201 Ga0496113_0073940
1202 Ga0496114_0067416
1203 Ga0496115_0003709
1204 Ga0496115_0005163
1205 Ga0496115_0012229
1206 Ga0496115_0027149
1207 Ga0496115_0044460
1208 Ga0496115_0053729
1209 Ga0496116_0009062
1210 Ga0496117_0004621
1211 Ga0496118_0007562
1212 Ga0496119_0012830
1213 Ga0496120_0037737
1214 Ga0496121_0000287
1215 Ga0496121_0000689
1216 Ga0496121_0008649
1217 Ga0496121_0011016
1218 Ga0496121_0021790
1219 Ga0496124_0005646
1220 Ga0496125_0000654
1221 Ga0496125_0007037
1222 Ga0496125_0036475
1223 Ga0496126_0001378
1224 Ga0496126_0003243
1225 Ga0496126_0011998
1226 Ga0496126_0017009
1227 Ga0496126_0023542
1228 Ga0496126_0025256
1229 Ga0496126_0030165
1230 Ga0496126_0036133
1231 Ga0501032_0024203
1232 Ga0501033_0005716
1233 Ga0501033_0037658
1234 Ga0501033_0094448
1235 Ga0501034_0000673
1236 Ga0501038_0097069
1237 Ga0501039_0063680
1238 Ga0501039_0099879
1239 Ga0501040_0096024
1240 Ga0501043_0008365
1241 Ga0501047_0042603
1242 Ga0501047_0043098
1243 Ga0501048_0029091
1244 Ga0501073_0008648
1245 Ga0501073_0019250
1246 Ga0501076_0085579
1247 Ga0501077_0008045
1248 Ga0501079_0022509
1249 Ga0501079_0034949
1250 Ga0501035_0002405
1251 Ga0501044_0004838
1252 Ga0501045_0011955
1253 nmdc:mga0yw44_5401_c1
1254 nmdc:mga05p37_38197_c1
1255 nmdc:mga09592_60106_c1
1256 nmdc:mga0qj67_6455_c1
1257 nmdc:mga06r32_117076_c1
1258 nmdc:mga0n895_22726_c1
1259 nmdc:mga0n895_7197_c1
1260 nmdc:mga0rr50_40512_c2
1261 Ga0500635_0005138
1262 Ga0495595_0003363
1263 Ga0495619_0008790
1264 Ga0500643_000077
1265 Ga0500651_0029465
1266 Ga0500566_0000228
1267 Ga0500557_000117
1268 Ga0500595_000743
1269 Ga0500595_002140
1270 Ga0500595_002200
1271 Ga0500595_003844
1272 Ga0500607_055527
1273 Ga0500642_0001154
1274 Ga0500652_000004
1275 Ga0500652_032248
1276 Ga0500603_001283
1277 Ga0500616_0000034
1278 Ga0500616_0000036
1279 Ga0500616_0014179
1280 Ga0500622_0007580
1281 Ga0500636_0000157
1282 Ga0500636_0009991
1283 Ga0500625_004013
1284 Ga0500601_000133
1285 Ga0501084_0064169
1286 Ga0501084_0079761
1287 Ga0501082_0051378
1288 Ga0466962_0027149
1289 Ga0530510_0023100
1290 2507506855
1291 2508540890
1292 2508696818
1293 2509139770
1294 2511399234
1295 2513623821
1296 2513641485
1297 2513650491
1298 2513655224
1299 2513677640
1300 2513693436
1301 2513705234
1302 2513720122
1303 2513861474
1304 2513877407
1305 2513915752
1306 2514013086
1307 2514588647
1308 2515613060
1309 2515629685
1310 2517106369
1311 2517568133
1312 2517894942
1313 2524439388
1314 2524464947
1315 2524534722
1316 2528853115
1317 2597812482
1318 2599105143
1319 2617348207
1320 2643770910
1321 2643838214
1322 2643985073
1323 2644155814
1324 2644287483
1325 2671123049
1326 2723848330
1327 2728748828
1328 2738744100
1329 2739353330
1330 2745078100
1331 2793065374
1332 2793073964
1333 2793079568
1334 2802723918
1335 2802733739
1336 2802740906
1337 2805918942
1338 2818242088
1339 2821448426
1340 2824609244
1341 2824613602
1342 2824620519
1343 2824634135
1344 2824658144
1345 2824664334
1346 2824679268
1347 2824687701
1348 2824696061
1349 2824752046
1350 2824757518
1351 2824768038
1352 2824779644
1353 2829749792
1354 2841945708
1355 2841954899
1356 2841963254
1357 2841972297
1358 2841980380
1359 2841988545
1360 2842044844
1361 2842052970
1362 2844320758
1363 2846955180
1364 2847938284
1365 2847940203
1366 2848858526
1367 2849077599
1368 2856335969
1369 2856345330
1370 2857369975
1371 2857510828
1372 2857529782
1373 2861693355
1374 2874593998
1375 2874607449
1376 2874618850
1377 2874626010
1378 2874630763
1379 2874647929
1380 2876774136
1381 2876814770
1382 2876821088
1383 2879078913
1384 2879086129
1385 2879104833
1386 2879111082
1387 2879127928
1388 2879147652
1389 2881364336
1390 2881666756
1391 2885367922
1392 2885375365
1393 2885388794
1394 2885414700
1395 2888346433
1396 2888386160
1397 2888392111
1398 2888426308
1399 2889037124
1400 2889307897
1401 2889790883
1402 2889915268
1403 2899277809
1404 2902407853
1405 2903728129
1406 2903753356
1407 2903771155
1408 2904672482
1409 2904698020
1410 2904712917
1411 2906605955
1412 2906611674
1413 2906632858
1414 2906639654
1415 2906645270
1416 2906660603
1417 2908745260
1418 2908763058
1419 2908782385
1420 2916067236
1421 2917557680
1422 2922155843
1423 2922361270
1424 2922370393
1425 2922392902
1426 2922399725
1427 2922427671
1428 2924758554
1429 2929621415
1430 2929631771
1431 2932792548
1432 2932798664
1433 2932806534
1434 2932815366
1435 2932824355
1436 2932832245
1437 2933583560
1438 2935615863
1439 2935622183
1440 2935632378
1441 2935646441
1442 2935653880
1443 2935662629
1444 2935669278
1445 2935683163
1446 2935692105
1447 2935702490
1448 2935708645
1449 2935720656
1450 2935729937
1451 2935739080
1452 2935748379
1453 2935758581
1454 2935765991
1455 2935772259
1456 2935783795
1457 2935787709
1458 2935793734
1459 2935805994
1460 2935815446
1461 2935826810
1462 2935835594
1463 2935843372
1464 2935860430
1465 2935867828
1466 2935878363
1467 2935888627
1468 2935914920
1469 2935923125
1470 2935932401
1471 2935940999
1472 2935949108
1473 2935957803
1474 2935964802
1475 2935974076
1476 2935981367
1477 2935990266
1478 2935998754
1479 2936007059
1480 2936015370
1481 2936024004
1482 2936033019
1483 2936040684
1484 2936051112
1485 2936058489
1486 2937000544
1487 2937088734
1488 2937845558
1489 2940564485
1490 2941508325
1491 2941515169
1492 2941524256
1493 2941536581
1494 2941544918
1495 2957380335
1496 2958123923
1497 2960632126
1498 2960699838
1499 2965035437
1500 2967691668
1501 2970032967
1502 2970546327
1503 2977879166
1504 2977965195
1505 2996340830
1506 3003667845
1507 3005477386
1508 3005485336
1509 3005507676
1510 3005593906
1511 3005601078
1512 3005723851
1513 643602867
1514 8004402504
1515 8004695454
1516 8006929701
1517 8006933877
1518 8006969643
1519 8006983550
1520 8006990638
1521 8006998718
1522 8016519907
1523 8016527819
1524 8016532929
1525 8016546165
1526 8016555960
1527 8016564313
1528 8016571239
1529 8016583724
1530 8016583939
1531 8016601999
1532 8016616643
1533 8016624509
1534 8016633980
1535 8017065637
1536 8019532730
1537 8019559781
1538 8019569887
1539 8019585045
1540 8019593011
1541 8019598453
1542 8019632468
1543 8019647417
1544 8019660385
1545 8019669804
1546 8019686289
1547 8019692446
1548 8055744382
1549 8056676646
1550 8056689644
1551 8056694005
1552 8056969233

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00994

MoCF_biosynth

Probable molybdopterin binding domain

235

374

0.97

PF03454

MoeA_C

MoeA C-terminal region (domain IV)

387

457

0.96

PF12727

PBP_like

PBP superfamily domain

481

665

0.93

PF03453

MoeA_N

MoeA N-terminal region (domain I and II)

54

222

0.9

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

556

679

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7egs-assembly1.cif.gz_A the crystal structure of lobe domain of e. coli rna polymerase complexed with the c-terminal domain of uvrd 0.8997 173 204
7u22-assembly1.cif.gz_D mycobacterium tuberculosis rna polymerase sigma a holoenzyme open promoter complex containing umn-7 0.888 173 203
1uz5-assembly1.cif.gz_A the crystal structure of molybdopterin biosynthesis moea protein from pyrococcus horikosii 0.8864 26 431
1uz5-assembly1.cif.gz_A the crystal structure of molybdopterin biosynthesis moea protein from pyrococcus horikosii 0.878 26 431
3lti-assembly1.cif.gz_A crystal structure of the escherichia coli rna polymerase beta subunit beta2-betai4 domains 0.8571 173 204
ID Description Score Start End Superfamily
af_Q2FVY0_53_145_2.170.190.11 Mainly Beta;Beta Complex;Molybdopterin biosynthesis moeA protein; domain 3;Molybdopterin biosynthesis moea protein, domain 3. 0.9817 73 167 2.170.190.11
1uz5A03 Mainly Beta;Beta Complex;Molybdopterin biosynthesis moeA protein; domain 3;Molybdopterin biosynthesis moea protein, domain 3. 0.9738 71 169 2.170.190.11
af_Q2FVY0_53_145_2.170.190.11 Mainly Beta;Beta Complex;Molybdopterin biosynthesis moeA protein; domain 3;Molybdopterin biosynthesis moea protein, domain 3. 0.9715 73 167 2.170.190.11
1uz5A03 Mainly Beta;Beta Complex;Molybdopterin biosynthesis moeA protein; domain 3;Molybdopterin biosynthesis moea protein, domain 3. 0.9641 71 169 2.170.190.11
1uz5A02 Alpha Beta;Alpha-Beta Complex;Molybdopterin biosynthesis moea protein, domain 2;Molybdopterin biosynthesis moea protein, domain 2 0.9623 48 201 3.90.105.10
ID Description Score Start End GO Terms
AF-A0A7C9VEY1-F1-model_v4 Solute-binding protein 0.9831 429 654
AF-A0A7C9VEY1-F1-model_v4 Solute-binding protein 0.9788 429 654
AF-A0A5Q4GYW6-F1-model_v4 Molybdopterin biosynthesis protein 0.9581 523 650
AF-A0A7J3AEF3-F1-model_v4 Molybdopterin molybdenumtransferase MoeA 0.9364 203 436 GO:0005737
GO:0006777
GO:0061599
AF-A0A2V3HLU9-F1-model_v4 MoaB/Mog domain-containing protein 0.9311 203 430 GO:0005829
GO:0006777
GO:0061599

Map