F480372
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 777 | 305 | 1554 | 384 |
Family's Representative Sequence
| Representative Sequence | 3300028573|Ga0265334_10021309|Ga0265334_100213093 |
| Length | 407 |
| Sequence | VFGYRTYVPVIACVSIPGLELKAALRRTPTLALRPAALAPEPPTSSGHWEPLIGPVTVAAEALGVRPGMRLGEALATCPALALVEPDAAGAEQAWEEIVRALEDAGFAVDPASYGVAYFETQGVERLYGGLEPALRRALAAVGSEWDARIGAAGRRFAALAAASVARPGQVVVVADEELPQFLAPLPLTLLPLERNRYEELEALGVRKLGQLAGLPGGAVAERLGPDGRRAWSLARGGTAARVRGRRPPAAVYASLEFPEAIGNELTLRRALAGLVDKALARPERRDRFVRKLALAARLETGGSWRRTLTLREPSADSERIRVALAPRLVELPGPVVELRLELVELTESVGQQLELLAAGAEDRTRLREGLRQVRASTGSGSVCTVVEVAPWSRVPESRALLVPKDE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 46 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 47 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 48 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 50 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 51 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 84 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 87 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 93 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 136 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 137 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 138 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 139 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 140 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 141 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 142 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 143 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 144 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 145 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 146 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 147 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 148 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 149 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 151 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 152 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 153 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 154 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 155 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 156 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 157 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 158 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 159 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 160 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 162 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 163 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 164 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 166 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 167 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 168 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 169 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 170 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 173 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 174 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 175 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 176 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 177 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 178 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 179 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 180 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 181 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 182 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 183 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 184 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 185 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 186 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 187 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 188 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 189 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 190 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 191 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 192 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 193 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 246 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 247 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 248 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 249 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 250 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 251 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 254 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 255 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 256 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 257 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 258 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 259 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 291 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 305 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.1 |
| Metatranscriptomes | 0.9 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.39 |
| Nodule | 0 |
| Rhizoplane | 11.97 |
| Rhizosphere | 87.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265334_10021309 | 3300028573 | Bacteria | 2647 |
| 2 | Ga0070658_10009553 | 3300005327 | Bacteria | 7788 |
| 3 | Ga0070658_10043255 | 3300005327 | Bacteria | 3639 |
| 4 | Ga0070683_100005736 | 3300005329 | Bacteria | 10373 |
| 5 | Ga0070683_100025123 | 3300005329 | Bacteria | 5346 |
| 6 | Ga0070683_100039455 | 3300005329 | Bacteria | 4335 |
| 7 | Ga0070683_100043689 | 3300005329 | Bacteria | 4130 |
| 8 | Ga0070680_100007655 | 3300005336 | Bacteria | 8240 |
| 9 | Ga0070680_100039108 | 3300005336 | Bacteria | 3838 |
| 10 | Ga0070680_100040114 | 3300005336 | Bacteria | 3789 |
| 11 | Ga0070680_100071255 | 3300005336 | Bacteria | 2855 |
| 12 | Ga0070682_100006153 | 3300005337 | Bacteria | 6721 |
| 13 | Ga0070682_100060505 | 3300005337 | Bacteria | 2395 |
| 14 | Ga0068868_100043677 | 3300005338 | Bacteria | 3501 |
| 15 | Ga0070660_100001517 | 3300005339 | Bacteria | 15917 |
| 16 | Ga0070660_100001690 | 3300005339 | Bacteria | 15140 |
| 17 | Ga0070660_100006571 | 3300005339 | Bacteria | 8065 |
| 18 | Ga0070660_100010990 | 3300005339 | Bacteria | 6414 |
| 19 | Ga0070661_100016327 | 3300005344 | Bacteria | 5248 |
| 20 | Ga0070661_100028216 | 3300005344 | Bacteria | 4047 |
| 21 | Ga0070692_10049263 | 3300005345 | Bacteria | 2185 |
| 22 | Ga0070692_10083284 | 3300005345 | Bacteria | 1726 |
| 23 | Ga0070668_100006244 | 3300005347 | Bacteria | 8826 |
| 24 | Ga0070669_100065637 | 3300005353 | Bacteria | 2674 |
| 25 | Ga0070671_100013071 | 3300005355 | Bacteria | 6688 |
| 26 | Ga0070674_100011678 | 3300005356 | Bacteria | 5353 |
| 27 | Ga0070659_100258402 | 3300005366 | Bacteria | 1445 |
| 28 | Ga0070659_100328835 | 3300005366 | Unclassified | 1279 |
| 29 | Ga0070703_10008624 | 3300005406 | Bacteria | 2868 |
| 30 | Ga0070709_10020586 | 3300005434 | Bacteria | 3829 |
| 31 | Ga0070709_10039355 | 3300005434 | Bacteria | 2901 |
| 32 | Ga0070709_10163944 | 3300005434 | Bacteria | 1548 |
| 33 | Ga0070714_100014183 | 3300005435 | Bacteria | 6397 |
| 34 | Ga0070714_100016774 | 3300005435 | Bacteria | 5922 |
| 35 | Ga0070714_100146404 | 3300005435 | Unclassified | 2125 |
| 36 | Ga0070713_100016547 | 3300005436 | Bacteria | 5545 |
| 37 | Ga0070713_100016773 | 3300005436 | Bacteria | 5515 |
| 38 | Ga0070713_100111526 | 3300005436 | Bacteria | 2385 |
| 39 | Ga0070713_100237557 | 3300005436 | Bacteria | 1658 |
| 40 | Ga0070713_100244623 | 3300005436 | Bacteria | 1634 |
| 41 | Ga0070710_10023926 | 3300005437 | Bacteria | 3216 |
| 42 | Ga0070710_10030280 | 3300005437 | Bacteria | 2911 |
| 43 | Ga0070710_10050628 | 3300005437 | Unclassified | 2329 |
| 44 | Ga0070710_10104995 | 3300005437 | Bacteria | 1688 |
| 45 | Ga0070701_10017552 | 3300005438 | Bacteria | 3346 |
| 46 | Ga0070711_100019774 | 3300005439 | Bacteria | 4327 |
| 47 | Ga0070705_100002476 | 3300005440 | Bacteria | 9279 |
| 48 | Ga0070705_100017298 | 3300005440 | Bacteria | 3762 |
| 49 | Ga0070694_100023142 | 3300005444 | Bacteria | 3992 |
| 50 | Ga0070694_100030834 | 3300005444 | Unclassified | 3511 |
| 51 | Ga0070662_100004082 | 3300005457 | Bacteria | 9172 |
| 52 | Ga0070662_100293562 | 3300005457 | Bacteria | 1318 |
| 53 | Ga0070681_10001213 | 3300005458 | Bacteria | 22417 |
| 54 | Ga0070681_10002017 | 3300005458 | Bacteria | 18379 |
| 55 | Ga0070681_10004073 | 3300005458 | Bacteria | 13802 |
| 56 | Ga0070681_10040002 | 3300005458 | Bacteria | 4701 |
| 57 | Ga0070681_10056936 | 3300005458 | Bacteria | 3889 |
| 58 | Ga0070681_10147130 | 3300005458 | Bacteria | 2284 |
| 59 | Ga0070706_100126231 | 3300005467 | Bacteria | 2386 |
| 60 | Ga0070706_100303749 | 3300005467 | Bacteria | 1489 |
| 61 | Ga0070707_100001941 | 3300005468 | Bacteria | 19855 |
| 62 | Ga0070698_100073227 | 3300005471 | Bacteria | 3433 |
| 63 | Ga0070679_100033173 | 3300005530 | Bacteria | 5112 |
| 64 | Ga0070679_100046170 | 3300005530 | Bacteria | 4341 |
| 65 | Ga0070679_100053721 | 3300005530 | Bacteria | 4010 |
| 66 | Ga0070679_100098116 | 3300005530 | Bacteria | 2917 |
| 67 | Ga0070679_100104478 | 3300005530 | Bacteria | 2819 |
| 68 | Ga0070679_100252816 | 3300005530 | Bacteria | 1718 |
| 69 | Ga0070684_100001782 | 3300005535 | Bacteria | 15731 |
| 70 | Ga0070684_100031250 | 3300005535 | Bacteria | 4531 |
| 71 | Ga0070684_100057587 | 3300005535 | Bacteria | 3393 |
| 72 | Ga0070684_100058232 | 3300005535 | Bacteria | 3376 |
| 73 | Ga0070686_100024613 | 3300005544 | Bacteria | 3610 |
| 74 | Ga0070686_100085016 | 3300005544 | Unclassified | 2104 |
| 75 | Ga0070695_100000023 | 3300005545 | Bacteria | 60293 |
| 76 | Ga0070695_100012016 | 3300005545 | Bacteria | 5187 |
| 77 | Ga0070696_100005739 | 3300005546 | Bacteria | 8284 |
| 78 | Ga0070696_100050836 | 3300005546 | Bacteria | 2881 |
| 79 | Ga0070693_100122190 | 3300005547 | Bacteria | 1616 |
| 80 | Ga0070665_100443895 | 3300005548 | Bacteria | 1307 |
| 81 | Ga0068855_100016384 | 3300005563 | Bacteria | 8910 |
| 82 | Ga0068855_100060875 | 3300005563 | Bacteria | 4412 |
| 83 | Ga0068855_100065579 | 3300005563 | Bacteria | 4233 |
| 84 | Ga0068855_100102077 | 3300005563 | Bacteria | 3301 |
| 85 | Ga0068855_100371292 | 3300005563 | Bacteria | 1572 |
| 86 | Ga0070664_100341351 | 3300005564 | Bacteria | 1360 |
| 87 | Ga0068854_100008212 | 3300005578 | Bacteria | 6699 |
| 88 | Ga0068856_100019349 | 3300005614 | Bacteria | 6610 |
| 89 | Ga0068856_100073541 | 3300005614 | Bacteria | 3384 |
| 90 | Ga0068852_100016969 | 3300005616 | Bacteria | 5698 |
| 91 | Ga0068852_100104996 | 3300005616 | Bacteria | 2558 |
| 92 | Ga0068866_10117044 | 3300005718 | Bacteria | 1496 |
| 93 | Ga0068861_100015838 | 3300005719 | Bacteria | 5323 |
| 94 | Ga0068861_100061681 | 3300005719 | Bacteria | 2878 |
| 95 | Ga0068860_100064102 | 3300005843 | Bacteria | 3491 |
| 96 | Ga0068862_100053396 | 3300005844 | Bacteria | 3459 |
| 97 | Ga0081455_10016032 | 3300005937 | Bacteria | 7250 |
| 98 | Ga0081455_10072982 | 3300005937 | Bacteria | 2838 |
| 99 | Ga0081538_10000286 | 3300005981 | Bacteria | 57937 |
| 100 | Ga0081538_10043112 | 3300005981 | Bacteria | 2838 |
| 101 | Ga0081540_1008899 | 3300005983 | Bacteria | 6963 |
| 102 | Ga0070717_10017852 | 3300006028 | Bacteria | 5531 |
| 103 | Ga0070717_10034081 | 3300006028 | Bacteria | 4112 |
| 104 | Ga0075365_10006430 | 3300006038 | Bacteria | 6465 |
| 105 | Ga0075364_10003922 | 3300006051 | Bacteria | 8533 |
| 106 | Ga0075432_10006435 | 3300006058 | Bacteria | 3997 |
| 107 | Ga0070716_100098282 | 3300006173 | Bacteria | 1788 |
| 108 | Ga0070712_100025405 | 3300006175 | Bacteria | 3937 |
| 109 | Ga0070712_100162044 | 3300006175 | Bacteria | 1728 |
| 110 | Ga0070712_100171999 | 3300006175 | Bacteria | 1681 |
| 111 | Ga0070712_100211248 | 3300006175 | Bacteria | 1530 |
| 112 | Ga0097621_100142777 | 3300006237 | Unclassified | 2047 |
| 113 | Ga0075430_100231791 | 3300006846 | Bacteria | 1531 |
| 114 | Ga0075431_100067933 | 3300006847 | Bacteria | 3679 |
| 115 | Ga0075433_10085662 | 3300006852 | Bacteria | 2782 |
| 116 | Ga0075433_10143249 | 3300006852 | Unclassified | 2124 |
| 117 | Ga0075434_100008194 | 3300006871 | Bacteria | 9695 |
| 118 | Ga0075434_100047928 | 3300006871 | Bacteria | 4240 |
| 119 | Ga0075434_100231203 | 3300006871 | Unclassified | 1868 |
| 120 | Ga0075434_100275153 | 3300006871 | Bacteria | 1703 |
| 121 | Ga0075429_100020385 | 3300006880 | Bacteria | 5751 |
| 122 | Ga0075429_100046490 | 3300006880 | Bacteria | 3776 |
| 123 | Ga0068865_100027843 | 3300006881 | Bacteria | 3737 |
| 124 | Ga0075436_100027354 | 3300006914 | Bacteria | 3926 |
| 125 | Ga0075436_100032925 | 3300006914 | Bacteria | 3571 |
| 126 | Ga0075436_100058811 | 3300006914 | Bacteria | 2655 |
| 127 | Ga0075436_100077483 | 3300006914 | Bacteria | 2302 |
| 128 | Ga0105240_10030125 | 3300009093 | Bacteria | 7057 |
| 129 | Ga0105240_10048618 | 3300009093 | Bacteria | 5360 |
| 130 | Ga0105240_10078098 | 3300009093 | Bacteria | 4077 |
| 131 | Ga0105240_10090992 | 3300009093 | Bacteria | 3728 |
| 132 | Ga0105240_10136231 | 3300009093 | Bacteria | 2940 |
| 133 | Ga0105240_10257945 | 3300009093 | Bacteria | 2013 |
| 134 | Ga0105240_10387472 | 3300009093 | Bacteria | 1577 |
| 135 | Ga0111539_10049522 | 3300009094 | Bacteria | 5009 |
| 136 | Ga0111539_10210712 | 3300009094 | Bacteria | 2264 |
| 137 | Ga0105245_10020707 | 3300009098 | Bacteria | 5765 |
| 138 | Ga0114129_10005545 | 3300009147 | Bacteria | 17850 |
| 139 | Ga0114129_10160230 | 3300009147 | Bacteria | 3074 |
| 140 | Ga0105243_10058047 | 3300009148 | Bacteria | 3083 |
| 141 | Ga0105241_10010596 | 3300009174 | Bacteria | 6762 |
| 142 | Ga0105242_10021890 | 3300009176 | Bacteria | 5024 |
| 143 | Ga0105242_10131610 | 3300009176 | Unclassified | 2160 |
| 144 | Ga0105248_10278975 | 3300009177 | Bacteria | 1881 |
| 145 | Ga0105237_10116252 | 3300009545 | Bacteria | 2668 |
| 146 | Ga0105238_10113964 | 3300009551 | Bacteria | 2683 |
| 147 | Ga0105249_10058573 | 3300009553 | Bacteria | 3530 |
| 148 | Ga0105249_10260665 | 3300009553 | Bacteria | 1722 |
| 149 | Ga0105239_10392108 | 3300010375 | Bacteria | 1571 |
| 150 | Ga0157320_1000699 | 3300012481 | Bacteria | 1467 |
| 151 | Ga0157373_10195795 | 3300013100 | Bacteria | 1425 |
| 152 | Ga0157370_10008703 | 3300013104 | Bacteria | 10922 |
| 153 | Ga0157369_10002254 | 3300013105 | Bacteria | 23183 |
| 154 | Ga0157369_10004763 | 3300013105 | Bacteria | 15950 |
| 155 | Ga0157369_10020611 | 3300013105 | Bacteria | 7371 |
| 156 | Ga0157369_10023333 | 3300013105 | Bacteria | 6891 |
| 157 | Ga0157369_10209922 | 3300013105 | Bacteria | 2041 |
| 158 | Ga0157369_10421655 | 3300013105 | Bacteria | 1383 |
| 159 | Ga0157374_10180733 | 3300013296 | Bacteria | 2060 |
| 160 | Ga0157374_10199569 | 3300013296 | Bacteria | 1958 |
| 161 | Ga0157378_10141320 | 3300013297 | Unclassified | 2236 |
| 162 | Ga0163162_10033481 | 3300013306 | Bacteria | 5107 |
| 163 | Ga0163162_10046309 | 3300013306 | Bacteria | 4358 |
| 164 | Ga0157372_10094301 | 3300013307 | Bacteria | 3408 |
| 165 | Ga0157372_10094327 | 3300013307 | Bacteria | 3407 |
| 166 | Ga0157372_10226806 | 3300013307 | Bacteria | 2166 |
| 167 | Ga0157380_10110639 | 3300014326 | Bacteria | 2307 |
| 168 | Ga0182008_10054224 | 3300014497 | Bacteria | 1984 |
| 169 | Ga0182008_10098821 | 3300014497 | Bacteria | 1441 |
| 170 | Ga0157377_10064727 | 3300014745 | Unclassified | 2098 |
| 171 | Ga0157376_10032736 | 3300014969 | Bacteria | 4177 |
| 172 | Ga0157376_10064754 | 3300014969 | Bacteria | 3084 |
| 173 | Ga0157376_10203753 | 3300014969 | Bacteria | 1822 |
| 174 | Ga0182007_10051096 | 3300015262 | Bacteria | 1364 |
| 175 | Ga0163161_10122398 | 3300017792 | Bacteria | 1956 |
| 176 | Ga0197907_10080291 | 3300020069 | Bacteria | 1475 |
| 177 | Ga0206356_11614020 | 3300020070 | Bacteria | 5514 |
| 178 | Ga0206354_10542429 | 3300020081 | Bacteria | 1658 |
| 179 | Ga0206354_11491096 | 3300020081 | Bacteria | 3157 |
| 180 | Ga0206353_10099927 | 3300020082 | Bacteria | 3233 |
| 181 | Ga0206353_10669741 | 3300020082 | Bacteria | 3282 |
| 182 | Ga0213871_10014302 | 3300021441 | Bacteria | 1880 |
| 183 | Ga0224712_10040016 | 3300022467 | Bacteria | 1761 |
| 184 | Ga0207653_10048209 | 3300025885 | Unclassified | 1412 |
| 185 | Ga0207692_10023856 | 3300025898 | Bacteria | 2836 |
| 186 | Ga0207692_10031100 | 3300025898 | Bacteria | 2553 |
| 187 | Ga0207692_10093428 | 3300025898 | Bacteria | 1636 |
| 188 | Ga0207688_10014556 | 3300025901 | Unclassified | 4273 |
| 189 | Ga0207688_10142569 | 3300025901 | Bacteria | 1411 |
| 190 | Ga0207699_10059054 | 3300025906 | Bacteria | 2297 |
| 191 | Ga0207699_10068638 | 3300025906 | Bacteria | 2159 |
| 192 | Ga0207699_10088627 | 3300025906 | Unclassified | 1937 |
| 193 | Ga0207699_10180912 | 3300025906 | Unclassified | 1417 |
| 194 | Ga0207699_10183729 | 3300025906 | Bacteria | 1407 |
| 195 | Ga0207705_10033077 | 3300025909 | Bacteria | 3695 |
| 196 | Ga0207705_10042113 | 3300025909 | Bacteria | 3278 |
| 197 | Ga0207705_10054608 | 3300025909 | Bacteria | 2879 |
| 198 | Ga0207705_10231628 | 3300025909 | Bacteria | 1405 |
| 199 | Ga0207684_10085700 | 3300025910 | Bacteria | 2683 |
| 200 | Ga0207707_10008180 | 3300025912 | Bacteria | 9075 |
| 201 | Ga0207707_10019358 | 3300025912 | Bacteria | 5942 |
| 202 | Ga0207707_10024788 | 3300025912 | Bacteria | 5248 |
| 203 | Ga0207695_10020749 | 3300025913 | Bacteria | 7517 |
| 204 | Ga0207695_10177668 | 3300025913 | Bacteria | 2051 |
| 205 | Ga0207695_10238535 | 3300025913 | Bacteria | 1720 |
| 206 | Ga0207671_10082284 | 3300025914 | Bacteria | 2415 |
| 207 | Ga0207671_10198324 | 3300025914 | Bacteria | 1567 |
| 208 | Ga0207693_10000495 | 3300025915 | Bacteria | 35594 |
| 209 | Ga0207693_10000945 | 3300025915 | Bacteria | 26054 |
| 210 | Ga0207693_10023481 | 3300025915 | Bacteria | 4896 |
| 211 | Ga0207693_10024171 | 3300025915 | Bacteria | 4824 |
| 212 | Ga0207693_10029773 | 3300025915 | Bacteria | 4310 |
| 213 | Ga0207693_10043088 | 3300025915 | Bacteria | 3553 |
| 214 | Ga0207693_10043197 | 3300025915 | Bacteria | 3547 |
| 215 | Ga0207693_10092467 | 3300025915 | Bacteria | 2371 |
| 216 | Ga0207693_10108366 | 3300025915 | Bacteria | 2179 |
| 217 | Ga0207693_10152223 | 3300025915 | Bacteria | 1819 |
| 218 | Ga0207663_10017707 | 3300025916 | Bacteria | 3977 |
| 219 | Ga0207663_10052101 | 3300025916 | Bacteria | 2551 |
| 220 | Ga0207663_10147462 | 3300025916 | Bacteria | 1647 |
| 221 | Ga0207660_10036380 | 3300025917 | Bacteria | 3422 |
| 222 | Ga0207660_10039038 | 3300025917 | Bacteria | 3317 |
| 223 | Ga0207660_10054983 | 3300025917 | Bacteria | 2842 |
| 224 | Ga0207660_10134828 | 3300025917 | Bacteria | 1883 |
| 225 | Ga0207662_10094394 | 3300025918 | Bacteria | 1845 |
| 226 | Ga0207657_10000054 | 3300025919 | Bacteria | 106767 |
| 227 | Ga0207657_10000941 | 3300025919 | Bacteria | 30830 |
| 228 | Ga0207657_10001857 | 3300025919 | Bacteria | 22817 |
| 229 | Ga0207657_10010087 | 3300025919 | Bacteria | 9445 |
| 230 | Ga0207657_10016069 | 3300025919 | Bacteria | 7225 |
| 231 | Ga0207649_10045466 | 3300025920 | Bacteria | 2692 |
| 232 | Ga0207649_10083062 | 3300025920 | Bacteria | 2078 |
| 233 | Ga0207649_10117862 | 3300025920 | Bacteria | 1785 |
| 234 | Ga0207652_10009948 | 3300025921 | Bacteria | 7656 |
| 235 | Ga0207652_10024808 | 3300025921 | Bacteria | 4977 |
| 236 | Ga0207652_10083967 | 3300025921 | Bacteria | 2789 |
| 237 | Ga0207652_10093678 | 3300025921 | Bacteria | 2644 |
| 238 | Ga0207652_10193957 | 3300025921 | Bacteria | 1827 |
| 239 | Ga0207652_10360508 | 3300025921 | Bacteria | 1312 |
| 240 | Ga0207646_10004082 | 3300025922 | Bacteria | 16087 |
| 241 | Ga0207646_10120152 | 3300025922 | Bacteria | 2360 |
| 242 | Ga0207650_10311910 | 3300025925 | Bacteria | 1287 |
| 243 | Ga0207700_10043096 | 3300025928 | Bacteria | 3313 |
| 244 | Ga0207700_10047950 | 3300025928 | Bacteria | 3169 |
| 245 | Ga0207700_10075797 | 3300025928 | Bacteria | 2607 |
| 246 | Ga0207700_10082516 | 3300025928 | Bacteria | 2514 |
| 247 | Ga0207700_10159484 | 3300025928 | Bacteria | 1872 |
| 248 | Ga0207700_10171522 | 3300025928 | Bacteria | 1810 |
| 249 | Ga0207664_10009896 | 3300025929 | Bacteria | 6715 |
| 250 | Ga0207664_10018814 | 3300025929 | Bacteria | 5095 |
| 251 | Ga0207664_10031411 | 3300025929 | Bacteria | 4063 |
| 252 | Ga0207664_10050667 | 3300025929 | Unclassified | 3275 |
| 253 | Ga0207664_10097049 | 3300025929 | Bacteria | 2427 |
| 254 | Ga0207664_10183549 | 3300025929 | Bacteria | 1797 |
| 255 | Ga0207664_10187042 | 3300025929 | Bacteria | 1781 |
| 256 | Ga0207664_10205168 | 3300025929 | Bacteria | 1703 |
| 257 | Ga0207644_10118139 | 3300025931 | Bacteria | 2015 |
| 258 | Ga0207706_10015073 | 3300025933 | Bacteria | 6997 |
| 259 | Ga0207706_10051366 | 3300025933 | Bacteria | 3640 |
| 260 | Ga0207706_10230456 | 3300025933 | Bacteria | 1621 |
| 261 | Ga0207686_10021423 | 3300025934 | Unclassified | 3710 |
| 262 | Ga0207665_10000344 | 3300025939 | Bacteria | 32292 |
| 263 | Ga0207665_10007025 | 3300025939 | Bacteria | 7453 |
| 264 | Ga0207665_10009193 | 3300025939 | Bacteria | 6489 |
| 265 | Ga0207665_10165657 | 3300025939 | Bacteria | 1593 |
| 266 | Ga0207691_10108888 | 3300025940 | Bacteria | 2465 |
| 267 | Ga0207691_10114805 | 3300025940 | Bacteria | 2392 |
| 268 | Ga0207689_10141365 | 3300025942 | Bacteria | 1983 |
| 269 | Ga0207661_10014747 | 3300025944 | Bacteria | 5733 |
| 270 | Ga0207661_10075545 | 3300025944 | Bacteria | 2765 |
| 271 | Ga0207661_10108686 | 3300025944 | Bacteria | 2342 |
| 272 | Ga0207661_10181810 | 3300025944 | Bacteria | 1837 |
| 273 | Ga0207661_10231040 | 3300025944 | Bacteria | 1638 |
| 274 | Ga0207679_10094316 | 3300025945 | Bacteria | 2323 |
| 275 | Ga0207667_10087137 | 3300025949 | Bacteria | 3230 |
| 276 | Ga0207667_10090856 | 3300025949 | Bacteria | 3155 |
| 277 | Ga0207667_10167339 | 3300025949 | Bacteria | 2260 |
| 278 | Ga0207651_10248077 | 3300025960 | Bacteria | 1455 |
| 279 | Ga0207712_10064257 | 3300025961 | Bacteria | 2616 |
| 280 | Ga0207668_10064965 | 3300025972 | Bacteria | 2581 |
| 281 | Ga0207677_10045462 | 3300026023 | Bacteria | 2932 |
| 282 | Ga0207677_10246579 | 3300026023 | Bacteria | 1448 |
| 283 | Ga0207678_10122082 | 3300026067 | Bacteria | 2223 |
| 284 | Ga0207708_10058125 | 3300026075 | Bacteria | 2951 |
| 285 | Ga0207708_10194126 | 3300026075 | Bacteria | 1617 |
| 286 | Ga0207702_10015688 | 3300026078 | Bacteria | 6272 |
| 287 | Ga0207702_10395768 | 3300026078 | Bacteria | 1331 |
| 288 | Ga0207702_10417494 | 3300026078 | Bacteria | 1297 |
| 289 | Ga0207648_10114104 | 3300026089 | Unclassified | 2374 |
| 290 | Ga0207648_10155150 | 3300026089 | Bacteria | 2021 |
| 291 | Ga0207648_10232961 | 3300026089 | Bacteria | 1638 |
| 292 | Ga0207675_100003285 | 3300026118 | Bacteria | 15838 |
| 293 | Ga0207675_100012189 | 3300026118 | Bacteria | 8030 |
| 294 | Ga0207675_100020396 | 3300026118 | Bacteria | 6178 |
| 295 | Ga0207683_10001247 | 3300026121 | Bacteria | 23079 |
| 296 | Ga0207683_10004843 | 3300026121 | Bacteria | 11590 |
| 297 | Ga0207683_10320033 | 3300026121 | Unclassified | 1421 |
| 298 | Ga0207698_10008372 | 3300026142 | Bacteria | 6537 |
| 299 | Ga0207698_10057683 | 3300026142 | Bacteria | 3006 |
| 300 | Ga0209966_1006202 | 3300027695 | Bacteria | 2070 |
| 301 | Ga0207428_10007916 | 3300027907 | Bacteria | 9659 |
| 302 | Ga0207428_10009055 | 3300027907 | Bacteria | 8956 |
| 303 | Ga0265319_1003854 | 3300028563 | Bacteria | 7666 |
| 304 | Ga0265334_10022111 | 3300028573 | Bacteria | 2594 |
| 305 | Ga0265334_10060558 | 3300028573 | Bacteria | 1429 |
| 306 | Ga0265318_10000219 | 3300028577 | Bacteria | 49788 |
| 307 | Ga0265322_10005053 | 3300028654 | Bacteria | 3909 |
| 308 | Ga0265336_10022420 | 3300028666 | Bacteria | 2010 |
| 309 | Ga0265336_10026935 | 3300028666 | Bacteria | 1804 |
| 310 | Ga0265338_10008108 | 3300028800 | Bacteria | 12831 |
| 311 | Ga0265338_10016811 | 3300028800 | Bacteria | 7924 |
| 312 | Ga0265338_10092143 | 3300028800 | Bacteria | 2500 |
| 313 | Ga0265338_10119500 | 3300028800 | Bacteria | 2104 |
| 314 | Ga0265338_10149995 | 3300028800 | Bacteria | 1812 |
| 315 | Ga0265324_10018794 | 3300029957 | Bacteria | 2493 |
| 316 | Ga0265330_10034635 | 3300031235 | Bacteria | 2254 |
| 317 | Ga0265330_10035074 | 3300031235 | Bacteria | 2240 |
| 318 | Ga0265329_10016313 | 3300031242 | Bacteria | 2576 |
| 319 | Ga0265340_10054382 | 3300031247 | Bacteria | 1930 |
| 320 | Ga0265339_10014188 | 3300031249 | Bacteria | 4807 |
| 321 | Ga0265327_10006943 | 3300031251 | Bacteria | 8896 |
| 322 | Ga0265316_10008595 | 3300031344 | Bacteria | 9462 |
| 323 | Ga0265316_10096621 | 3300031344 | Unclassified | 2249 |
| 324 | Ga0265316_10147390 | 3300031344 | Bacteria | 1764 |
| 325 | Ga0265313_10067742 | 3300031595 | Bacteria | 1650 |
| 326 | Ga0265314_10003849 | 3300031711 | Bacteria | 14308 |
| 327 | Ga0265314_10004663 | 3300031711 | Bacteria | 12592 |
| 328 | Ga0265314_10063639 | 3300031711 | Bacteria | 2501 |
| 329 | Ga0265342_10108258 | 3300031712 | Bacteria | 1576 |
| 330 | Ga0265342_10135452 | 3300031712 | Bacteria | 1377 |
| 331 | Ga0307406_10080151 | 3300031901 | Bacteria | 2167 |
| 332 | Ga0307409_100018087 | 3300031995 | Bacteria | 4723 |
| 333 | Ga0373930_0001044 | 3300034816 | Bacteria | 3993 |
| 334 | Ga0373930_0010040 | 3300034816 | Bacteria | 1684 |
| 335 | Ga0373948_0009036 | 3300034817 | Bacteria | 1711 |
| 336 | Ga0373958_0006478 | 3300034819 | Unclassified | 1826 |
| 337 | Ga0373938_0001994 | 3300034957 | Unclassified | 3271 |
| 338 | Ga0373934_0025098 | 3300035086 | Bacteria | 2307 |
| 339 | Ga0373944_0013418 | 3300035089 | Bacteria | 2272 |
| 340 | Ga0373949_0013098 | 3300035090 | Unclassified | 1837 |
| 341 | Ga0373932_0001782 | 3300035112 | Bacteria | 5799 |
| 342 | Ga0373939_0000856 | 3300035114 | Bacteria | 7531 |
| 343 | Ga0373960_0001350 | 3300035121 | Bacteria | 5407 |
| 344 | Ga0373960_0059458 | 3300035121 | Bacteria | 1156 |
| 345 | Ga0373943_0000290 | 3300035170 | Bacteria | 20818 |
| 346 | Ga0373943_0025689 | 3300035170 | Bacteria | 2754 |
| 347 | Ga0373955_0045409 | 3300035172 | Bacteria | 2371 |
| 348 | Ga0373955_0057311 | 3300035172 | Bacteria | 2140 |
| 349 | Ga0373962_0000602 | 3300035242 | Bacteria | 8133 |
| 350 | Ga0373931_0000639 | 3300035691 | Bacteria | 14537 |
| 351 | Ga0373927_0093722 | 3300035695 | Bacteria | 1951 |
| 352 | Ga0373933_0057087 | 3300035724 | Bacteria | 2345 |
| 353 | Ga0373933_0109104 | 3300035724 | Bacteria | 1725 |
| 354 | Ga0373947_0001628 | 3300035725 | Bacteria | 13772 |
| 355 | Ga0373947_0008872 | 3300035725 | Bacteria | 5786 |
| 356 | Ga0373937_0009968 | 3300036401 | Bacteria | 8284 |
| 357 | Ga0373937_0072736 | 3300036401 | Bacteria | 3171 |
| 358 | Ga0373925_0004920 | 3300037068 | Bacteria | 10041 |
| 359 | Ga0373925_0037139 | 3300037068 | Bacteria | 3595 |
| 360 | Ga0395899_0003147 | 3300037312 | Bacteria | 13110 |
| 361 | Ga0395899_0003315 | 3300037312 | Bacteria | 12759 |
| 362 | Ga0395899_0005386 | 3300037312 | Bacteria | 9940 |
| 363 | Ga0395899_0008083 | 3300037312 | Bacteria | 8102 |
| 364 | Ga0395899_0024715 | 3300037312 | Bacteria | 4541 |
| 365 | Ga0395899_0041400 | 3300037312 | Bacteria | 3442 |
| 366 | Ga0395899_0070489 | 3300037312 | Bacteria | 2558 |
| 367 | Ga0395899_0128095 | 3300037312 | Bacteria | 1814 |
| 368 | Ga0395900_0000838 | 3300037418 | Bacteria | 40475 |
| 369 | Ga0395900_0005654 | 3300037418 | Bacteria | 13077 |
| 370 | Ga0395900_0007347 | 3300037418 | Bacteria | 11391 |
| 371 | Ga0395900_0008309 | 3300037418 | Bacteria | 10686 |
| 372 | Ga0395900_0008650 | 3300037418 | Bacteria | 10457 |
| 373 | Ga0395900_0010903 | 3300037418 | Bacteria | 9294 |
| 374 | Ga0395900_0043716 | 3300037418 | Bacteria | 4618 |
| 375 | Ga0395900_0045718 | 3300037418 | Bacteria | 4509 |
| 376 | Ga0395900_0067485 | 3300037418 | Bacteria | 3674 |
| 377 | Ga0395900_0076929 | 3300037418 | Bacteria | 3428 |
| 378 | Ga0395900_0083740 | 3300037418 | Bacteria | 3276 |
| 379 | Ga0395900_0092890 | 3300037418 | Bacteria | 3100 |
| 380 | Ga0395900_0100826 | 3300037418 | Bacteria | 2966 |
| 381 | Ga0395900_0153779 | 3300037418 | Bacteria | 2350 |
| 382 | Ga0395900_0171629 | 3300037418 | Bacteria | 2207 |
| 383 | Ga0395898_0007850 | 3300037466 | Bacteria | 11324 |
| 384 | Ga0395898_0010929 | 3300037466 | Bacteria | 9468 |
| 385 | Ga0395898_0024194 | 3300037466 | Bacteria | 6127 |
| 386 | Ga0395898_0034694 | 3300037466 | Bacteria | 5023 |
| 387 | Ga0395898_0072835 | 3300037466 | Bacteria | 3318 |
| 388 | Ga0395898_0112300 | 3300037466 | Bacteria | 2612 |
| 389 | Ga0395898_0112629 | 3300037466 | Bacteria | 2607 |
| 390 | Ga0395898_0160894 | 3300037466 | Bacteria | 2147 |
| 391 | Ga0395898_0237000 | 3300037466 | Bacteria | 1740 |
| 392 | Ga0395898_0237708 | 3300037466 | Bacteria | 1737 |
| 393 | Ga0395905_0003938 | 3300037471 | Bacteria | 15618 |
| 394 | Ga0395905_0005601 | 3300037471 | Bacteria | 12795 |
| 395 | Ga0395905_0012906 | 3300037471 | Bacteria | 8032 |
| 396 | Ga0395905_0016557 | 3300037471 | Bacteria | 7009 |
| 397 | Ga0395905_0019701 | 3300037471 | Bacteria | 6394 |
| 398 | Ga0395905_0038691 | 3300037471 | Bacteria | 4474 |
| 399 | Ga0395905_0069100 | 3300037471 | Bacteria | 3308 |
| 400 | Ga0395905_0096264 | 3300037471 | Unclassified | 2779 |
| 401 | Ga0395905_0101389 | 3300037471 | Bacteria | 2702 |
| 402 | Ga0395905_0133313 | 3300037471 | Unclassified | 2337 |
| 403 | Ga0395905_0170305 | 3300037471 | Unclassified | 2045 |
| 404 | Ga0395901_0001414 | 3300038443 | Bacteria | 25054 |
| 405 | Ga0395901_0003421 | 3300038443 | Bacteria | 15994 |
| 406 | Ga0395901_0005323 | 3300038443 | Bacteria | 13005 |
| 407 | Ga0395901_0006116 | 3300038443 | Bacteria | 12197 |
| 408 | Ga0395901_0026767 | 3300038443 | Bacteria | 5921 |
| 409 | Ga0395901_0033094 | 3300038443 | Bacteria | 5334 |
| 410 | Ga0395901_0053167 | 3300038443 | Bacteria | 4208 |
| 411 | Ga0395901_0057782 | 3300038443 | Bacteria | 4035 |
| 412 | Ga0395901_0110316 | 3300038443 | Unclassified | 2888 |
| 413 | Ga0395901_0113109 | 3300038443 | Bacteria | 2850 |
| 414 | Ga0395901_0123512 | 3300038443 | Bacteria | 2720 |
| 415 | Ga0395901_0183666 | 3300038443 | Bacteria | 2194 |
| 416 | Ga0395901_0278734 | 3300038443 | Bacteria | 1737 |
| 417 | Ga0395901_0393347 | 3300038443 | Bacteria | 1425 |
| 418 | Ga0436365_0288750 | 3300039437 | Bacteria | 5145 |
| 419 | Ga0436360_0585058 | 3300039438 | Bacteria | 5927 |
| 420 | Ga0436363_0736941 | 3300039450 | Bacteria | 1335 |
| 421 | Ga0436363_1513121 | 3300039450 | Bacteria | 1485 |
| 422 | Ga0466969_0001545 | 3300044656 | Bacteria | 12372 |
| 423 | Ga0466965_0028062 | 3300044683 | Bacteria | 2733 |
| 424 | Ga0466966_0002588 | 3300044684 | Bacteria | 11853 |
| 425 | Ga0466966_0016691 | 3300044684 | Bacteria | 4850 |
| 426 | Ga0466966_0042204 | 3300044684 | Bacteria | 2930 |
| 427 | Ga0466966_0046444 | 3300044684 | Bacteria | 2772 |
| 428 | Ga0466961_0006892 | 3300044693 | Bacteria | 7228 |
| 429 | Ga0466961_0009429 | 3300044693 | Bacteria | 6213 |
| 430 | Ga0466961_0024828 | 3300044693 | Bacteria | 3855 |
| 431 | Ga0466961_0025074 | 3300044693 | Bacteria | 3837 |
| 432 | Ga0466961_0030874 | 3300044693 | Bacteria | 3443 |
| 433 | Ga0466963_0000059 | 3300044694 | Bacteria | 37360 |
| 434 | Ga0466963_0000451 | 3300044694 | Bacteria | 19022 |
| 435 | Ga0466963_0001690 | 3300044694 | Bacteria | 12019 |
| 436 | Ga0466963_0001783 | 3300044694 | Bacteria | 11714 |
| 437 | Ga0466963_0003487 | 3300044694 | Bacteria | 9021 |
| 438 | Ga0466963_0007720 | 3300044694 | Bacteria | 6427 |
| 439 | Ga0466963_0007853 | 3300044694 | Bacteria | 6385 |
| 440 | Ga0466963_0010105 | 3300044694 | Bacteria | 5707 |
| 441 | Ga0466963_0025387 | 3300044694 | Bacteria | 3778 |
| 442 | Ga0466963_0027264 | 3300044694 | Bacteria | 3656 |
| 443 | Ga0466963_0032549 | 3300044694 | Bacteria | 3377 |
| 444 | Ga0466963_0075996 | 3300044694 | Bacteria | 2267 |
| 445 | Ga0466963_0165941 | 3300044694 | Bacteria | 1538 |
| 446 | Ga0466963_0171829 | 3300044694 | Bacteria | 1511 |
| 447 | Ga0466963_0189288 | 3300044694 | Bacteria | 1437 |
| 448 | Ga0466963_0200625 | 3300044694 | Bacteria | 1395 |
| 449 | Ga0466964_0003256 | 3300044706 | Bacteria | 5908 |
| 450 | Ga0466964_0008033 | 3300044706 | Bacteria | 3954 |
| 451 | Ga0466964_0011513 | 3300044706 | Bacteria | 3343 |
| 452 | Ga0466964_0014598 | 3300044706 | Bacteria | 2987 |
| 453 | Ga0466964_0016620 | 3300044706 | Bacteria | 2811 |
| 454 | Ga0466971_0001447 | 3300044719 | Bacteria | 10001 |
| 455 | Ga0466971_0001675 | 3300044719 | Bacteria | 9373 |
| 456 | Ga0466971_0008295 | 3300044719 | Bacteria | 4532 |
| 457 | Ga0466971_0087778 | 3300044719 | Bacteria | 1422 |
| 458 | Ga0466970_0018019 | 3300044765 | Bacteria | 3654 |
| 459 | Ga0466970_0032228 | 3300044765 | Bacteria | 2769 |
| 460 | Ga0466957_0003296 | 3300044842 | Bacteria | 8840 |
| 461 | Ga0466957_0009953 | 3300044842 | Bacteria | 5439 |
| 462 | Ga0466957_0013132 | 3300044842 | Bacteria | 4800 |
| 463 | Ga0466957_0018218 | 3300044842 | Bacteria | 4121 |
| 464 | Ga0466957_0071208 | 3300044842 | Bacteria | 2150 |
| 465 | Ga0466959_0009303 | 3300045049 | Bacteria | 6982 |
| 466 | Ga0466959_0012579 | 3300045049 | Bacteria | 6120 |
| 467 | Ga0466959_0013174 | 3300045049 | Bacteria | 5990 |
| 468 | Ga0466959_0028910 | 3300045049 | Bacteria | 4107 |
| 469 | Ga0466959_0040126 | 3300045049 | Bacteria | 3458 |
| 470 | Ga0466959_0063894 | 3300045049 | Bacteria | 2672 |
| 471 | Ga0466959_0065778 | 3300045049 | Bacteria | 2631 |
| 472 | Ga0466959_0077157 | 3300045049 | Bacteria | 2405 |
| 473 | Ga0466959_0091547 | 3300045049 | Bacteria | 2184 |
| 474 | Ga0451576_0020459 | 3300045051 | Bacteria | 7206 |
| 475 | Ga0466958_0002596 | 3300045836 | Bacteria | 9120 |
| 476 | Ga0466958_0004998 | 3300045836 | Bacteria | 7079 |
| 477 | Ga0466958_0010450 | 3300045836 | Bacteria | 5200 |
| 478 | Ga0466958_0015406 | 3300045836 | Bacteria | 4381 |
| 479 | Ga0466958_0035840 | 3300045836 | Bacteria | 2965 |
| 480 | Ga0466958_0055187 | 3300045836 | Bacteria | 2411 |
| 481 | Ga0466958_0083568 | 3300045836 | Bacteria | 1968 |
| 482 | Ga0466967_0000367 | 3300045976 | Bacteria | 20993 |
| 483 | Ga0466967_0000465 | 3300045976 | Bacteria | 19522 |
| 484 | Ga0466967_0009324 | 3300045976 | Bacteria | 7273 |
| 485 | Ga0466967_0014857 | 3300045976 | Bacteria | 6085 |
| 486 | Ga0466967_0017910 | 3300045976 | Bacteria | 5644 |
| 487 | Ga0466967_0027519 | 3300045976 | Bacteria | 4731 |
| 488 | Ga0466967_0028230 | 3300045976 | Bacteria | 4682 |
| 489 | Ga0466967_0038033 | 3300045976 | Bacteria | 4123 |
| 490 | Ga0466967_0048277 | 3300045976 | Bacteria | 3716 |
| 491 | Ga0466967_0053952 | 3300045976 | Bacteria | 3535 |
| 492 | Ga0466967_0064696 | 3300045976 | Bacteria | 3252 |
| 493 | Ga0466967_0075442 | 3300045976 | Bacteria | 3030 |
| 494 | Ga0466967_0090657 | 3300045976 | Bacteria | 2777 |
| 495 | Ga0466967_0115167 | 3300045976 | Bacteria | 2475 |
| 496 | Ga0466967_0143123 | 3300045976 | Bacteria | 2228 |
| 497 | Ga0466967_0259713 | 3300045976 | Bacteria | 1662 |
| 498 | Ga0466967_0324594 | 3300045976 | Bacteria | 1485 |
| 499 | Ga0495592_0000100 | 3300046454 | Bacteria | 76535 |
| 500 | Ga0495592_0022356 | 3300046454 | Bacteria | 4812 |
| 501 | Ga0495592_0078293 | 3300046454 | Bacteria | 2394 |
| 502 | Ga0495592_0090838 | 3300046454 | Bacteria | 2190 |
| 503 | Ga0495592_0244427 | 3300046454 | Bacteria | 1189 |
| 504 | Ga0495603_0026104 | 3300046455 | Bacteria | 3530 |
| 505 | Ga0495603_0062813 | 3300046455 | Bacteria | 2192 |
| 506 | Ga0495629_0012451 | 3300046459 | Bacteria | 6160 |
| 507 | Ga0495629_0082996 | 3300046459 | Bacteria | 2237 |
| 508 | Ga0495629_0142487 | 3300046459 | Bacteria | 1667 |
| 509 | Ga0495629_0321064 | 3300046459 | Bacteria | 1058 |
| 510 | Ga0495641_0080196 | 3300046461 | Bacteria | 1462 |
| 511 | Ga0495651_0000008 | 3300046462 | Bacteria | 156989 |
| 512 | Ga0495651_0004871 | 3300046462 | Bacteria | 10268 |
| 513 | Ga0495651_0072776 | 3300046462 | Bacteria | 2610 |
| 514 | Ga0495651_0092229 | 3300046462 | Bacteria | 2269 |
| 515 | Ga0495653_0000830 | 3300046463 | Bacteria | 23812 |
| 516 | Ga0495653_0234332 | 3300046463 | Bacteria | 1227 |
| 517 | Ga0495580_0032029 | 3300046472 | Bacteria | 3796 |
| 518 | Ga0495582_0001569 | 3300046473 | Bacteria | 12885 |
| 519 | Ga0495639_0010155 | 3300046475 | Bacteria | 4049 |
| 520 | Ga0495639_0036913 | 3300046475 | Bacteria | 2190 |
| 521 | Ga0495662_0006208 | 3300046476 | Bacteria | 5975 |
| 522 | Ga0495662_0131387 | 3300046476 | Bacteria | 1231 |
| 523 | Ga0495585_0068549 | 3300046492 | Bacteria | 1938 |
| 524 | Ga0495594_0009237 | 3300046499 | Bacteria | 5090 |
| 525 | Ga0495608_0000592 | 3300046511 | Bacteria | 24960 |
| 526 | Ga0495608_0005935 | 3300046511 | Bacteria | 8686 |
| 527 | Ga0495618_0001097 | 3300046514 | Bacteria | 18344 |
| 528 | Ga0495618_0075380 | 3300046514 | Bacteria | 2148 |
| 529 | Ga0495628_0000105 | 3300046516 | Bacteria | 68159 |
| 530 | Ga0495628_0018328 | 3300046516 | Bacteria | 5802 |
| 531 | Ga0495628_0019397 | 3300046516 | Bacteria | 5623 |
| 532 | Ga0495628_0050033 | 3300046516 | Bacteria | 3307 |
| 533 | Ga0495630_0066192 | 3300046517 | Bacteria | 2715 |
| 534 | Ga0495630_0091978 | 3300046517 | Bacteria | 2292 |
| 535 | Ga0495644_0034595 | 3300046523 | Bacteria | 1907 |
| 536 | Ga0495644_0044040 | 3300046523 | Bacteria | 1679 |
| 537 | Ga0495666_0003265 | 3300046526 | Bacteria | 8182 |
| 538 | Ga0495666_0008748 | 3300046526 | Bacteria | 5072 |
| 539 | Ga0495652_0000588 | 3300046529 | Bacteria | 42490 |
| 540 | Ga0495652_0020477 | 3300046529 | Bacteria | 5881 |
| 541 | Ga0495652_0022091 | 3300046529 | Bacteria | 5651 |
| 542 | Ga0495652_0028289 | 3300046529 | Bacteria | 4933 |
| 543 | Ga0495652_0301038 | 3300046529 | Unclassified | 1166 |
| 544 | Ga0495665_0004559 | 3300046531 | Bacteria | 7479 |
| 545 | Ga0495640_0009416 | 3300046533 | Bacteria | 7607 |
| 546 | Ga0495640_0195693 | 3300046533 | Bacteria | 1283 |
| 547 | Ga0495586_0055418 | 3300046535 | Bacteria | 2148 |
| 548 | Ga0495587_0000048 | 3300046536 | Bacteria | 105358 |
| 549 | Ga0495587_0064598 | 3300046536 | Bacteria | 2138 |
| 550 | Ga0495645_0000029 | 3300046543 | Bacteria | 113119 |
| 551 | Ga0495645_0034803 | 3300046543 | Bacteria | 3672 |
| 552 | Ga0495645_0101828 | 3300046543 | Bacteria | 2041 |
| 553 | Ga0495633_0115689 | 3300046558 | Bacteria | 1243 |
| 554 | Ga0495667_0002537 | 3300046559 | Bacteria | 12191 |
| 555 | Ga0495667_0044609 | 3300046559 | Bacteria | 2936 |
| 556 | Ga0495667_0246038 | 3300046559 | Bacteria | 1138 |
| 557 | Ga0495668_0161161 | 3300046616 | Bacteria | 1229 |
| 558 | Ga0495634_0020252 | 3300046642 | Bacteria | 4719 |
| 559 | Ga0495634_0035646 | 3300046642 | Bacteria | 3405 |
| 560 | Ga0495634_0066526 | 3300046642 | Bacteria | 2386 |
| 561 | Ga0495634_0073440 | 3300046642 | Bacteria | 2249 |
| 562 | Ga0495634_0136971 | 3300046642 | Bacteria | 1557 |
| 563 | Ga0495635_0007861 | 3300046663 | Bacteria | 7447 |
| 564 | Ga0495635_0085343 | 3300046663 | Bacteria | 2160 |
| 565 | Ga0495588_0010588 | 3300046674 | Bacteria | 4294 |
| 566 | Ga0495657_0007704 | 3300046675 | Bacteria | 8290 |
| 567 | Ga0495657_0054612 | 3300046675 | Bacteria | 2667 |
| 568 | Ga0495599_0004463 | 3300046678 | Bacteria | 8288 |
| 569 | Ga0495599_0035212 | 3300046678 | Bacteria | 3143 |
| 570 | Ga0495623_0000383 | 3300046679 | Bacteria | 29016 |
| 571 | Ga0495623_0005893 | 3300046679 | Bacteria | 7982 |
| 572 | Ga0495646_0007876 | 3300046680 | Bacteria | 6764 |
| 573 | Ga0495646_0032248 | 3300046680 | Bacteria | 3261 |
| 574 | Ga0495646_0059507 | 3300046680 | Bacteria | 2281 |
| 575 | Ga0495646_0074497 | 3300046680 | Bacteria | 1992 |
| 576 | Ga0495647_0000147 | 3300046681 | Bacteria | 18079 |
| 577 | Ga0495658_0000882 | 3300046683 | Bacteria | 16096 |
| 578 | Ga0495613_0011162 | 3300046689 | Bacteria | 6670 |
| 579 | Ga0495613_0040914 | 3300046689 | Bacteria | 3433 |
| 580 | Ga0495613_0074584 | 3300046689 | Bacteria | 2470 |
| 581 | Ga0495624_0004712 | 3300046690 | Bacteria | 9922 |
| 582 | Ga0495624_0010694 | 3300046690 | Bacteria | 6320 |
| 583 | Ga0495600_0014980 | 3300046809 | Bacteria | 4896 |
| 584 | Ga0495581_0001949 | 3300047315 | Bacteria | 11566 |
| 585 | Ga0495581_0022511 | 3300047315 | Bacteria | 3652 |
| 586 | Ga0495581_0057400 | 3300047315 | Unclassified | 2247 |
| 587 | Ga0495604_0000238 | 3300047317 | Bacteria | 49191 |
| 588 | Ga0495604_0029912 | 3300047317 | Bacteria | 4331 |
| 589 | Ga0495636_0018134 | 3300047318 | Bacteria | 2823 |
| 590 | Ga0495674_0006233 | 3300047319 | Bacteria | 11443 |
| 591 | Ga0495674_0012752 | 3300047319 | Bacteria | 7917 |
| 592 | Ga0495674_0308202 | 3300047319 | Bacteria | 1292 |
| 593 | Ga0495674_0332755 | 3300047319 | Bacteria | 1235 |
| 594 | Ga0495676_0003678 | 3300047321 | Bacteria | 13922 |
| 595 | Ga0495676_0043875 | 3300047321 | Bacteria | 3655 |
| 596 | Ga0495676_0050544 | 3300047321 | Bacteria | 3333 |
| 597 | Ga0495680_0000743 | 3300047322 | Bacteria | 36546 |
| 598 | Ga0495680_0046690 | 3300047322 | Bacteria | 3413 |
| 599 | Ga0495680_0051521 | 3300047322 | Bacteria | 3213 |
| 600 | Ga0495680_0127507 | 3300047322 | Bacteria | 1872 |
| 601 | Ga0495675_0000262 | 3300047444 | Bacteria | 38243 |
| 602 | Ga0495684_0049795 | 3300047471 | Bacteria | 3200 |
| 603 | Ga0495684_0174143 | 3300047471 | Bacteria | 1598 |
| 604 | Ga0495684_0236544 | 3300047471 | Bacteria | 1334 |
| 605 | Ga0495593_0000299 | 3300047673 | Bacteria | 27012 |
| 606 | Ga0495602_0000141 | 3300048088 | Bacteria | 67940 |
| 607 | Ga0495602_0076716 | 3300048088 | Bacteria | 2830 |
| 608 | Ga0495614_0004505 | 3300048089 | Bacteria | 6286 |
| 609 | Ga0496100_0002369 | 3300048903 | Bacteria | 9534 |
| 610 | Ga0496100_0025498 | 3300048903 | Unclassified | 3616 |
| 611 | Ga0496100_0027663 | 3300048903 | Bacteria | 3489 |
| 612 | Ga0496100_0047198 | 3300048903 | Bacteria | 2773 |
| 613 | Ga0496100_0100626 | 3300048903 | Bacteria | 1991 |
| 614 | Ga0496101_0001864 | 3300048904 | Bacteria | 12730 |
| 615 | Ga0496101_0007743 | 3300048904 | Bacteria | 6979 |
| 616 | Ga0496101_0032449 | 3300048904 | Unclassified | 3676 |
| 617 | Ga0496101_0032809 | 3300048904 | Bacteria | 3658 |
| 618 | Ga0496101_0047644 | 3300048904 | Bacteria | 3078 |
| 619 | Ga0496101_0228893 | 3300048904 | Bacteria | 1444 |
| 620 | Ga0496101_0234636 | 3300048904 | Bacteria | 1427 |
| 621 | Ga0496102_0027940 | 3300048905 | Bacteria | 5040 |
| 622 | Ga0496102_0035691 | 3300048905 | Bacteria | 4476 |
| 623 | Ga0496102_0039851 | 3300048905 | Bacteria | 4247 |
| 624 | Ga0496102_0286185 | 3300048905 | Unclassified | 1553 |
| 625 | Ga0496103_0002427 | 3300048906 | Bacteria | 11726 |
| 626 | Ga0496103_0007138 | 3300048906 | Bacteria | 6668 |
| 627 | Ga0496103_0028824 | 3300048906 | Bacteria | 3372 |
| 628 | Ga0496103_0046546 | 3300048906 | Bacteria | 2679 |
| 629 | Ga0496103_0091347 | 3300048906 | Bacteria | 1921 |
| 630 | Ga0496103_0142024 | 3300048906 | Bacteria | 1536 |
| 631 | Ga0496104_0000606 | 3300048907 | Bacteria | 30748 |
| 632 | Ga0496104_0002544 | 3300048907 | Bacteria | 15709 |
| 633 | Ga0496104_0020469 | 3300048907 | Bacteria | 6064 |
| 634 | Ga0496104_0024930 | 3300048907 | Bacteria | 5509 |
| 635 | Ga0496104_0070212 | 3300048907 | Bacteria | 3329 |
| 636 | Ga0496104_0232493 | 3300048907 | Bacteria | 1755 |
| 637 | Ga0496105_0000182 | 3300048908 | Bacteria | 41923 |
| 638 | Ga0496105_0000829 | 3300048908 | Bacteria | 21023 |
| 639 | Ga0496105_0003781 | 3300048908 | Bacteria | 11282 |
| 640 | Ga0496105_0020584 | 3300048908 | Bacteria | 5332 |
| 641 | Ga0496105_0028325 | 3300048908 | Bacteria | 4581 |
| 642 | Ga0496105_0028597 | 3300048908 | Bacteria | 4558 |
| 643 | Ga0496106_0004815 | 3300048909 | Bacteria | 9984 |
| 644 | Ga0496106_0006529 | 3300048909 | Bacteria | 8634 |
| 645 | Ga0496106_0015014 | 3300048909 | Bacteria | 5732 |
| 646 | Ga0496106_0030296 | 3300048909 | Bacteria | 4035 |
| 647 | Ga0496106_0038972 | 3300048909 | Bacteria | 3558 |
| 648 | Ga0496107_0000956 | 3300048910 | Bacteria | 17125 |
| 649 | Ga0496107_0004947 | 3300048910 | Bacteria | 9068 |
| 650 | Ga0496107_0005172 | 3300048910 | Bacteria | 8908 |
| 651 | Ga0496107_0006368 | 3300048910 | Bacteria | 8115 |
| 652 | Ga0496107_0034200 | 3300048910 | Unclassified | 3639 |
| 653 | Ga0496107_0036365 | 3300048910 | Bacteria | 3532 |
| 654 | Ga0496107_0106014 | 3300048910 | Bacteria | 2064 |
| 655 | Ga0496108_0002750 | 3300048911 | Bacteria | 14084 |
| 656 | Ga0496108_0003870 | 3300048911 | Bacteria | 12019 |
| 657 | Ga0496108_0004029 | 3300048911 | Bacteria | 11792 |
| 658 | Ga0496108_0007073 | 3300048911 | Bacteria | 9088 |
| 659 | Ga0496108_0009975 | 3300048911 | Bacteria | 7697 |
| 660 | Ga0496108_0098949 | 3300048911 | Bacteria | 2485 |
| 661 | Ga0496109_0000403 | 3300048912 | Bacteria | 39012 |
| 662 | Ga0496109_0000993 | 3300048912 | Bacteria | 23393 |
| 663 | Ga0496109_0002841 | 3300048912 | Bacteria | 14513 |
| 664 | Ga0496109_0070827 | 3300048912 | Bacteria | 3200 |
| 665 | Ga0496109_0093921 | 3300048912 | Bacteria | 2776 |
| 666 | Ga0496110_0000581 | 3300048913 | Bacteria | 25064 |
| 667 | Ga0496110_0009855 | 3300048913 | Bacteria | 7744 |
| 668 | Ga0496110_0035488 | 3300048913 | Bacteria | 4326 |
| 669 | Ga0496111_0000076 | 3300048914 | Bacteria | 40931 |
| 670 | Ga0496111_0043291 | 3300048914 | Bacteria | 3235 |
| 671 | Ga0496111_0045980 | 3300048914 | Bacteria | 3142 |
| 672 | Ga0496111_0103499 | 3300048914 | Bacteria | 2094 |
| 673 | Ga0496111_0120427 | 3300048914 | Bacteria | 1938 |
| 674 | Ga0496111_0132742 | 3300048914 | Bacteria | 1843 |
| 675 | Ga0496111_0238260 | 3300048914 | Bacteria | 1351 |
| 676 | Ga0496112_0016601 | 3300048915 | Bacteria | 6902 |
| 677 | Ga0496112_0063236 | 3300048915 | Bacteria | 3650 |
| 678 | Ga0496112_0095357 | 3300048915 | Unclassified | 2945 |
| 679 | Ga0496112_0351159 | 3300048915 | Bacteria | 1417 |
| 680 | Ga0496112_0487894 | 3300048915 | Bacteria | 1168 |
| 681 | Ga0496113_0001019 | 3300048916 | Bacteria | 15051 |
| 682 | Ga0496113_0057152 | 3300048916 | Bacteria | 2931 |
| 683 | Ga0496113_0085378 | 3300048916 | Bacteria | 2425 |
| 684 | Ga0496113_0090629 | 3300048916 | Bacteria | 2355 |
| 685 | Ga0496113_0164916 | 3300048916 | Bacteria | 1753 |
| 686 | Ga0496113_0168014 | 3300048916 | Unclassified | 1736 |
| 687 | Ga0496114_0001845 | 3300048917 | Bacteria | 16042 |
| 688 | Ga0496114_0004673 | 3300048917 | Bacteria | 10646 |
| 689 | Ga0496114_0039542 | 3300048917 | Bacteria | 3902 |
| 690 | Ga0496114_0050111 | 3300048917 | Bacteria | 3475 |
| 691 | Ga0496114_0102798 | 3300048917 | Bacteria | 2441 |
| 692 | Ga0496114_0111612 | 3300048917 | Bacteria | 2343 |
| 693 | Ga0496114_0222685 | 3300048917 | Bacteria | 1656 |
| 694 | Ga0496114_0264722 | 3300048917 | Bacteria | 1514 |
| 695 | Ga0496115_0006197 | 3300048918 | Bacteria | 8747 |
| 696 | Ga0496115_0011876 | 3300048918 | Bacteria | 6541 |
| 697 | Ga0496115_0013517 | 3300048918 | Bacteria | 6176 |
| 698 | Ga0496115_0027593 | 3300048918 | Bacteria | 4443 |
| 699 | Ga0496115_0040331 | 3300048918 | Bacteria | 3711 |
| 700 | Ga0496115_0097313 | 3300048918 | Bacteria | 2410 |
| 701 | Ga0496115_0124554 | 3300048918 | Bacteria | 2122 |
| 702 | Ga0501031_0000716 | 3300049568 | Bacteria | 19845 |
| 703 | Ga0501032_0025894 | 3300049569 | Bacteria | 4040 |
| 704 | Ga0501033_0002860 | 3300049570 | Bacteria | 14466 |
| 705 | Ga0501034_0023571 | 3300049571 | Bacteria | 6271 |
| 706 | Ga0501036_0002492 | 3300049572 | Bacteria | 14439 |
| 707 | Ga0501037_0003072 | 3300049573 | Bacteria | 12095 |
| 708 | Ga0501038_0087121 | 3300049574 | Bacteria | 2622 |
| 709 | Ga0501039_0007222 | 3300049575 | Bacteria | 8463 |
| 710 | Ga0501040_0107068 | 3300049576 | Bacteria | 1953 |
| 711 | Ga0501041_0002467 | 3300049577 | Bacteria | 10509 |
| 712 | Ga0501042_0032065 | 3300049578 | Bacteria | 3718 |
| 713 | Ga0501046_0012506 | 3300049580 | Bacteria | 7222 |
| 714 | Ga0501046_0248610 | 3300049580 | Bacteria | 1310 |
| 715 | Ga0501047_0114935 | 3300049581 | Bacteria | 2573 |
| 716 | Ga0501048_0001523 | 3300049582 | Bacteria | 17576 |
| 717 | Ga0501067_0018861 | 3300049583 | Bacteria | 3817 |
| 718 | Ga0501068_0000650 | 3300049584 | Bacteria | 17802 |
| 719 | Ga0501069_0000355 | 3300049585 | Bacteria | 20569 |
| 720 | Ga0501070_0005314 | 3300049586 | Bacteria | 10987 |
| 721 | Ga0501070_0085560 | 3300049586 | Bacteria | 2610 |
| 722 | Ga0501072_0011114 | 3300049588 | Bacteria | 6871 |
| 723 | Ga0501072_0015503 | 3300049588 | Bacteria | 5841 |
| 724 | Ga0501073_0004139 | 3300049589 | Bacteria | 10884 |
| 725 | Ga0501073_0047382 | 3300049589 | Bacteria | 3021 |
| 726 | Ga0501073_0123178 | 3300049589 | Bacteria | 1797 |
| 727 | Ga0501074_0001086 | 3300049590 | Bacteria | 17746 |
| 728 | Ga0501074_0013966 | 3300049590 | Bacteria | 5836 |
| 729 | Ga0501075_0090013 | 3300049591 | Bacteria | 2327 |
| 730 | Ga0501075_0249693 | 3300049591 | Bacteria | 1352 |
| 731 | Ga0501076_0152861 | 3300049592 | Bacteria | 1877 |
| 732 | Ga0501077_0029137 | 3300049593 | Bacteria | 3509 |
| 733 | Ga0501079_0016847 | 3300049741 | Bacteria | 5579 |
| 734 | Ga0501079_0118273 | 3300049741 | Bacteria | 2060 |
| 735 | Ga0501080_0005193 | 3300049742 | Bacteria | 11602 |
| 736 | Ga0501080_0036472 | 3300049742 | Bacteria | 4589 |
| 737 | Ga0501080_0138711 | 3300049742 | Bacteria | 2249 |
| 738 | Ga0501081_0011960 | 3300049743 | Bacteria | 5686 |
| 739 | Ga0501083_0000421 | 3300049744 | Bacteria | 27178 |
| 740 | Ga0501083_0007048 | 3300049744 | Bacteria | 7982 |
| 741 | Ga0501035_0011371 | 3300049822 | Bacteria | 8250 |
| 742 | Ga0501044_0021031 | 3300049823 | Bacteria | 6966 |
| 743 | Ga0501045_0042436 | 3300049824 | Bacteria | 3310 |
| 744 | nmdc:mga00v17_59807_c1 | 3300050491 | Unclassified | 2339 |
| 745 | nmdc:mga05p37_240557_c1 | 3300050507 | Bacteria | 2177 |
| 746 | nmdc:mga0qj67_211783_c1 | 3300050509 | Bacteria | 1574 |
| 747 | nmdc:mga0qj67_268420_c1 | 3300050509 | Bacteria | 1384 |
| 748 | nmdc:mga08y16_490458_c1 | 3300050511 | Bacteria | 1249 |
| 749 | nmdc:mga0n895_154441_c1 | 3300050512 | Bacteria | 2326 |
| 750 | nmdc:mga0n895_154527_c1 | 3300050512 | Bacteria | 2325 |
| 751 | nmdc:mga0n895_291936_c1 | 3300050512 | Bacteria | 1653 |
| 752 | nmdc:mga0n895_308682_c1 | 3300050512 | Bacteria | 1603 |
| 753 | nmdc:mga0rr50_159395_c1 | 3300050513 | Unclassified | 1830 |
| 754 | nmdc:mga0rr50_222253_c1 | 3300050513 | Unclassified | 1560 |
| 755 | nmdc:mga08x19_13480_c1 | 3300050514 | Bacteria | 4944 |
| 756 | nmdc:mga08x19_69595_c1 | 3300050514 | Bacteria | 2292 |
| 757 | nmdc:mga0a205_176466_c1 | 3300050515 | Bacteria | 2032 |
| 758 | nmdc:mga0a205_203810_c1 | 3300050515 | Bacteria | 1868 |
| 759 | nmdc:mga0a205_68618_c1 | 3300050515 | Unclassified | 3424 |
| 760 | Ga0495601_0000174 | 3300053077 | Bacteria | 34055 |
| 761 | Ga0495601_0022382 | 3300053077 | Bacteria | 3878 |
| 762 | Ga0495601_0082876 | 3300053077 | Bacteria | 2059 |
| 763 | Ga0495612_0109762 | 3300053078 | Bacteria | 1180 |
| 764 | Ga0495595_0022445 | 3300053084 | Bacteria | 2771 |
| 765 | Ga0495595_0031672 | 3300053084 | Bacteria | 2377 |
| 766 | Ga0495595_0095464 | 3300053084 | Bacteria | 1430 |
| 767 | Ga0495619_0001659 | 3300053085 | Bacteria | 14697 |
| 768 | Ga0495619_0008857 | 3300053085 | Bacteria | 6362 |
| 769 | Ga0495619_0017573 | 3300053085 | Bacteria | 4529 |
| 770 | Ga0495619_0088180 | 3300053085 | Bacteria | 2098 |
| 771 | Ga0501084_0044664 | 3300054114 | Bacteria | 3709 |
| 772 | Ga0501082_0048936 | 3300060353 | Bacteria | 3644 |
| 773 | Ga0466962_0001492 | 3300061719 | Bacteria | 10912 |
| 774 | Ga0466962_0002419 | 3300061719 | Bacteria | 8856 |
| 775 | Ga0466962_0022096 | 3300061719 | Bacteria | 3056 |
| 776 | Ga0530510_0117143 | 3300061734 | Bacteria | 1953 |
| 777 | Ga0530510_0161772 | 3300061734 | Bacteria | 1656 |
| 778 | Ga0265334_10021309 | |||
| 779 | Ga0070658_10009553 | |||
| 780 | Ga0070658_10043255 | |||
| 781 | Ga0070683_100005736 | |||
| 782 | Ga0070683_100025123 | |||
| 783 | Ga0070683_100039455 | |||
| 784 | Ga0070683_100043689 | |||
| 785 | Ga0070680_100007655 | |||
| 786 | Ga0070680_100039108 | |||
| 787 | Ga0070680_100040114 | |||
| 788 | Ga0070680_100071255 | |||
| 789 | Ga0070682_100006153 | |||
| 790 | Ga0070682_100060505 | |||
| 791 | Ga0068868_100043677 | |||
| 792 | Ga0070660_100001517 | |||
| 793 | Ga0070660_100001690 | |||
| 794 | Ga0070660_100006571 | |||
| 795 | Ga0070660_100010990 | |||
| 796 | Ga0070661_100016327 | |||
| 797 | Ga0070661_100028216 | |||
| 798 | Ga0070692_10049263 | |||
| 799 | Ga0070692_10083284 | |||
| 800 | Ga0070668_100006244 | |||
| 801 | Ga0070669_100065637 | |||
| 802 | Ga0070671_100013071 | |||
| 803 | Ga0070674_100011678 | |||
| 804 | Ga0070659_100258402 | |||
| 805 | Ga0070659_100328835 | |||
| 806 | Ga0070703_10008624 | |||
| 807 | Ga0070709_10020586 | |||
| 808 | Ga0070709_10039355 | |||
| 809 | Ga0070709_10163944 | |||
| 810 | Ga0070714_100014183 | |||
| 811 | Ga0070714_100016774 | |||
| 812 | Ga0070714_100146404 | |||
| 813 | Ga0070713_100016547 | |||
| 814 | Ga0070713_100016773 | |||
| 815 | Ga0070713_100111526 | |||
| 816 | Ga0070713_100237557 | |||
| 817 | Ga0070713_100244623 | |||
| 818 | Ga0070710_10023926 | |||
| 819 | Ga0070710_10030280 | |||
| 820 | Ga0070710_10050628 | |||
| 821 | Ga0070710_10104995 | |||
| 822 | Ga0070701_10017552 | |||
| 823 | Ga0070711_100019774 | |||
| 824 | Ga0070705_100002476 | |||
| 825 | Ga0070705_100017298 | |||
| 826 | Ga0070694_100023142 | |||
| 827 | Ga0070694_100030834 | |||
| 828 | Ga0070662_100004082 | |||
| 829 | Ga0070662_100293562 | |||
| 830 | Ga0070681_10001213 | |||
| 831 | Ga0070681_10002017 | |||
| 832 | Ga0070681_10004073 | |||
| 833 | Ga0070681_10040002 | |||
| 834 | Ga0070681_10056936 | |||
| 835 | Ga0070681_10147130 | |||
| 836 | Ga0070706_100126231 | |||
| 837 | Ga0070706_100303749 | |||
| 838 | Ga0070707_100001941 | |||
| 839 | Ga0070698_100073227 | |||
| 840 | Ga0070679_100033173 | |||
| 841 | Ga0070679_100046170 | |||
| 842 | Ga0070679_100053721 | |||
| 843 | Ga0070679_100098116 | |||
| 844 | Ga0070679_100104478 | |||
| 845 | Ga0070679_100252816 | |||
| 846 | Ga0070684_100001782 | |||
| 847 | Ga0070684_100031250 | |||
| 848 | Ga0070684_100057587 | |||
| 849 | Ga0070684_100058232 | |||
| 850 | Ga0070686_100024613 | |||
| 851 | Ga0070686_100085016 | |||
| 852 | Ga0070695_100000023 | |||
| 853 | Ga0070695_100012016 | |||
| 854 | Ga0070696_100005739 | |||
| 855 | Ga0070696_100050836 | |||
| 856 | Ga0070693_100122190 | |||
| 857 | Ga0070665_100443895 | |||
| 858 | Ga0068855_100016384 | |||
| 859 | Ga0068855_100060875 | |||
| 860 | Ga0068855_100065579 | |||
| 861 | Ga0068855_100102077 | |||
| 862 | Ga0068855_100371292 | |||
| 863 | Ga0070664_100341351 | |||
| 864 | Ga0068854_100008212 | |||
| 865 | Ga0068856_100019349 | |||
| 866 | Ga0068856_100073541 | |||
| 867 | Ga0068852_100016969 | |||
| 868 | Ga0068852_100104996 | |||
| 869 | Ga0068866_10117044 | |||
| 870 | Ga0068861_100015838 | |||
| 871 | Ga0068861_100061681 | |||
| 872 | Ga0068860_100064102 | |||
| 873 | Ga0068862_100053396 | |||
| 874 | Ga0081455_10016032 | |||
| 875 | Ga0081455_10072982 | |||
| 876 | Ga0081538_10000286 | |||
| 877 | Ga0081538_10043112 | |||
| 878 | Ga0081540_1008899 | |||
| 879 | Ga0070717_10017852 | |||
| 880 | Ga0070717_10034081 | |||
| 881 | Ga0075365_10006430 | |||
| 882 | Ga0075364_10003922 | |||
| 883 | Ga0075432_10006435 | |||
| 884 | Ga0070716_100098282 | |||
| 885 | Ga0070712_100025405 | |||
| 886 | Ga0070712_100162044 | |||
| 887 | Ga0070712_100171999 | |||
| 888 | Ga0070712_100211248 | |||
| 889 | Ga0097621_100142777 | |||
| 890 | Ga0075430_100231791 | |||
| 891 | Ga0075431_100067933 | |||
| 892 | Ga0075433_10085662 | |||
| 893 | Ga0075433_10143249 | |||
| 894 | Ga0075434_100008194 | |||
| 895 | Ga0075434_100047928 | |||
| 896 | Ga0075434_100231203 | |||
| 897 | Ga0075434_100275153 | |||
| 898 | Ga0075429_100020385 | |||
| 899 | Ga0075429_100046490 | |||
| 900 | Ga0068865_100027843 | |||
| 901 | Ga0075436_100027354 | |||
| 902 | Ga0075436_100032925 | |||
| 903 | Ga0075436_100058811 | |||
| 904 | Ga0075436_100077483 | |||
| 905 | Ga0105240_10030125 | |||
| 906 | Ga0105240_10048618 | |||
| 907 | Ga0105240_10078098 | |||
| 908 | Ga0105240_10090992 | |||
| 909 | Ga0105240_10136231 | |||
| 910 | Ga0105240_10257945 | |||
| 911 | Ga0105240_10387472 | |||
| 912 | Ga0111539_10049522 | |||
| 913 | Ga0111539_10210712 | |||
| 914 | Ga0105245_10020707 | |||
| 915 | Ga0114129_10005545 | |||
| 916 | Ga0114129_10160230 | |||
| 917 | Ga0105243_10058047 | |||
| 918 | Ga0105241_10010596 | |||
| 919 | Ga0105242_10021890 | |||
| 920 | Ga0105242_10131610 | |||
| 921 | Ga0105248_10278975 | |||
| 922 | Ga0105237_10116252 | |||
| 923 | Ga0105238_10113964 | |||
| 924 | Ga0105249_10058573 | |||
| 925 | Ga0105249_10260665 | |||
| 926 | Ga0105239_10392108 | |||
| 927 | Ga0157320_1000699 | |||
| 928 | Ga0157373_10195795 | |||
| 929 | Ga0157370_10008703 | |||
| 930 | Ga0157369_10002254 | |||
| 931 | Ga0157369_10004763 | |||
| 932 | Ga0157369_10020611 | |||
| 933 | Ga0157369_10023333 | |||
| 934 | Ga0157369_10209922 | |||
| 935 | Ga0157369_10421655 | |||
| 936 | Ga0157374_10180733 | |||
| 937 | Ga0157374_10199569 | |||
| 938 | Ga0157378_10141320 | |||
| 939 | Ga0163162_10033481 | |||
| 940 | Ga0163162_10046309 | |||
| 941 | Ga0157372_10094301 | |||
| 942 | Ga0157372_10094327 | |||
| 943 | Ga0157372_10226806 | |||
| 944 | Ga0157380_10110639 | |||
| 945 | Ga0182008_10054224 | |||
| 946 | Ga0182008_10098821 | |||
| 947 | Ga0157377_10064727 | |||
| 948 | Ga0157376_10032736 | |||
| 949 | Ga0157376_10064754 | |||
| 950 | Ga0157376_10203753 | |||
| 951 | Ga0182007_10051096 | |||
| 952 | Ga0163161_10122398 | |||
| 953 | Ga0197907_10080291 | |||
| 954 | Ga0206356_11614020 | |||
| 955 | Ga0206354_10542429 | |||
| 956 | Ga0206354_11491096 | |||
| 957 | Ga0206353_10099927 | |||
| 958 | Ga0206353_10669741 | |||
| 959 | Ga0213871_10014302 | |||
| 960 | Ga0224712_10040016 | |||
| 961 | Ga0207653_10048209 | |||
| 962 | Ga0207692_10023856 | |||
| 963 | Ga0207692_10031100 | |||
| 964 | Ga0207692_10093428 | |||
| 965 | Ga0207688_10014556 | |||
| 966 | Ga0207688_10142569 | |||
| 967 | Ga0207699_10059054 | |||
| 968 | Ga0207699_10068638 | |||
| 969 | Ga0207699_10088627 | |||
| 970 | Ga0207699_10180912 | |||
| 971 | Ga0207699_10183729 | |||
| 972 | Ga0207705_10033077 | |||
| 973 | Ga0207705_10042113 | |||
| 974 | Ga0207705_10054608 | |||
| 975 | Ga0207705_10231628 | |||
| 976 | Ga0207684_10085700 | |||
| 977 | Ga0207707_10008180 | |||
| 978 | Ga0207707_10019358 | |||
| 979 | Ga0207707_10024788 | |||
| 980 | Ga0207695_10020749 | |||
| 981 | Ga0207695_10177668 | |||
| 982 | Ga0207695_10238535 | |||
| 983 | Ga0207671_10082284 | |||
| 984 | Ga0207671_10198324 | |||
| 985 | Ga0207693_10000495 | |||
| 986 | Ga0207693_10000945 | |||
| 987 | Ga0207693_10023481 | |||
| 988 | Ga0207693_10024171 | |||
| 989 | Ga0207693_10029773 | |||
| 990 | Ga0207693_10043088 | |||
| 991 | Ga0207693_10043197 | |||
| 992 | Ga0207693_10092467 | |||
| 993 | Ga0207693_10108366 | |||
| 994 | Ga0207693_10152223 | |||
| 995 | Ga0207663_10017707 | |||
| 996 | Ga0207663_10052101 | |||
| 997 | Ga0207663_10147462 | |||
| 998 | Ga0207660_10036380 | |||
| 999 | Ga0207660_10039038 | |||
| 1000 | Ga0207660_10054983 | |||
| 1001 | Ga0207660_10134828 | |||
| 1002 | Ga0207662_10094394 | |||
| 1003 | Ga0207657_10000054 | |||
| 1004 | Ga0207657_10000941 | |||
| 1005 | Ga0207657_10001857 | |||
| 1006 | Ga0207657_10010087 | |||
| 1007 | Ga0207657_10016069 | |||
| 1008 | Ga0207649_10045466 | |||
| 1009 | Ga0207649_10083062 | |||
| 1010 | Ga0207649_10117862 | |||
| 1011 | Ga0207652_10009948 | |||
| 1012 | Ga0207652_10024808 | |||
| 1013 | Ga0207652_10083967 | |||
| 1014 | Ga0207652_10093678 | |||
| 1015 | Ga0207652_10193957 | |||
| 1016 | Ga0207652_10360508 | |||
| 1017 | Ga0207646_10004082 | |||
| 1018 | Ga0207646_10120152 | |||
| 1019 | Ga0207650_10311910 | |||
| 1020 | Ga0207700_10043096 | |||
| 1021 | Ga0207700_10047950 | |||
| 1022 | Ga0207700_10075797 | |||
| 1023 | Ga0207700_10082516 | |||
| 1024 | Ga0207700_10159484 | |||
| 1025 | Ga0207700_10171522 | |||
| 1026 | Ga0207664_10009896 | |||
| 1027 | Ga0207664_10018814 | |||
| 1028 | Ga0207664_10031411 | |||
| 1029 | Ga0207664_10050667 | |||
| 1030 | Ga0207664_10097049 | |||
| 1031 | Ga0207664_10183549 | |||
| 1032 | Ga0207664_10187042 | |||
| 1033 | Ga0207664_10205168 | |||
| 1034 | Ga0207644_10118139 | |||
| 1035 | Ga0207706_10015073 | |||
| 1036 | Ga0207706_10051366 | |||
| 1037 | Ga0207706_10230456 | |||
| 1038 | Ga0207686_10021423 | |||
| 1039 | Ga0207665_10000344 | |||
| 1040 | Ga0207665_10007025 | |||
| 1041 | Ga0207665_10009193 | |||
| 1042 | Ga0207665_10165657 | |||
| 1043 | Ga0207691_10108888 | |||
| 1044 | Ga0207691_10114805 | |||
| 1045 | Ga0207689_10141365 | |||
| 1046 | Ga0207661_10014747 | |||
| 1047 | Ga0207661_10075545 | |||
| 1048 | Ga0207661_10108686 | |||
| 1049 | Ga0207661_10181810 | |||
| 1050 | Ga0207661_10231040 | |||
| 1051 | Ga0207679_10094316 | |||
| 1052 | Ga0207667_10087137 | |||
| 1053 | Ga0207667_10090856 | |||
| 1054 | Ga0207667_10167339 | |||
| 1055 | Ga0207651_10248077 | |||
| 1056 | Ga0207712_10064257 | |||
| 1057 | Ga0207668_10064965 | |||
| 1058 | Ga0207677_10045462 | |||
| 1059 | Ga0207677_10246579 | |||
| 1060 | Ga0207678_10122082 | |||
| 1061 | Ga0207708_10058125 | |||
| 1062 | Ga0207708_10194126 | |||
| 1063 | Ga0207702_10015688 | |||
| 1064 | Ga0207702_10395768 | |||
| 1065 | Ga0207702_10417494 | |||
| 1066 | Ga0207648_10114104 | |||
| 1067 | Ga0207648_10155150 | |||
| 1068 | Ga0207648_10232961 | |||
| 1069 | Ga0207675_100003285 | |||
| 1070 | Ga0207675_100012189 | |||
| 1071 | Ga0207675_100020396 | |||
| 1072 | Ga0207683_10001247 | |||
| 1073 | Ga0207683_10004843 | |||
| 1074 | Ga0207683_10320033 | |||
| 1075 | Ga0207698_10008372 | |||
| 1076 | Ga0207698_10057683 | |||
| 1077 | Ga0209966_1006202 | |||
| 1078 | Ga0207428_10007916 | |||
| 1079 | Ga0207428_10009055 | |||
| 1080 | Ga0265319_1003854 | |||
| 1081 | Ga0265334_10022111 | |||
| 1082 | Ga0265334_10060558 | |||
| 1083 | Ga0265318_10000219 | |||
| 1084 | Ga0265322_10005053 | |||
| 1085 | Ga0265336_10022420 | |||
| 1086 | Ga0265336_10026935 | |||
| 1087 | Ga0265338_10008108 | |||
| 1088 | Ga0265338_10016811 | |||
| 1089 | Ga0265338_10092143 | |||
| 1090 | Ga0265338_10119500 | |||
| 1091 | Ga0265338_10149995 | |||
| 1092 | Ga0265324_10018794 | |||
| 1093 | Ga0265330_10034635 | |||
| 1094 | Ga0265330_10035074 | |||
| 1095 | Ga0265329_10016313 | |||
| 1096 | Ga0265340_10054382 | |||
| 1097 | Ga0265339_10014188 | |||
| 1098 | Ga0265327_10006943 | |||
| 1099 | Ga0265316_10008595 | |||
| 1100 | Ga0265316_10096621 | |||
| 1101 | Ga0265316_10147390 | |||
| 1102 | Ga0265313_10067742 | |||
| 1103 | Ga0265314_10003849 | |||
| 1104 | Ga0265314_10004663 | |||
| 1105 | Ga0265314_10063639 | |||
| 1106 | Ga0265342_10108258 | |||
| 1107 | Ga0265342_10135452 | |||
| 1108 | Ga0307406_10080151 | |||
| 1109 | Ga0307409_100018087 | |||
| 1110 | Ga0373930_0001044 | |||
| 1111 | Ga0373930_0010040 | |||
| 1112 | Ga0373948_0009036 | |||
| 1113 | Ga0373958_0006478 | |||
| 1114 | Ga0373938_0001994 | |||
| 1115 | Ga0373934_0025098 | |||
| 1116 | Ga0373944_0013418 | |||
| 1117 | Ga0373949_0013098 | |||
| 1118 | Ga0373932_0001782 | |||
| 1119 | Ga0373939_0000856 | |||
| 1120 | Ga0373960_0001350 | |||
| 1121 | Ga0373960_0059458 | |||
| 1122 | Ga0373943_0000290 | |||
| 1123 | Ga0373943_0025689 | |||
| 1124 | Ga0373955_0045409 | |||
| 1125 | Ga0373955_0057311 | |||
| 1126 | Ga0373962_0000602 | |||
| 1127 | Ga0373931_0000639 | |||
| 1128 | Ga0373927_0093722 | |||
| 1129 | Ga0373933_0057087 | |||
| 1130 | Ga0373933_0109104 | |||
| 1131 | Ga0373947_0001628 | |||
| 1132 | Ga0373947_0008872 | |||
| 1133 | Ga0373937_0009968 | |||
| 1134 | Ga0373937_0072736 | |||
| 1135 | Ga0373925_0004920 | |||
| 1136 | Ga0373925_0037139 | |||
| 1137 | Ga0395899_0003147 | |||
| 1138 | Ga0395899_0003315 | |||
| 1139 | Ga0395899_0005386 | |||
| 1140 | Ga0395899_0008083 | |||
| 1141 | Ga0395899_0024715 | |||
| 1142 | Ga0395899_0041400 | |||
| 1143 | Ga0395899_0070489 | |||
| 1144 | Ga0395899_0128095 | |||
| 1145 | Ga0395900_0000838 | |||
| 1146 | Ga0395900_0005654 | |||
| 1147 | Ga0395900_0007347 | |||
| 1148 | Ga0395900_0008309 | |||
| 1149 | Ga0395900_0008650 | |||
| 1150 | Ga0395900_0010903 | |||
| 1151 | Ga0395900_0043716 | |||
| 1152 | Ga0395900_0045718 | |||
| 1153 | Ga0395900_0067485 | |||
| 1154 | Ga0395900_0076929 | |||
| 1155 | Ga0395900_0083740 | |||
| 1156 | Ga0395900_0092890 | |||
| 1157 | Ga0395900_0100826 | |||
| 1158 | Ga0395900_0153779 | |||
| 1159 | Ga0395900_0171629 | |||
| 1160 | Ga0395898_0007850 | |||
| 1161 | Ga0395898_0010929 | |||
| 1162 | Ga0395898_0024194 | |||
| 1163 | Ga0395898_0034694 | |||
| 1164 | Ga0395898_0072835 | |||
| 1165 | Ga0395898_0112300 | |||
| 1166 | Ga0395898_0112629 | |||
| 1167 | Ga0395898_0160894 | |||
| 1168 | Ga0395898_0237000 | |||
| 1169 | Ga0395898_0237708 | |||
| 1170 | Ga0395905_0003938 | |||
| 1171 | Ga0395905_0005601 | |||
| 1172 | Ga0395905_0012906 | |||
| 1173 | Ga0395905_0016557 | |||
| 1174 | Ga0395905_0019701 | |||
| 1175 | Ga0395905_0038691 | |||
| 1176 | Ga0395905_0069100 | |||
| 1177 | Ga0395905_0096264 | |||
| 1178 | Ga0395905_0101389 | |||
| 1179 | Ga0395905_0133313 | |||
| 1180 | Ga0395905_0170305 | |||
| 1181 | Ga0395901_0001414 | |||
| 1182 | Ga0395901_0003421 | |||
| 1183 | Ga0395901_0005323 | |||
| 1184 | Ga0395901_0006116 | |||
| 1185 | Ga0395901_0026767 | |||
| 1186 | Ga0395901_0033094 | |||
| 1187 | Ga0395901_0053167 | |||
| 1188 | Ga0395901_0057782 | |||
| 1189 | Ga0395901_0110316 | |||
| 1190 | Ga0395901_0113109 | |||
| 1191 | Ga0395901_0123512 | |||
| 1192 | Ga0395901_0183666 | |||
| 1193 | Ga0395901_0278734 | |||
| 1194 | Ga0395901_0393347 | |||
| 1195 | Ga0436365_0288750 | |||
| 1196 | Ga0436360_0585058 | |||
| 1197 | Ga0436363_0736941 | |||
| 1198 | Ga0436363_1513121 | |||
| 1199 | Ga0466969_0001545 | |||
| 1200 | Ga0466965_0028062 | |||
| 1201 | Ga0466966_0002588 | |||
| 1202 | Ga0466966_0016691 | |||
| 1203 | Ga0466966_0042204 | |||
| 1204 | Ga0466966_0046444 | |||
| 1205 | Ga0466961_0006892 | |||
| 1206 | Ga0466961_0009429 | |||
| 1207 | Ga0466961_0024828 | |||
| 1208 | Ga0466961_0025074 | |||
| 1209 | Ga0466961_0030874 | |||
| 1210 | Ga0466963_0000059 | |||
| 1211 | Ga0466963_0000451 | |||
| 1212 | Ga0466963_0001690 | |||
| 1213 | Ga0466963_0001783 | |||
| 1214 | Ga0466963_0003487 | |||
| 1215 | Ga0466963_0007720 | |||
| 1216 | Ga0466963_0007853 | |||
| 1217 | Ga0466963_0010105 | |||
| 1218 | Ga0466963_0025387 | |||
| 1219 | Ga0466963_0027264 | |||
| 1220 | Ga0466963_0032549 | |||
| 1221 | Ga0466963_0075996 | |||
| 1222 | Ga0466963_0165941 | |||
| 1223 | Ga0466963_0171829 | |||
| 1224 | Ga0466963_0189288 | |||
| 1225 | Ga0466963_0200625 | |||
| 1226 | Ga0466964_0003256 | |||
| 1227 | Ga0466964_0008033 | |||
| 1228 | Ga0466964_0011513 | |||
| 1229 | Ga0466964_0014598 | |||
| 1230 | Ga0466964_0016620 | |||
| 1231 | Ga0466971_0001447 | |||
| 1232 | Ga0466971_0001675 | |||
| 1233 | Ga0466971_0008295 | |||
| 1234 | Ga0466971_0087778 | |||
| 1235 | Ga0466970_0018019 | |||
| 1236 | Ga0466970_0032228 | |||
| 1237 | Ga0466957_0003296 | |||
| 1238 | Ga0466957_0009953 | |||
| 1239 | Ga0466957_0013132 | |||
| 1240 | Ga0466957_0018218 | |||
| 1241 | Ga0466957_0071208 | |||
| 1242 | Ga0466959_0009303 | |||
| 1243 | Ga0466959_0012579 | |||
| 1244 | Ga0466959_0013174 | |||
| 1245 | Ga0466959_0028910 | |||
| 1246 | Ga0466959_0040126 | |||
| 1247 | Ga0466959_0063894 | |||
| 1248 | Ga0466959_0065778 | |||
| 1249 | Ga0466959_0077157 | |||
| 1250 | Ga0466959_0091547 | |||
| 1251 | Ga0451576_0020459 | |||
| 1252 | Ga0466958_0002596 | |||
| 1253 | Ga0466958_0004998 | |||
| 1254 | Ga0466958_0010450 | |||
| 1255 | Ga0466958_0015406 | |||
| 1256 | Ga0466958_0035840 | |||
| 1257 | Ga0466958_0055187 | |||
| 1258 | Ga0466958_0083568 | |||
| 1259 | Ga0466967_0000367 | |||
| 1260 | Ga0466967_0000465 | |||
| 1261 | Ga0466967_0009324 | |||
| 1262 | Ga0466967_0014857 | |||
| 1263 | Ga0466967_0017910 | |||
| 1264 | Ga0466967_0027519 | |||
| 1265 | Ga0466967_0028230 | |||
| 1266 | Ga0466967_0038033 | |||
| 1267 | Ga0466967_0048277 | |||
| 1268 | Ga0466967_0053952 | |||
| 1269 | Ga0466967_0064696 | |||
| 1270 | Ga0466967_0075442 | |||
| 1271 | Ga0466967_0090657 | |||
| 1272 | Ga0466967_0115167 | |||
| 1273 | Ga0466967_0143123 | |||
| 1274 | Ga0466967_0259713 | |||
| 1275 | Ga0466967_0324594 | |||
| 1276 | Ga0495592_0000100 | |||
| 1277 | Ga0495592_0022356 | |||
| 1278 | Ga0495592_0078293 | |||
| 1279 | Ga0495592_0090838 | |||
| 1280 | Ga0495592_0244427 | |||
| 1281 | Ga0495603_0026104 | |||
| 1282 | Ga0495603_0062813 | |||
| 1283 | Ga0495629_0012451 | |||
| 1284 | Ga0495629_0082996 | |||
| 1285 | Ga0495629_0142487 | |||
| 1286 | Ga0495629_0321064 | |||
| 1287 | Ga0495641_0080196 | |||
| 1288 | Ga0495651_0000008 | |||
| 1289 | Ga0495651_0004871 | |||
| 1290 | Ga0495651_0072776 | |||
| 1291 | Ga0495651_0092229 | |||
| 1292 | Ga0495653_0000830 | |||
| 1293 | Ga0495653_0234332 | |||
| 1294 | Ga0495580_0032029 | |||
| 1295 | Ga0495582_0001569 | |||
| 1296 | Ga0495639_0010155 | |||
| 1297 | Ga0495639_0036913 | |||
| 1298 | Ga0495662_0006208 | |||
| 1299 | Ga0495662_0131387 | |||
| 1300 | Ga0495585_0068549 | |||
| 1301 | Ga0495594_0009237 | |||
| 1302 | Ga0495608_0000592 | |||
| 1303 | Ga0495608_0005935 | |||
| 1304 | Ga0495618_0001097 | |||
| 1305 | Ga0495618_0075380 | |||
| 1306 | Ga0495628_0000105 | |||
| 1307 | Ga0495628_0018328 | |||
| 1308 | Ga0495628_0019397 | |||
| 1309 | Ga0495628_0050033 | |||
| 1310 | Ga0495630_0066192 | |||
| 1311 | Ga0495630_0091978 | |||
| 1312 | Ga0495644_0034595 | |||
| 1313 | Ga0495644_0044040 | |||
| 1314 | Ga0495666_0003265 | |||
| 1315 | Ga0495666_0008748 | |||
| 1316 | Ga0495652_0000588 | |||
| 1317 | Ga0495652_0020477 | |||
| 1318 | Ga0495652_0022091 | |||
| 1319 | Ga0495652_0028289 | |||
| 1320 | Ga0495652_0301038 | |||
| 1321 | Ga0495665_0004559 | |||
| 1322 | Ga0495640_0009416 | |||
| 1323 | Ga0495640_0195693 | |||
| 1324 | Ga0495586_0055418 | |||
| 1325 | Ga0495587_0000048 | |||
| 1326 | Ga0495587_0064598 | |||
| 1327 | Ga0495645_0000029 | |||
| 1328 | Ga0495645_0034803 | |||
| 1329 | Ga0495645_0101828 | |||
| 1330 | Ga0495633_0115689 | |||
| 1331 | Ga0495667_0002537 | |||
| 1332 | Ga0495667_0044609 | |||
| 1333 | Ga0495667_0246038 | |||
| 1334 | Ga0495668_0161161 | |||
| 1335 | Ga0495634_0020252 | |||
| 1336 | Ga0495634_0035646 | |||
| 1337 | Ga0495634_0066526 | |||
| 1338 | Ga0495634_0073440 | |||
| 1339 | Ga0495634_0136971 | |||
| 1340 | Ga0495635_0007861 | |||
| 1341 | Ga0495635_0085343 | |||
| 1342 | Ga0495588_0010588 | |||
| 1343 | Ga0495657_0007704 | |||
| 1344 | Ga0495657_0054612 | |||
| 1345 | Ga0495599_0004463 | |||
| 1346 | Ga0495599_0035212 | |||
| 1347 | Ga0495623_0000383 | |||
| 1348 | Ga0495623_0005893 | |||
| 1349 | Ga0495646_0007876 | |||
| 1350 | Ga0495646_0032248 | |||
| 1351 | Ga0495646_0059507 | |||
| 1352 | Ga0495646_0074497 | |||
| 1353 | Ga0495647_0000147 | |||
| 1354 | Ga0495658_0000882 | |||
| 1355 | Ga0495613_0011162 | |||
| 1356 | Ga0495613_0040914 | |||
| 1357 | Ga0495613_0074584 | |||
| 1358 | Ga0495624_0004712 | |||
| 1359 | Ga0495624_0010694 | |||
| 1360 | Ga0495600_0014980 | |||
| 1361 | Ga0495581_0001949 | |||
| 1362 | Ga0495581_0022511 | |||
| 1363 | Ga0495581_0057400 | |||
| 1364 | Ga0495604_0000238 | |||
| 1365 | Ga0495604_0029912 | |||
| 1366 | Ga0495636_0018134 | |||
| 1367 | Ga0495674_0006233 | |||
| 1368 | Ga0495674_0012752 | |||
| 1369 | Ga0495674_0308202 | |||
| 1370 | Ga0495674_0332755 | |||
| 1371 | Ga0495676_0003678 | |||
| 1372 | Ga0495676_0043875 | |||
| 1373 | Ga0495676_0050544 | |||
| 1374 | Ga0495680_0000743 | |||
| 1375 | Ga0495680_0046690 | |||
| 1376 | Ga0495680_0051521 | |||
| 1377 | Ga0495680_0127507 | |||
| 1378 | Ga0495675_0000262 | |||
| 1379 | Ga0495684_0049795 | |||
| 1380 | Ga0495684_0174143 | |||
| 1381 | Ga0495684_0236544 | |||
| 1382 | Ga0495593_0000299 | |||
| 1383 | Ga0495602_0000141 | |||
| 1384 | Ga0495602_0076716 | |||
| 1385 | Ga0495614_0004505 | |||
| 1386 | Ga0496100_0002369 | |||
| 1387 | Ga0496100_0025498 | |||
| 1388 | Ga0496100_0027663 | |||
| 1389 | Ga0496100_0047198 | |||
| 1390 | Ga0496100_0100626 | |||
| 1391 | Ga0496101_0001864 | |||
| 1392 | Ga0496101_0007743 | |||
| 1393 | Ga0496101_0032449 | |||
| 1394 | Ga0496101_0032809 | |||
| 1395 | Ga0496101_0047644 | |||
| 1396 | Ga0496101_0228893 | |||
| 1397 | Ga0496101_0234636 | |||
| 1398 | Ga0496102_0027940 | |||
| 1399 | Ga0496102_0035691 | |||
| 1400 | Ga0496102_0039851 | |||
| 1401 | Ga0496102_0286185 | |||
| 1402 | Ga0496103_0002427 | |||
| 1403 | Ga0496103_0007138 | |||
| 1404 | Ga0496103_0028824 | |||
| 1405 | Ga0496103_0046546 | |||
| 1406 | Ga0496103_0091347 | |||
| 1407 | Ga0496103_0142024 | |||
| 1408 | Ga0496104_0000606 | |||
| 1409 | Ga0496104_0002544 | |||
| 1410 | Ga0496104_0020469 | |||
| 1411 | Ga0496104_0024930 | |||
| 1412 | Ga0496104_0070212 | |||
| 1413 | Ga0496104_0232493 | |||
| 1414 | Ga0496105_0000182 | |||
| 1415 | Ga0496105_0000829 | |||
| 1416 | Ga0496105_0003781 | |||
| 1417 | Ga0496105_0020584 | |||
| 1418 | Ga0496105_0028325 | |||
| 1419 | Ga0496105_0028597 | |||
| 1420 | Ga0496106_0004815 | |||
| 1421 | Ga0496106_0006529 | |||
| 1422 | Ga0496106_0015014 | |||
| 1423 | Ga0496106_0030296 | |||
| 1424 | Ga0496106_0038972 | |||
| 1425 | Ga0496107_0000956 | |||
| 1426 | Ga0496107_0004947 | |||
| 1427 | Ga0496107_0005172 | |||
| 1428 | Ga0496107_0006368 | |||
| 1429 | Ga0496107_0034200 | |||
| 1430 | Ga0496107_0036365 | |||
| 1431 | Ga0496107_0106014 | |||
| 1432 | Ga0496108_0002750 | |||
| 1433 | Ga0496108_0003870 | |||
| 1434 | Ga0496108_0004029 | |||
| 1435 | Ga0496108_0007073 | |||
| 1436 | Ga0496108_0009975 | |||
| 1437 | Ga0496108_0098949 | |||
| 1438 | Ga0496109_0000403 | |||
| 1439 | Ga0496109_0000993 | |||
| 1440 | Ga0496109_0002841 | |||
| 1441 | Ga0496109_0070827 | |||
| 1442 | Ga0496109_0093921 | |||
| 1443 | Ga0496110_0000581 | |||
| 1444 | Ga0496110_0009855 | |||
| 1445 | Ga0496110_0035488 | |||
| 1446 | Ga0496111_0000076 | |||
| 1447 | Ga0496111_0043291 | |||
| 1448 | Ga0496111_0045980 | |||
| 1449 | Ga0496111_0103499 | |||
| 1450 | Ga0496111_0120427 | |||
| 1451 | Ga0496111_0132742 | |||
| 1452 | Ga0496111_0238260 | |||
| 1453 | Ga0496112_0016601 | |||
| 1454 | Ga0496112_0063236 | |||
| 1455 | Ga0496112_0095357 | |||
| 1456 | Ga0496112_0351159 | |||
| 1457 | Ga0496112_0487894 | |||
| 1458 | Ga0496113_0001019 | |||
| 1459 | Ga0496113_0057152 | |||
| 1460 | Ga0496113_0085378 | |||
| 1461 | Ga0496113_0090629 | |||
| 1462 | Ga0496113_0164916 | |||
| 1463 | Ga0496113_0168014 | |||
| 1464 | Ga0496114_0001845 | |||
| 1465 | Ga0496114_0004673 | |||
| 1466 | Ga0496114_0039542 | |||
| 1467 | Ga0496114_0050111 | |||
| 1468 | Ga0496114_0102798 | |||
| 1469 | Ga0496114_0111612 | |||
| 1470 | Ga0496114_0222685 | |||
| 1471 | Ga0496114_0264722 | |||
| 1472 | Ga0496115_0006197 | |||
| 1473 | Ga0496115_0011876 | |||
| 1474 | Ga0496115_0013517 | |||
| 1475 | Ga0496115_0027593 | |||
| 1476 | Ga0496115_0040331 | |||
| 1477 | Ga0496115_0097313 | |||
| 1478 | Ga0496115_0124554 | |||
| 1479 | Ga0501031_0000716 | |||
| 1480 | Ga0501032_0025894 | |||
| 1481 | Ga0501033_0002860 | |||
| 1482 | Ga0501034_0023571 | |||
| 1483 | Ga0501036_0002492 | |||
| 1484 | Ga0501037_0003072 | |||
| 1485 | Ga0501038_0087121 | |||
| 1486 | Ga0501039_0007222 | |||
| 1487 | Ga0501040_0107068 | |||
| 1488 | Ga0501041_0002467 | |||
| 1489 | Ga0501042_0032065 | |||
| 1490 | Ga0501046_0012506 | |||
| 1491 | Ga0501046_0248610 | |||
| 1492 | Ga0501047_0114935 | |||
| 1493 | Ga0501048_0001523 | |||
| 1494 | Ga0501067_0018861 | |||
| 1495 | Ga0501068_0000650 | |||
| 1496 | Ga0501069_0000355 | |||
| 1497 | Ga0501070_0005314 | |||
| 1498 | Ga0501070_0085560 | |||
| 1499 | Ga0501072_0011114 | |||
| 1500 | Ga0501072_0015503 | |||
| 1501 | Ga0501073_0004139 | |||
| 1502 | Ga0501073_0047382 | |||
| 1503 | Ga0501073_0123178 | |||
| 1504 | Ga0501074_0001086 | |||
| 1505 | Ga0501074_0013966 | |||
| 1506 | Ga0501075_0090013 | |||
| 1507 | Ga0501075_0249693 | |||
| 1508 | Ga0501076_0152861 | |||
| 1509 | Ga0501077_0029137 | |||
| 1510 | Ga0501079_0016847 | |||
| 1511 | Ga0501079_0118273 | |||
| 1512 | Ga0501080_0005193 | |||
| 1513 | Ga0501080_0036472 | |||
| 1514 | Ga0501080_0138711 | |||
| 1515 | Ga0501081_0011960 | |||
| 1516 | Ga0501083_0000421 | |||
| 1517 | Ga0501083_0007048 | |||
| 1518 | Ga0501035_0011371 | |||
| 1519 | Ga0501044_0021031 | |||
| 1520 | Ga0501045_0042436 | |||
| 1521 | nmdc:mga00v17_59807_c1 | |||
| 1522 | nmdc:mga05p37_240557_c1 | |||
| 1523 | nmdc:mga0qj67_211783_c1 | |||
| 1524 | nmdc:mga0qj67_268420_c1 | |||
| 1525 | nmdc:mga08y16_490458_c1 | |||
| 1526 | nmdc:mga0n895_154441_c1 | |||
| 1527 | nmdc:mga0n895_154527_c1 | |||
| 1528 | nmdc:mga0n895_291936_c1 | |||
| 1529 | nmdc:mga0n895_308682_c1 | |||
| 1530 | nmdc:mga0rr50_159395_c1 | |||
| 1531 | nmdc:mga0rr50_222253_c1 | |||
| 1532 | nmdc:mga08x19_13480_c1 | |||
| 1533 | nmdc:mga08x19_69595_c1 | |||
| 1534 | nmdc:mga0a205_176466_c1 | |||
| 1535 | nmdc:mga0a205_203810_c1 | |||
| 1536 | nmdc:mga0a205_68618_c1 | |||
| 1537 | Ga0495601_0000174 | |||
| 1538 | Ga0495601_0022382 | |||
| 1539 | Ga0495601_0082876 | |||
| 1540 | Ga0495612_0109762 | |||
| 1541 | Ga0495595_0022445 | |||
| 1542 | Ga0495595_0031672 | |||
| 1543 | Ga0495595_0095464 | |||
| 1544 | Ga0495619_0001659 | |||
| 1545 | Ga0495619_0008857 | |||
| 1546 | Ga0495619_0017573 | |||
| 1547 | Ga0495619_0088180 | |||
| 1548 | Ga0501084_0044664 | |||
| 1549 | Ga0501082_0048936 | |||
| 1550 | Ga0466962_0001492 | |||
| 1551 | Ga0466962_0002419 | |||
| 1552 | Ga0466962_0022096 | |||
| 1553 | Ga0530510_0117143 | |||
| 1554 | Ga0530510_0161772 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy