F480376

General Info

Members Datasets Scaffolds Average Seq Length
777 557 1554 300

Family's Representative Sequence

Representative Sequence 3300035695|Ga0373927_0044698|Ga0373927_0044698_74_1183
Length 369
Sequence MIARALAPRLFVIPHCCGRTVNIAGVDLPLPRGQQAFCGGKNRAIEVPIAIPFCNPSRGTAKVNATAHQTPRIARANGIELCYEIFGDADAEPMLLIMGLAAQMIHWDDEFCRQLAARGFRVIRFDNRDIGRSSRMTGGKRLGALELLKLRFLKIPVAAPYTLRDMAEDTVGLMDVLGIKSAHLVGASMGGMIAQEIAISFPQRVRSLTSIMSTTGNPKVPGPTREASAMLMAPPPSTKEEYFERYAQTWKILRAGSFPQDEALDRARAERNFERGLNPTGVGRQLRAVLASGNRKERLASVRAPTLVIHGTVDPLVRPEGGKDTAASIPGAKLLMIEGMGHALPIRMWPQVIDAIDKHAHAASAKAMH

Samples

Sample ID Description Type Environment
1 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
71 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
157 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
158 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
159 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
163 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
164 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
165 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
174 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
175 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
176 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
177 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
178 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
179 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
182 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
196 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
197 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
198 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
199 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
212 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
213 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
214 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
217 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
218 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
219 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
223 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
224 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
225 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
226 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
227 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
228 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
229 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
230 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
254 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
263 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
264 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
265 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
266 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
267 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
268 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
269 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
270 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
271 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
284 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
285 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
286 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
287 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
288 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
289 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
290 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
291 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
292 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
293 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
296 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
297 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
298 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
299 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
300 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
301 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
302 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
303 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
304 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
305 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
306 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
307 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
308 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
309 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
310 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
311 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
312 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
313 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
314 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
315 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
316 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
317 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
318 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
319 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
320 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
321 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
322 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
323 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
324 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
325 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
326 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
327 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
328 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
329 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
330 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
331 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
332 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
333 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
334 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
335 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
336 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
337 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
338 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
339 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
340 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
341 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
342 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
343 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
344 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
345 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
346 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
347 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
348 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
349 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
350 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
351 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
352 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
353 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
354 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
355 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
356 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
357 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
358 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
359 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
360 2643221651 Afipia sp. Root123D2 Isolate Unclassified
361 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
362 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
363 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
364 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
365 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
366 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
367 2791355199
368 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
369 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
370 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
371 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
372 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
373 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
374 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
375 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
376 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
377 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
378 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
379 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
380 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
381 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
382 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
383 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
384 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
385 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
386 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
387 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
388 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
389 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
390 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
391 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
392 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
393 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
394 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
395 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
396 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
397 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
398 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
399 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
400 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
401 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
402 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
403 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
404 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
405 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
406 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
407 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
408 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
409 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
410 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
411 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
412 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
413 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
414 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
415 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
416 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
417 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
418 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
419 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
420 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
421 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
422 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
423 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
424 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
425 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
426 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
427 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
428 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
429 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
430 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
431 2904699407
432 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
433 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
434 2906610324
435 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
436 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
437 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
438 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
439 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
440 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
441 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
442 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
443 2922368715
444 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
445 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
446 2922425934
447 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
448 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
449 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
450 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
451 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
452 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
453 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
454 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
455 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
456 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
457 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
458 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
459 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
460 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
461 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
462 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
463 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
464 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
465 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
466 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
467 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
468 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
469 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
470 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
471 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
472 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
473 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
474 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
475 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
476 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
477 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
478 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
479 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
480 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
481 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
482 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
483 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
484 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
485 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
486 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
487 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
488 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
489 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
490 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
491 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
492 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
493 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
494 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
495 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
496 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
497 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
498 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
499 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
500 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
501 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
502 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
503 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
504 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
505 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
506 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
507 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
508 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
509 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
510 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
511 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
512 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
513 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
514 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
515 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
516 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
517 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
518 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
519 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
520 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
521 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
522 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
523 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
524 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
525 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
526 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
527 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
528 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
529 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
530 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
531 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
532 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
533 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
534 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
535 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
536 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
537 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
538 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
539 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
540 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
541 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
542 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
543 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
544 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
545 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
546 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
547 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
548 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
549 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
550 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
551 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
552 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
553 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
554 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
555 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
556 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
557 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 71.5
Metatranscriptomes 0
Isolates 28.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.72
Nodule 22.27
Rhizoplane 5.79
Rhizosphere 52.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373927_0044698 3300035695 Bacteria 2865
2 JGI25406J46586_10000223 3300003203 Bacteria 25081
3 JGI25160J50197_1002236 3300003354 Bacteria 9086
4 Ga0055543_1003779 3300004625 Bacteria 4317
5 Ga0065165_1001214 3300005262 Bacteria 29682
6 Ga0070658_10005755 3300005327 Bacteria 10053
7 Ga0070658_10029138 3300005327 Bacteria 4434
8 Ga0070676_10068276 3300005328 Bacteria 2128
9 Ga0070676_10129692 3300005328 Bacteria 1593
10 Ga0070683_100007952 3300005329 Bacteria 8995
11 Ga0070683_100196995 3300005329 Bacteria 1913
12 Ga0070670_100037139 3300005331 Bacteria 4191
13 Ga0070670_100131214 3300005331 Bacteria 2164
14 Ga0070677_10002920 3300005333 Bacteria 5491
15 Ga0070682_100127813 3300005337 Bacteria 1716
16 Ga0068868_100021088 3300005338 Bacteria 4905
17 Ga0068868_100118279 3300005338 Bacteria 2160
18 Ga0070660_100085153 3300005339 Bacteria 2485
19 Ga0070660_100094301 3300005339 Bacteria 2365
20 Ga0070660_100118218 3300005339 Bacteria 2114
21 Ga0070689_100250614 3300005340 Bacteria 1461
22 Ga0070661_100004144 3300005344 Bacteria 9996
23 Ga0070668_100098454 3300005347 Bacteria 2314
24 Ga0070668_100104450 3300005347 Bacteria 2248
25 Ga0070669_100037552 3300005353 Bacteria 3514
26 Ga0070669_100182244 3300005353 Bacteria 1643
27 Ga0070675_100008566 3300005354 Bacteria 7941
28 Ga0070671_100191918 3300005355 Bacteria 1731
29 Ga0070674_100000518 3300005356 Bacteria 19349
30 Ga0070674_100003318 3300005356 Bacteria 9011
31 Ga0070674_100058937 3300005356 Bacteria 2671
32 Ga0070673_100064373 3300005364 Bacteria 2921
33 Ga0070659_100033568 3300005366 Bacteria 3986
34 Ga0070659_100227289 3300005366 Bacteria 1541
35 Ga0070667_100007713 3300005367 Bacteria 8920
36 Ga0070709_10013391 3300005434 Bacteria 4610
37 Ga0070709_10027137 3300005434 Bacteria 3403
38 Ga0070709_10039448 3300005434 Bacteria 2897
39 Ga0070714_100007489 3300005435 Bacteria 8495
40 Ga0070714_100022201 3300005435 Bacteria 5202
41 Ga0070713_100001931 3300005436 Bacteria 13391
42 Ga0070710_10000550 3300005437 Bacteria 17724
43 Ga0070710_10011800 3300005437 Bacteria 4327
44 Ga0070710_10012215 3300005437 Bacteria 4258
45 Ga0070711_100073365 3300005439 Bacteria 2418
46 Ga0070711_100239395 3300005439 Bacteria 1418
47 Ga0070663_100015643 3300005455 Bacteria 4905
48 Ga0070663_100028451 3300005455 Bacteria 3805
49 Ga0070678_100003918 3300005456 Bacteria 8367
50 Ga0070678_100141068 3300005456 Bacteria 1928
51 Ga0070678_100162088 3300005456 Bacteria 1813
52 Ga0070662_100352827 3300005457 Bacteria 1205
53 Ga0070662_100437376 3300005457 Bacteria 1084
54 Ga0068867_100004484 3300005459 Bacteria 9810
55 Ga0070679_100037472 3300005530 Bacteria 4818
56 Ga0070679_100134648 3300005530 Bacteria 2452
57 Ga0070684_100002660 3300005535 Bacteria 13192
58 Ga0070684_100037881 3300005535 Bacteria 4139
59 Ga0070684_100185011 3300005535 Bacteria 1894
60 Ga0068853_100130206 3300005539 Bacteria 2252
61 Ga0070672_100000150 3300005543 Bacteria 38126
62 Ga0070672_100026924 3300005543 Bacteria 4285
63 Ga0070686_100163559 3300005544 Bacteria 1569
64 Ga0070693_100053632 3300005547 Bacteria 2316
65 Ga0070665_100028020 3300005548 Bacteria 5674
66 Ga0070665_100095325 3300005548 Bacteria 2980
67 Ga0068855_100215006 3300005563 Bacteria 2158
68 Ga0070664_100020769 3300005564 Bacteria 5409
69 Ga0068857_100063575 3300005577 Bacteria 3281
70 Ga0068857_100175773 3300005577 Bacteria 1948
71 Ga0068854_100001586 3300005578 Bacteria 13835
72 Ga0068854_100033855 3300005578 Bacteria 3564
73 Ga0068856_100002765 3300005614 Bacteria 17962
74 Ga0068856_100288187 3300005614 Bacteria 1659
75 Ga0068852_100004505 3300005616 Bacteria 9855
76 Ga0068852_100012408 3300005616 Bacteria 6469
77 Ga0068852_100015875 3300005616 Bacteria 5857
78 Ga0068852_100343918 3300005616 Bacteria 1455
79 Ga0068864_100125965 3300005618 Bacteria 2296
80 Ga0068864_100280962 3300005618 Bacteria 1554
81 Ga0068864_100517715 3300005618 Bacteria 1150
82 Ga0068861_100007671 3300005719 Bacteria 7406
83 Ga0068870_10064238 3300005840 Bacteria 1982
84 Ga0068863_100019290 3300005841 Bacteria 6522
85 Ga0068863_100354582 3300005841 Bacteria 1429
86 Ga0068858_100006988 3300005842 Bacteria 10963
87 Ga0068860_100064651 3300005843 Bacteria 3475
88 Ga0068860_100090365 3300005843 Bacteria 2917
89 Ga0068862_100080734 3300005844 Bacteria 2821
90 Ga0081455_10004053 3300005937 Bacteria 16599
91 Ga0081538_10050154 3300005981 Bacteria 2524
92 Ga0081540_1007980 3300005983 Bacteria 7455
93 Ga0081540_1019127 3300005983 Bacteria 4176
94 Ga0081539_10000325 3300005985 Bacteria 106431
95 Ga0070717_10009249 3300006028 Bacteria 7406
96 Ga0070717_10010145 3300006028 Bacteria 7093
97 Ga0070717_10044803 3300006028 Bacteria 3615
98 Ga0075365_10011349 3300006038 Bacteria 5235
99 Ga0075365_10068872 3300006038 Bacteria 2378
100 Ga0075363_100003003 3300006048 Bacteria 7055
101 Ga0075364_10019699 3300006051 Bacteria 4237
102 Ga0075364_10041354 3300006051 Bacteria 2993
103 Ga0075364_10125101 3300006051 Bacteria 1723
104 Ga0070715_10000126 3300006163 Bacteria 18112
105 Ga0070716_100005825 3300006173 Bacteria 5985
106 Ga0070712_100012143 3300006175 Bacteria 5474
107 Ga0075362_10055660 3300006177 Bacteria 1779
108 Ga0075367_10043437 3300006178 Bacteria 2632
109 Ga0075366_10089319 3300006195 Bacteria 1845
110 Ga0075370_10165354 3300006353 Bacteria 1299
111 Ga0068871_100019118 3300006358 Bacteria 5226
112 Ga0068865_100097434 3300006881 Bacteria 2147
113 Ga0099824_1006123 3300006942 Bacteria 16665
114 Ga0099822_1000072 3300006943 Bacteria 55118
115 Ga0105240_10003278 3300009093 Bacteria 25307
116 Ga0105240_10017290 3300009093 Bacteria 9725
117 Ga0105240_10058231 3300009093 Bacteria 4824
118 Ga0105240_10593043 3300009093 Bacteria 1221
119 Ga0105245_10015073 3300009098 Bacteria 6735
120 Ga0105245_10047099 3300009098 Bacteria 3854
121 Ga0105245_10082016 3300009098 Bacteria 2949
122 Ga0105247_10087830 3300009101 Bacteria 1969
123 Ga0105243_10096912 3300009148 Bacteria 2441
124 Ga0105241_10016146 3300009174 Bacteria 5473
125 Ga0105241_10383282 3300009174 Bacteria 1229
126 Ga0105248_10025180 3300009177 Bacteria 6614
127 Ga0105248_10397254 3300009177 Bacteria 1552
128 Ga0105237_10001694 3300009545 Bacteria 28555
129 Ga0105237_10004554 3300009545 Bacteria 16018
130 Ga0105237_10053262 3300009545 Bacteria 4059
131 Ga0105237_10206221 3300009545 Bacteria 1966
132 Ga0105237_10399960 3300009545 Bacteria 1378
133 Ga0105238_10004287 3300009551 Bacteria 14157
134 Ga0105238_10004463 3300009551 Bacteria 13870
135 Ga0105238_10028572 3300009551 Bacteria 5682
136 Ga0105238_10104419 3300009551 Bacteria 2814
137 Ga0105238_10314419 3300009551 Bacteria 1551
138 Ga0105249_10001498 3300009553 Bacteria 20478
139 Ga0099796_10083171 3300010159 Bacteria 1177
140 Ga0105239_10011538 3300010375 Bacteria 9855
141 Ga0105239_10065020 3300010375 Bacteria 4005
142 Ga0105239_10199765 3300010375 Bacteria 2240
143 Ga0105239_10361602 3300010375 Bacteria 1639
144 Ga0157373_10078674 3300013100 Bacteria 2325
145 Ga0157370_10153088 3300013104 Bacteria 2145
146 Ga0157369_10214476 3300013105 Bacteria 2017
147 Ga0157374_10082425 3300013296 Bacteria 3054
148 Ga0157374_10097214 3300013296 Bacteria 2817
149 Ga0157378_10310267 3300013297 Bacteria 1530
150 Ga0163162_10020520 3300013306 Bacteria 6492
151 Ga0163162_10384563 3300013306 Bacteria 1537
152 Ga0157372_10109670 3300013307 Bacteria 3161
153 Ga0157375_10020672 3300013308 Bacteria 6019
154 Ga0157375_10269324 3300013308 Bacteria 1865
155 Ga0157375_10570368 3300013308 Bacteria 1292
156 Ga0163163_10126799 3300014325 Bacteria 2590
157 Ga0157380_10001208 3300014326 Bacteria 16721
158 Ga0157380_10204433 3300014326 Bacteria 1755
159 Ga0157377_10039056 3300014745 Bacteria 2624
160 Ga0157379_10009787 3300014968 Bacteria 8353
161 Ga0157379_10013513 3300014968 Bacteria 7154
162 Ga0157379_10036695 3300014968 Bacteria 4370
163 Ga0157379_10197101 3300014968 Bacteria 1820
164 Ga0157379_10528526 3300014968 Bacteria 1096
165 Ga0157376_10079936 3300014969 Bacteria 2804
166 Ga0163161_10017129 3300017792 Bacteria 5069
167 Ga0213873_10002543 3300021358 Bacteria 3171
168 Ga0213876_10006112 3300021384 Bacteria 6578
169 Ga0213876_10067134 3300021384 Bacteria 1894
170 Ga0209148_1000347 3300025254 Bacteria 60370
171 Ga0209233_1003464 3300025261 Bacteria 5557
172 Ga0209233_1005147 3300025261 Bacteria 4371
173 Ga0209455_1002483 3300025272 Bacteria 7091
174 Ga0209758_1003203 3300025297 Bacteria 15275
175 Ga0209256_1014792 3300025299 Bacteria 2776
176 Ga0207426_1000270 3300025302 Bacteria 108404
177 Ga0207656_10023712 3300025321 Bacteria 2474
178 Ga0207656_10155796 3300025321 Bacteria 1084
179 Ga0207682_10000759 3300025893 Bacteria 14883
180 Ga0207692_10008557 3300025898 Bacteria 4240
181 Ga0207692_10014334 3300025898 Bacteria 3461
182 Ga0207692_10021439 3300025898 Bacteria 2956
183 Ga0207710_10062762 3300025900 Bacteria 1689
184 Ga0207688_10044077 3300025901 Bacteria 2486
185 Ga0207688_10064671 3300025901 Bacteria 2066
186 Ga0207647_10119596 3300025904 Bacteria 1553
187 Ga0207685_10108092 3300025905 Bacteria 1201
188 Ga0207699_10014226 3300025906 Bacteria 4095
189 Ga0207699_10049577 3300025906 Bacteria 2472
190 Ga0207645_10023994 3300025907 Bacteria 3959
191 Ga0207645_10044376 3300025907 Bacteria 2845
192 Ga0207643_10067337 3300025908 Bacteria 2055
193 Ga0207643_10207298 3300025908 Bacteria 1195
194 Ga0207705_10052653 3300025909 Bacteria 2931
195 Ga0207705_10072358 3300025909 Bacteria 2500
196 Ga0207705_10092128 3300025909 Bacteria 2220
197 Ga0207654_10045215 3300025911 Bacteria 2505
198 Ga0207654_10049589 3300025911 Bacteria 2409
199 Ga0207654_10099332 3300025911 Bacteria 1790
200 Ga0207695_10000008 3300025913 Bacteria 1058268
201 Ga0207695_10008824 3300025913 Bacteria 12554
202 Ga0207695_10124795 3300025913 Bacteria 2538
203 Ga0207695_10322858 3300025913 Bacteria 1433
204 Ga0207671_10007506 3300025914 Bacteria 9457
205 Ga0207671_10010103 3300025914 Bacteria 7824
206 Ga0207671_10066695 3300025914 Bacteria 2679
207 Ga0207671_10154511 3300025914 Bacteria 1774
208 Ga0207693_10000683 3300025915 Bacteria 30507
209 Ga0207663_10001947 3300025916 Bacteria 9768
210 Ga0207663_10042784 3300025916 Bacteria 2770
211 Ga0207663_10045486 3300025916 Bacteria 2700
212 Ga0207660_10101298 3300025917 Bacteria 2151
213 Ga0207662_10066120 3300025918 Bacteria 2178
214 Ga0207657_10004384 3300025919 Bacteria 14939
215 Ga0207657_10026159 3300025919 Bacteria 5368
216 Ga0207657_10030571 3300025919 Bacteria 4887
217 Ga0207657_10141002 3300025919 Bacteria 1969
218 Ga0207649_10113007 3300025920 Bacteria 1818
219 Ga0207652_10068746 3300025921 Bacteria 3074
220 Ga0207681_10006914 3300025923 Bacteria 6960
221 Ga0207681_10010182 3300025923 Bacteria 5757
222 Ga0207694_10012939 3300025924 Bacteria 6285
223 Ga0207694_10014250 3300025924 Bacteria 5996
224 Ga0207694_10024599 3300025924 Bacteria 4574
225 Ga0207694_10143346 3300025924 Bacteria 1922
226 Ga0207650_10002442 3300025925 Bacteria 12942
227 Ga0207650_10165995 3300025925 Bacteria 1752
228 Ga0207659_10000135 3300025926 Bacteria 43365
229 Ga0207659_10012550 3300025926 Bacteria 5395
230 Ga0207687_10192296 3300025927 Bacteria 1589
231 Ga0207664_10291567 3300025929 Bacteria 1434
232 Ga0207644_10020254 3300025931 Bacteria 4521
233 Ga0207644_10454550 3300025931 Bacteria 1052
234 Ga0207690_10054941 3300025932 Bacteria 2680
235 Ga0207706_10002883 3300025933 Bacteria 16654
236 Ga0207706_10110757 3300025933 Bacteria 2415
237 Ga0207706_10116533 3300025933 Bacteria 2349
238 Ga0207706_10472640 3300025933 Bacteria 1083
239 Ga0207669_10012119 3300025937 Bacteria 4227
240 Ga0207704_10031670 3300025938 Bacteria 2982
241 Ga0207704_10066234 3300025938 Bacteria 2266
242 Ga0207665_10000339 3300025939 Bacteria 32422
243 Ga0207691_10002113 3300025940 Bacteria 19425
244 Ga0207691_10025132 3300025940 Bacteria 5595
245 Ga0207691_10364215 3300025940 Bacteria 1236
246 Ga0207711_10032396 3300025941 Bacteria 4419
247 Ga0207661_10036834 3300025944 Bacteria 3821
248 Ga0207661_10088109 3300025944 Bacteria 2579
249 Ga0207661_10190172 3300025944 Bacteria 1799
250 Ga0207679_10003707 3300025945 Bacteria 9470
251 Ga0207667_10215284 3300025949 Bacteria 1969
252 Ga0207651_10000647 3300025960 Bacteria 14772
253 Ga0207712_10017129 3300025961 Bacteria 4701
254 Ga0207658_10014926 3300025986 Bacteria 5324
255 Ga0207658_10058472 3300025986 Bacteria 2869
256 Ga0207677_10005607 3300026023 Bacteria 6819
257 Ga0207703_10005700 3300026035 Bacteria 9988
258 Ga0207703_10151611 3300026035 Bacteria 2022
259 Ga0207639_10406187 3300026041 Bacteria 1228
260 Ga0207678_10016124 3300026067 Bacteria 6562
261 Ga0207678_10040249 3300026067 Bacteria 4055
262 Ga0207678_10086017 3300026067 Bacteria 2687
263 Ga0207708_10087740 3300026075 Bacteria 2396
264 Ga0207702_10200973 3300026078 Bacteria 1847
265 Ga0207702_10497536 3300026078 Bacteria 1188
266 Ga0207648_10002879 3300026089 Bacteria 18217
267 Ga0207648_10036193 3300026089 Bacteria 4348
268 Ga0207648_10489998 3300026089 Bacteria 1124
269 Ga0207676_10040495 3300026095 Bacteria 3571
270 Ga0207676_10155254 3300026095 Bacteria 1976
271 Ga0207676_10158341 3300026095 Bacteria 1959
272 Ga0207674_10078524 3300026116 Bacteria 3306
273 Ga0207674_10139575 3300026116 Bacteria 2384
274 Ga0207674_10303432 3300026116 Bacteria 1546
275 Ga0207698_10004390 3300026142 Bacteria 8592
276 Ga0207698_10059392 3300026142 Bacteria 2969
277 Ga0207698_10305421 3300026142 Bacteria 1483
278 Ga0209389_1000001 3300027296 Bacteria 463799
279 Ga0209589_1000011 3300027357 Bacteria 236981
280 Ga0209489_100012 3300027361 Bacteria 236981
281 Ga0209489_102213 3300027361 Bacteria 39761
282 Ga0209700_100007 3300027363 Bacteria 454608
283 Ga0209700_100019 3300027363 Bacteria 236981
284 Ga0268266_10060289 3300028379 Bacteria 3271
285 Ga0268264_10337985 3300028381 Bacteria 1429
286 Ga0268264_10342113 3300028381 Bacteria 1421
287 Ga0307511_10114407 3300030521 Bacteria 1700
288 Ga0265339_10053306 3300031249 Bacteria 2200
289 Ga0307508_10000015 3300031616 Bacteria 210182
290 Ga0265342_10007168 3300031712 Bacteria 8206
291 Ga0307410_10005624 3300031852 Bacteria 6661
292 Ga0307410_10210576 3300031852 Bacteria 1489
293 Ga0307406_10003804 3300031901 Bacteria 8218
294 Ga0307407_10031383 3300031903 Bacteria 2877
295 Ga0307412_10435276 3300031911 Bacteria 1076
296 Ga0307416_100002779 3300032002 Bacteria 10165
297 Ga0307416_100003421 3300032002 Bacteria 9318
298 Ga0307411_10039581 3300032005 Bacteria 2983
299 Ga0307415_100104199 3300032126 Bacteria 2089
300 Ga0307507_10006824 3300033179 Bacteria 17074
301 Ga0307510_10037374 3300033180 Bacteria 5387
302 Ga0307510_10055134 3300033180 Bacteria 4154
303 Ga0307510_10096620 3300033180 Bacteria 2769
304 Ga0315911_1000002 3300033442 Bacteria 926833
305 Ga0316215_1002146 3300033544 Bacteria 1864
306 Ga0373945_0107247 3300035116 Bacteria 1099
307 Ga0373953_0035797 3300035117 Bacteria 1952
308 Ga0373957_0013071 3300035120 Bacteria 2809
309 Ga0373957_0077728 3300035120 Bacteria 1306
310 Ga0373955_0072253 3300035172 Bacteria 1932
311 Ga0373962_0008156 3300035242 Bacteria 2573
312 Ga0316574_0000847 3300035398 Bacteria 13411
313 Ga0373924_0033008 3300035410 Bacteria 2087
314 Ga0373931_0011120 3300035691 Bacteria 4340
315 Ga0373931_0132514 3300035691 Bacteria 1436
316 Ga0373935_0055887 3300035692 Bacteria 2515
317 Ga0373927_0027113 3300035695 Bacteria 3743
318 Ga0373947_0007716 3300035725 Bacteria 6220
319 Ga0373937_0100979 3300036401 Bacteria 2677
320 Ga0373925_0022318 3300037068 Bacteria 4617
321 Ga0373925_0072696 3300037068 Bacteria 2602
322 Ga0395900_0201794 3300037418 Bacteria 2012
323 Ga0395898_0105086 3300037466 Bacteria 2708
324 Ga0436364_1074833 3300037853 Bacteria 5387
325 Ga0395901_0410324 3300038443 Bacteria 1391
326 Ga0237816_02524 3300039145 Bacteria 1394
327 Ga0436365_0496646 3300039437 Bacteria 6540
328 Ga0436365_1276870 3300039437 Bacteria 8067
329 Ga0436363_1359162 3300039450 Bacteria 2778
330 Ga0436362_0966777 3300039453 Bacteria 3926
331 Ga0466969_0042525 3300044656 Bacteria 2268
332 Ga0466972_0000134 3300044658 Bacteria 61802
333 Ga0466965_0032173 3300044683 Bacteria 2562
334 Ga0466966_0061017 3300044684 Bacteria 2379
335 Ga0466963_0179628 3300044694 Bacteria 1477
336 Ga0466957_0059293 3300044842 Bacteria 2346
337 Ga0466960_0037434 3300044901 Bacteria 2276
338 Ga0466959_0033350 3300045049 Bacteria 3808
339 Ga0466967_0184717 3300045976 Bacteria 1968
340 Ga0466967_0377309 3300045976 Bacteria 1376
341 Ga0495592_0024435 3300046454 Bacteria 4594
342 Ga0495592_0190651 3300046454 Bacteria 1390
343 Ga0495603_0025442 3300046455 Bacteria 3580
344 Ga0495603_0028282 3300046455 Bacteria 3381
345 Ga0495629_0007286 3300046459 Bacteria 8148
346 Ga0495638_0047278 3300046460 Bacteria 2698
347 Ga0495651_0004240 3300046462 Bacteria 10992
348 Ga0495651_0098201 3300046462 Bacteria 2186
349 Ga0495651_0100648 3300046462 Bacteria 2152
350 Ga0495653_0064213 3300046463 Bacteria 2767
351 Ga0495664_0015208 3300046477 Bacteria 4372
352 Ga0495664_0055337 3300046477 Bacteria 2361
353 Ga0495608_0030206 3300046511 Bacteria 3671
354 Ga0495618_0057476 3300046514 Bacteria 2463
355 Ga0495618_0096450 3300046514 Bacteria 1891
356 Ga0495628_0055591 3300046516 Bacteria 3117
357 Ga0495628_0235997 3300046516 Bacteria 1369
358 Ga0495630_0052973 3300046517 Bacteria 3038
359 Ga0495643_0008377 3300046522 Bacteria 6554
360 Ga0495644_0063291 3300046523 Bacteria 1390
361 Ga0495648_0004316 3300046524 Bacteria 12181
362 Ga0495648_0075860 3300046524 Bacteria 1932
363 Ga0495652_0000938 3300046529 Bacteria 33434
364 Ga0495652_0025055 3300046529 Bacteria 5279
365 Ga0495640_0007993 3300046533 Bacteria 8313
366 Ga0495640_0036648 3300046533 Bacteria 3464
367 Ga0495640_0135972 3300046533 Bacteria 1587
368 Ga0495587_0051821 3300046536 Bacteria 2424
369 Ga0495645_0041434 3300046543 Bacteria 3358
370 Ga0495645_0052596 3300046543 Bacteria 2962
371 Ga0495645_0156327 3300046543 Bacteria 1579
372 Ga0495622_0051205 3300046557 Bacteria 1915
373 Ga0495622_0127491 3300046557 Bacteria 1160
374 Ga0495667_0031082 3300046559 Bacteria 3585
375 Ga0495667_0031460 3300046559 Bacteria 3562
376 Ga0495634_0080979 3300046642 Bacteria 2124
377 Ga0495635_0005160 3300046663 Bacteria 9092
378 Ga0495635_0111434 3300046663 Bacteria 1869
379 Ga0495657_0008941 3300046675 Bacteria 7622
380 Ga0495657_0018176 3300046675 Bacteria 5093
381 Ga0495599_0047674 3300046678 Bacteria 2685
382 Ga0495599_0171615 3300046678 Bacteria 1338
383 Ga0495646_0053536 3300046680 Bacteria 2433
384 Ga0495646_0065458 3300046680 Bacteria 2152
385 Ga0495658_0031727 3300046683 Bacteria 2879
386 Ga0495613_0218574 3300046689 Bacteria 1338
387 Ga0495624_0017354 3300046690 Bacteria 4834
388 Ga0495649_0105856 3300046694 Bacteria 1493
389 Ga0495600_0050226 3300046809 Bacteria 2721
390 Ga0495600_0061677 3300046809 Bacteria 2449
391 Ga0495600_0256848 3300046809 Bacteria 1110
392 Ga0495581_0136633 3300047315 Bacteria 1429
393 Ga0495604_0003325 3300047317 Bacteria 12811
394 Ga0495604_0033572 3300047317 Bacteria 4061
395 Ga0495674_0036465 3300047319 Bacteria 4425
396 Ga0495674_0079109 3300047319 Bacteria 2824
397 Ga0495674_0422590 3300047319 Bacteria 1074
398 Ga0495672_0174664 3300047320 Bacteria 1092
399 Ga0495680_0007102 3300047322 Bacteria 10313
400 Ga0495675_0011426 3300047444 Bacteria 5574
401 Ga0495684_0024756 3300047471 Bacteria 4616
402 Ga0495684_0052157 3300047471 Bacteria 3121
403 Ga0495686_0041367 3300047472 Bacteria 2935
404 Ga0495602_0016046 3300048088 Bacteria 7539
405 Ga0495602_0053918 3300048088 Bacteria 3556
406 Ga0495614_0007563 3300048089 Bacteria 4835
407 Ga0496100_0028657 3300048903 Bacteria 3436
408 Ga0496100_0128972 3300048903 Bacteria 1779
409 Ga0496101_0004214 3300048904 Bacteria 9009
410 Ga0496101_0058748 3300048904 Bacteria 2786
411 Ga0496101_0061665 3300048904 Bacteria 2724
412 Ga0496102_0006143 3300048905 Bacteria 10237
413 Ga0496102_0072396 3300048905 Bacteria 3167
414 Ga0496102_0097001 3300048905 Bacteria 2734
415 Ga0496102_0119146 3300048905 Bacteria 2464
416 Ga0496102_0132063 3300048905 Bacteria 2338
417 Ga0496103_0062146 3300048906 Bacteria 2324
418 Ga0496104_0018203 3300048907 Bacteria 6407
419 Ga0496104_0428269 3300048907 Bacteria 1235
420 Ga0496105_0005595 3300048908 Bacteria 9552
421 Ga0496105_0092877 3300048908 Bacteria 2491
422 Ga0496105_0213215 3300048908 Bacteria 1573
423 Ga0496106_0048620 3300048909 Bacteria 3194
424 Ga0496106_0050208 3300048909 Bacteria 3144
425 Ga0496106_0057918 3300048909 Bacteria 2931
426 Ga0496107_0002113 3300048910 Bacteria 12728
427 Ga0496107_0007328 3300048910 Bacteria 7605
428 Ga0496107_0046023 3300048910 Bacteria 3140
429 Ga0496107_0109796 3300048910 Bacteria 2026
430 Ga0496108_0071294 3300048911 Bacteria 2931
431 Ga0496108_0348436 3300048911 Bacteria 1292
432 Ga0496108_0447246 3300048911 Bacteria 1129
433 Ga0496109_0063257 3300048912 Bacteria 3384
434 Ga0496109_0438307 3300048912 Bacteria 1234
435 Ga0496110_0205416 3300048913 Bacteria 1790
436 Ga0496111_0033737 3300048914 Bacteria 3652
437 Ga0496112_0000044 3300048915 Bacteria 86865
438 Ga0496112_0015095 3300048915 Bacteria 7195
439 Ga0496112_0018080 3300048915 Bacteria 6633
440 Ga0496112_0139350 3300048915 Bacteria 2395
441 Ga0496113_0051531 3300048916 Bacteria 3072
442 Ga0496114_0072007 3300048917 Bacteria 2906
443 Ga0496114_0075757 3300048917 Bacteria 2834
444 Ga0496114_0156020 3300048917 Bacteria 1982
445 Ga0496114_0320533 3300048917 Bacteria 1369
446 Ga0496115_0004269 3300048918 Bacteria 10342
447 Ga0496115_0067760 3300048918 Bacteria 2888
448 Ga0496115_0175726 3300048918 Bacteria 1771
449 Ga0496115_0255204 3300048918 Bacteria 1443
450 Ga0496115_0321083 3300048918 Bacteria 1266
451 Ga0496117_0067801 3300048920 Bacteria 2412
452 Ga0496117_0118927 3300048920 Bacteria 1628
453 Ga0496118_0003016 3300048921 Bacteria 21744
454 Ga0496118_0119224 3300048921 Bacteria 1726
455 Ga0496118_0188289 3300048921 Bacteria 1237
456 Ga0496120_0010703 3300048923 Bacteria 6367
457 Ga0496121_0000041 3300048924 Bacteria 346686
458 Ga0496121_0011806 3300048924 Bacteria 9625
459 Ga0496121_0071824 3300048924 Bacteria 2782
460 Ga0496122_0071759 3300048925 Bacteria 2466
461 Ga0496124_0006721 3300048927 Bacteria 12444
462 Ga0496125_0000712 3300048928 Bacteria 54983
463 Ga0496125_0104374 3300048928 Bacteria 2076
464 Ga0496126_0032037 3300048929 Bacteria 4958
465 Ga0496126_0049685 3300048929 Bacteria 3827
466 Ga0496126_0053820 3300048929 Bacteria 3649
467 Ga0496126_0070101 3300048929 Bacteria 3124
468 Ga0496126_0208115 3300048929 Bacteria 1648
469 Ga0496126_0232309 3300048929 Bacteria 1545
470 Ga0496126_0369665 3300048929 Bacteria 1169
471 Ga0495682_0078011 3300049460 Bacteria 1191
472 Ga0501031_0000652 3300049568 Bacteria 20544
473 Ga0501032_0002299 3300049569 Bacteria 14998
474 Ga0501032_0036945 3300049569 Bacteria 3333
475 Ga0501033_0000091 3300049570 Bacteria 85666
476 Ga0501034_0000039 3300049571 Bacteria 237357
477 Ga0501034_0636407 3300049571 Bacteria 969
478 Ga0501036_0000052 3300049572 Bacteria 74795
479 Ga0501037_0000025 3300049573 Bacteria 143276
480 Ga0501038_0002924 3300049574 Bacteria 15925
481 Ga0501038_0211707 3300049574 Bacteria 1550
482 Ga0501039_0000719 3300049575 Bacteria 23853
483 Ga0501043_0000928 3300049579 Bacteria 25941
484 Ga0501046_0000231 3300049580 Bacteria 57655
485 Ga0501046_0075551 3300049580 Bacteria 2612
486 Ga0501047_0000457 3300049581 Bacteria 45136
487 Ga0501047_0024108 3300049581 Bacteria 5844
488 Ga0501048_0000218 3300049582 Bacteria 37734
489 Ga0501067_0003111 3300049583 Bacteria 9160
490 Ga0501067_0021251 3300049583 Bacteria 3591
491 Ga0501068_0001352 3300049584 Bacteria 12996
492 Ga0501070_0002829 3300049586 Bacteria 15142
493 Ga0501071_0026801 3300049587 Bacteria 4049
494 Ga0501072_0004469 3300049588 Bacteria 10621
495 Ga0501073_0000877 3300049589 Bacteria 21517
496 Ga0501074_0000273 3300049590 Bacteria 29590
497 Ga0501079_0011695 3300049741 Bacteria 6704
498 Ga0501080_0000124 3300049742 Bacteria 54519
499 Ga0501083_0000785 3300049744 Bacteria 20828
500 Ga0501035_0000052 3300049822 Bacteria 143038
501 Ga0501035_0135984 3300049822 Bacteria 2140
502 Ga0501044_0000217 3300049823 Bacteria 73242
503 Ga0501044_0100080 3300049823 Bacteria 2917
504 Ga0501045_0010874 3300049824 Bacteria 6378
505 nmdc:mga00v17_143506_c1 3300050491 Bacteria 1532
506 nmdc:mga0yw44_198777_c1 3300050492 Bacteria 1324
507 nmdc:mga0yw44_35390_c1 3300050492 Bacteria 2934
508 nmdc:mga0k408_45179_c1 3300050493 Bacteria 2541
509 nmdc:mga07m45_51757_c1 3300050496 Bacteria 2317
510 nmdc:mga0sz30_48771_c1 3300050516 Bacteria 1793
511 Ga0495601_0199096 3300053077 Bacteria 1309
512 Ga0500635_0017688 3300053080 Bacteria 2140
513 Ga0500635_0020322 3300053080 Bacteria 2033
514 Ga0495595_0151629 3300053084 Bacteria 1141
515 Ga0495619_0019088 3300053085 Bacteria 4356
516 Ga0495619_0181079 3300053085 Bacteria 1458
517 Ga0500643_000069 3300053087 Bacteria 116366
518 Ga0500644_0003960 3300053088 Bacteria 3686
519 Ga0500566_0000608 3300053094 Bacteria 20128
520 Ga0500566_0032348 3300053094 Bacteria 3050
521 Ga0500566_0043837 3300053094 Bacteria 2577
522 Ga0500650_0055084 3300053098 Bacteria 1852
523 Ga0500554_000716 3300053102 Bacteria 6725
524 Ga0500555_009231 3300053103 Bacteria 2820
525 Ga0500556_0004962 3300053104 Bacteria 3765
526 Ga0500557_000003 3300053105 Bacteria 228429
527 Ga0500569_014459 3300053109 Bacteria 1954
528 Ga0500595_000200 3300053119 Bacteria 40977
529 Ga0500595_009172 3300053119 Bacteria 4005
530 Ga0500642_0000051 3300053130 Bacteria 77123
531 Ga0500642_0011959 3300053130 Bacteria 3128
532 Ga0500568_0010968 3300053139 Bacteria 4224
533 Ga0500568_0017137 3300053139 Bacteria 3204
534 Ga0500577_0033509 3300053142 Bacteria 1816
535 Ga0500589_035950 3300053147 Bacteria 2313
536 Ga0500603_000240 3300053150 Bacteria 14346
537 Ga0500603_067225 3300053150 Bacteria 1014
538 Ga0500604_0023161 3300053151 Bacteria 1770
539 Ga0500622_0008815 3300053156 Bacteria 5614
540 Ga0500638_000785 3300053162 Bacteria 8718
541 Ga0500636_0000166 3300053177 Bacteria 34574
542 Ga0500637_0000144 3300053178 Bacteria 26094
543 Ga0500576_028192 3300053725 Bacteria 2559
544 Ga0500625_003024 3300053729 Bacteria 6512
545 Ga0500609_002156 3300053731 Bacteria 2819
546 Ga0500552_000771 3300053733 Bacteria 2987
547 Ga0500596_001440 3300053735 Bacteria 4811
548 Ga0500599_000151 3300053736 Bacteria 6301
549 Ga0501084_0000683 3300054114 Bacteria 25896
550 Ga0501082_0007986 3300060353 Bacteria 9137
551 Ga0466962_0045345 3300061719 Bacteria 2102
552 Ga0466962_0065872 3300061719 Bacteria 1730
553 2507507596 2507262055 Bacteria 8048963
554 2508541715 2508501009 Bacteria 7784016
555 2508692743 2508501042 Bacteria 8719808
556 2509152987 2508501128 Bacteria 8613869
557 2511397091 2511231028 Bacteria 8046582
558 2513621797 2513237092 Bacteria 8341956
559 2513636760 2513237094 Bacteria 8789602
560 2513647581 2513237095 Bacteria 8976980
561 2513654154 2513237096 Bacteria 8722461
562 2513674841 2513237098 Bacteria 9902361
563 2513697094 2513237101 Bacteria 7952346
564 2513701382 2513237102 Bacteria 7703324
565 2513721226 2513237104 Bacteria 10034502
566 2513856909 2513237137 Bacteria 9558895
567 2513878709 2513237139 Bacteria 8737671
568 2513918494 2513237145 Bacteria 8979722
569 2514009363 2513237161 Bacteria 8871253
570 2515626140 2515154112 Bacteria 8294334
571 2517104225 2517093001 Bacteria 9002274
572 2517891271 2517572143 Bacteria 9484767
573 2524436213 2524023205 Bacteria 8918781
574 2524468220 2524023210 Bacteria 9029266
575 2524533524 2524023228 Bacteria 10118060
576 2528848913 2528768022 Bacteria 10457665
577 2617346864 2617270735 Bacteria 9163226
578 2617372795 2617270741 Bacteria 8201522
579 2644291325 2643221651 Bacteria 4798932
580 2671123801 2667528175 Bacteria 7532676
581 2723843626 2721755755 Bacteria 8322773
582 2728749968 2728368998 Bacteria 8720350
583 2745080831 2744054633 Bacteria 8678936
584 2793060941 2791355196 Bacteria 7323613
585 2793066634 2791355197 Bacteria 8420563
586 2793083853
587 2805921358 2802429603 Bacteria 8777136
588 2818236618 2816332527 Bacteria 8933356
589 2824605198 2824600985 Bacteria 8488197
590 2824615517 2824609381 Bacteria 8672835
591 2824620486 2824617872 Bacteria 8814715
592 2824628466 2824626560 Bacteria 8813858
593 2824637166 2824635225 Bacteria 8785348
594 2824645911 2824644064 Bacteria 8743947
595 2824656404 2824653114 Bacteria 8493680
596 2824666194 2824661429 Bacteria 9877870
597 2824673704 2824671348 Bacteria 8369588
598 2824681761 2824679649 Bacteria 8248951
599 2824690671 2824687955 Bacteria 8360029
600 2824709824 2824704595 Bacteria 9667483
601 2824716578 2824714736 Bacteria 8717648
602 2824725559 2824723954 Bacteria 8758240
603 2824736080 2824732956 Bacteria 7810675
604 2824748798 2824746037 Bacteria 7911610
605 2824756048 2824753945 Bacteria 9787441
606 2824767586 2824763712 Bacteria 9792355
607 2824775059 2824773399 Bacteria 8360218
608 2838129286 2838122688 Bacteria 8803140
609 2841948058 2841941048 Bacteria 8688029
610 2841953545 2841949485 Bacteria 8680857
611 2841962857 2841957949 Bacteria 8652217
612 2841973050 2841966195 Bacteria 8673214
613 2841978273 2841974524 Bacteria 8931498
614 2841990492 2841983080 Bacteria 8395090
615 2842040716 2842038055 Bacteria 8002051
616 2842046338 2842045827 Bacteria 8006841
617 2844320094 2844315083 Bacteria 8138177
618 2847937387 2847930680 Bacteria 9342022
619 2847947812 2847939898 Bacteria 8606328
620 2849078330 2849076700 Bacteria 7039503
621 2857512710 2857509624 Bacteria 7472071
622 2874598712 2874590934 Bacteria 8299676
623 2874607162 2874604998 Bacteria 7834745
624 2874614505 2874612657 Bacteria 8252029
625 2874628144 2874620515 Bacteria 8290088
626 2874634940 2874628541 Bacteria 8630250
627 2874652167 2874645413 Bacteria 8214782
628 2876768154 2876761206 Bacteria 10111113
629 2876778751 2876771140 Bacteria 8287509
630 2876824354 2876818435 Bacteria 8274608
631 2879082544 2879074833 Bacteria 8279565
632 2879086688 2879083081 Bacteria 8587928
633 2879107777 2879099564 Bacteria 10442239
634 2879114049 2879110137 Bacteria 8907982
635 2879131461 2879127579 Bacteria 8294491
636 2879147907 2879142872 Bacteria 8267021
637 2881371396 2881364244 Bacteria 7710352
638 2881666650 2881665667 Bacteria 8175609
639 2885370031 2885366525 Bacteria 8326213
640 2885376582 2885374607 Bacteria 8927485
641 2885415667 2885409591 Bacteria 9235467
642 2888385518 2888378607 Bacteria 9652610
643 2888392712 2888388044 Bacteria 7304136
644 2888425650 2888419890 Bacteria 7857137
645 2889037948 2889033259 Bacteria 9099371
646 2903730232 2903727486 Bacteria 8281579
647 2903757683 2903748898 Bacteria 9972761
648 2904674238 2904666416 Bacteria 8226587
649 2904694201 2904690495 Bacteria 9412302
650 2904701194
651 2904711907 2904711408 Bacteria 9771557
652 2906609919 2906602504 Bacteria 8295279
653 2906616455
654 2906627660 2906626472 Bacteria 8826946
655 2906640011 2906635258 Bacteria 8601019
656 2906647358 2906643746 Bacteria 8722424
657 2906662951 2906660503 Bacteria 8595048
658 2908741609 2908739725 Bacteria 8628932
659 2908759227 2908756301 Bacteria 8864324
660 2908781239 2908775508 Bacteria 8092255
661 2922361886 2922361189 Bacteria 7436256
662 2922372338
663 2922386881 2922386360 Bacteria 7017218
664 2922397012 2922393267 Bacteria 8285685
665 2922431529
666 2929621091 2929615660 Bacteria 9193770
667 2929626078 2929624759 Bacteria 9339455
668 2932785048 2932784394 Bacteria 9704911
669 2932795087 2932794094 Bacteria 7915132
670 2932805615 2932801729 Bacteria 7987968
671 2932810076 2932809354 Bacteria 9135765
672 2932821650 2932818245 Bacteria 9955613
673 2932828884 2932828146 Bacteria 9745859
674 2933583039 2933577622 Bacteria 9116884
675 2935609896 2935608549 Bacteria 8203142
676 2935619696 2935616580 Bacteria 9032984
677 2935636168 2935630451 Bacteria 8169952
678 2935638676 2935638405 Bacteria 10015038
679 2935652074 2935648319 Bacteria 8801166
680 2935659953 2935656913 Bacteria 8965014
681 2935666472 2935665750 Bacteria 9571747
682 2935676485 2935675223 Bacteria 9928132
683 2935690999 2935684952 Bacteria 9590419
684 2935694567 2935694250 Bacteria 9291695
685 2935703682 2935703347 Bacteria 10242284
686 2935718380 2935713505 Bacteria 9608509
687 2935727640 2935722832 Bacteria 9608746
688 2935736343 2935732158 Bacteria 9706831
689 2935745723 2935741537 Bacteria 9707219
690 2935756104 2935750917 Bacteria 9590372
691 2935760636 2935760218 Bacteria 9817913
692 2935776055 2935769743 Bacteria 7878163
693 2935783487 2935777560 Bacteria 8077691
694 2935791932 2935785616 Bacteria 7962367
695 2935800258 2935793552 Bacteria 8012592
696 2935801820 2935801545 Bacteria 9301974
697 2935814765 2935810662 Bacteria 9401221
698 2935823056 2935819856 Bacteria 8261050
699 2935828170 2935827899 Bacteria 10038562
700 2935842375 2935837841 Bacteria 9454360
701 2935848638 2935847175 Bacteria 8228321
702 2935857989 2935855204 Bacteria 9035059
703 2935867893 2935864058 Bacteria 9784707
704 2935874083 2935873716 Bacteria 9632195
705 2935885815 2935883170 Bacteria 7964738
706 2935909556 2935908558 Bacteria 8568796
707 2935917281 2935916978 Bacteria 9113783
708 2935927037 2935926038 Bacteria 8601059
709 2935937119 2935934488 Bacteria 8602579
710 2935944578 2935942939 Bacteria 8599779
711 2935953015 2935951376 Bacteria 8602333
712 2935962783 2935959822 Bacteria 7869783
713 2935969855 2935967501 Bacteria 8603075
714 2935976452 2935975950 Bacteria 8347125
715 2935987098 2935984226 Bacteria 8302647
716 2935992992 2935992306 Bacteria 9802711
717 2936002904 2936002035 Bacteria 9362176
718 2936014369 2936011229 Bacteria 8801034
719 2936023791 2936019824 Bacteria 8804134
720 2936031434 2936028420 Bacteria 8965941
721 2936040592 2936037263 Bacteria 9446081
722 2936049475 2936046547 Bacteria 8903709
723 2936062225 2936055302 Bacteria 8785755
724 2940561921 2940556831 Bacteria 9590747
725 2941512799 2941507105 Bacteria 8166816
726 2941520634 2941515067 Bacteria 8166720
727 2941528648 2941523033 Bacteria 8169134
728 2941531276 2941531003 Bacteria 7653939
729 2941542424 2941538514 Bacteria 9402094
730 3005481323 3005474847 Bacteria 9259049
731 3005485468 3005483717 Bacteria 7877331
732 3005508373 3005506211 Bacteria 6943378
733 3005588127 3005587118 Bacteria 7794411
734 3005600380 3005594810 Bacteria 8716512
735 3005715674 3005710791 Bacteria 7622528
736 3005715872 3005710791 Bacteria 7622528
737 3005723229 3005718088 Bacteria 8283608
738 8006930103 8006926726 Bacteria 6749210
739 8006939387 8006933436 Bacteria 10410654
740 8006968821 8006964411 Bacteria 8966052
741 8006979042 8006973647 Bacteria 10679141
742 8006984500 8006984368 Bacteria 9651211
743 8007000961 8006994254 Bacteria 8309700
744 8016520582 8016511872 Bacteria 9921665
745 8016528618 8016522445 Bacteria 8156687
746 8016533788 8016530956 Bacteria 8155261
747 8016547006 8016539877 Bacteria 8155419
748 8016555105 8016548790 Bacteria 8155074
749 8016563470 8016557553 Bacteria 8154380
750 8016572124 8016566248 Bacteria 8158151
751 8016576322 8016575299 Bacteria 8154085
752 8016594428 8016583857 Bacteria 10421953
753 8016601217 8016595262 Bacteria 8149947
754 8016609221 8016603502 Bacteria 8731218
755 8016615682 8016613128 Bacteria 8794220
756 8016625543 8016622563 Bacteria 7999408
757 8016639102 8016630954 Bacteria 9217207
758 8017064996 8017057580 Bacteria 10023680
759 8019533564 8019530166 Bacteria 8155624
760 8019546106 8019538911 Bacteria 7872763
761 8019552600 8019547302 Bacteria 7996444
762 8019565257 8019555841 Bacteria 9642137
763 8019575361 8019565922 Bacteria 9639779
764 8019584374 8019576017 Bacteria 10049540
765 8019592145 8019586578 Bacteria 10212056
766 8019599136 8019597564 Bacteria 10041141
767 8019619882 8019619141 Bacteria 9218857
768 8019633235 8019629233 Bacteria 8687553
769 8019646664 8019638758 Bacteria 9062356
770 8019661104 8019659431 Bacteria 8577854
771 8019670662 8019668869 Bacteria 8791617
772 8019685569 8019678201 Bacteria 8863603
773 8019691138 8019687851 Bacteria 8712826
774 8055745046 8055742211 Bacteria 9226248
775 8056677483 8056673599 Bacteria 7871253
776 8056690725 8056689827 Bacteria 6712655
777 8056975000 8056967851 Bacteria 9038162
778 Ga0373927_0044698
779 JGI25406J46586_10000223
780 JGI25160J50197_1002236
781 Ga0055543_1003779
782 Ga0065165_1001214
783 Ga0070658_10005755
784 Ga0070658_10029138
785 Ga0070676_10068276
786 Ga0070676_10129692
787 Ga0070683_100007952
788 Ga0070683_100196995
789 Ga0070670_100037139
790 Ga0070670_100131214
791 Ga0070677_10002920
792 Ga0070682_100127813
793 Ga0068868_100021088
794 Ga0068868_100118279
795 Ga0070660_100085153
796 Ga0070660_100094301
797 Ga0070660_100118218
798 Ga0070689_100250614
799 Ga0070661_100004144
800 Ga0070668_100098454
801 Ga0070668_100104450
802 Ga0070669_100037552
803 Ga0070669_100182244
804 Ga0070675_100008566
805 Ga0070671_100191918
806 Ga0070674_100000518
807 Ga0070674_100003318
808 Ga0070674_100058937
809 Ga0070673_100064373
810 Ga0070659_100033568
811 Ga0070659_100227289
812 Ga0070667_100007713
813 Ga0070709_10013391
814 Ga0070709_10027137
815 Ga0070709_10039448
816 Ga0070714_100007489
817 Ga0070714_100022201
818 Ga0070713_100001931
819 Ga0070710_10000550
820 Ga0070710_10011800
821 Ga0070710_10012215
822 Ga0070711_100073365
823 Ga0070711_100239395
824 Ga0070663_100015643
825 Ga0070663_100028451
826 Ga0070678_100003918
827 Ga0070678_100141068
828 Ga0070678_100162088
829 Ga0070662_100352827
830 Ga0070662_100437376
831 Ga0068867_100004484
832 Ga0070679_100037472
833 Ga0070679_100134648
834 Ga0070684_100002660
835 Ga0070684_100037881
836 Ga0070684_100185011
837 Ga0068853_100130206
838 Ga0070672_100000150
839 Ga0070672_100026924
840 Ga0070686_100163559
841 Ga0070693_100053632
842 Ga0070665_100028020
843 Ga0070665_100095325
844 Ga0068855_100215006
845 Ga0070664_100020769
846 Ga0068857_100063575
847 Ga0068857_100175773
848 Ga0068854_100001586
849 Ga0068854_100033855
850 Ga0068856_100002765
851 Ga0068856_100288187
852 Ga0068852_100004505
853 Ga0068852_100012408
854 Ga0068852_100015875
855 Ga0068852_100343918
856 Ga0068864_100125965
857 Ga0068864_100280962
858 Ga0068864_100517715
859 Ga0068861_100007671
860 Ga0068870_10064238
861 Ga0068863_100019290
862 Ga0068863_100354582
863 Ga0068858_100006988
864 Ga0068860_100064651
865 Ga0068860_100090365
866 Ga0068862_100080734
867 Ga0081455_10004053
868 Ga0081538_10050154
869 Ga0081540_1007980
870 Ga0081540_1019127
871 Ga0081539_10000325
872 Ga0070717_10009249
873 Ga0070717_10010145
874 Ga0070717_10044803
875 Ga0075365_10011349
876 Ga0075365_10068872
877 Ga0075363_100003003
878 Ga0075364_10019699
879 Ga0075364_10041354
880 Ga0075364_10125101
881 Ga0070715_10000126
882 Ga0070716_100005825
883 Ga0070712_100012143
884 Ga0075362_10055660
885 Ga0075367_10043437
886 Ga0075366_10089319
887 Ga0075370_10165354
888 Ga0068871_100019118
889 Ga0068865_100097434
890 Ga0099824_1006123
891 Ga0099822_1000072
892 Ga0105240_10003278
893 Ga0105240_10017290
894 Ga0105240_10058231
895 Ga0105240_10593043
896 Ga0105245_10015073
897 Ga0105245_10047099
898 Ga0105245_10082016
899 Ga0105247_10087830
900 Ga0105243_10096912
901 Ga0105241_10016146
902 Ga0105241_10383282
903 Ga0105248_10025180
904 Ga0105248_10397254
905 Ga0105237_10001694
906 Ga0105237_10004554
907 Ga0105237_10053262
908 Ga0105237_10206221
909 Ga0105237_10399960
910 Ga0105238_10004287
911 Ga0105238_10004463
912 Ga0105238_10028572
913 Ga0105238_10104419
914 Ga0105238_10314419
915 Ga0105249_10001498
916 Ga0099796_10083171
917 Ga0105239_10011538
918 Ga0105239_10065020
919 Ga0105239_10199765
920 Ga0105239_10361602
921 Ga0157373_10078674
922 Ga0157370_10153088
923 Ga0157369_10214476
924 Ga0157374_10082425
925 Ga0157374_10097214
926 Ga0157378_10310267
927 Ga0163162_10020520
928 Ga0163162_10384563
929 Ga0157372_10109670
930 Ga0157375_10020672
931 Ga0157375_10269324
932 Ga0157375_10570368
933 Ga0163163_10126799
934 Ga0157380_10001208
935 Ga0157380_10204433
936 Ga0157377_10039056
937 Ga0157379_10009787
938 Ga0157379_10013513
939 Ga0157379_10036695
940 Ga0157379_10197101
941 Ga0157379_10528526
942 Ga0157376_10079936
943 Ga0163161_10017129
944 Ga0213873_10002543
945 Ga0213876_10006112
946 Ga0213876_10067134
947 Ga0209148_1000347
948 Ga0209233_1003464
949 Ga0209233_1005147
950 Ga0209455_1002483
951 Ga0209758_1003203
952 Ga0209256_1014792
953 Ga0207426_1000270
954 Ga0207656_10023712
955 Ga0207656_10155796
956 Ga0207682_10000759
957 Ga0207692_10008557
958 Ga0207692_10014334
959 Ga0207692_10021439
960 Ga0207710_10062762
961 Ga0207688_10044077
962 Ga0207688_10064671
963 Ga0207647_10119596
964 Ga0207685_10108092
965 Ga0207699_10014226
966 Ga0207699_10049577
967 Ga0207645_10023994
968 Ga0207645_10044376
969 Ga0207643_10067337
970 Ga0207643_10207298
971 Ga0207705_10052653
972 Ga0207705_10072358
973 Ga0207705_10092128
974 Ga0207654_10045215
975 Ga0207654_10049589
976 Ga0207654_10099332
977 Ga0207695_10000008
978 Ga0207695_10008824
979 Ga0207695_10124795
980 Ga0207695_10322858
981 Ga0207671_10007506
982 Ga0207671_10010103
983 Ga0207671_10066695
984 Ga0207671_10154511
985 Ga0207693_10000683
986 Ga0207663_10001947
987 Ga0207663_10042784
988 Ga0207663_10045486
989 Ga0207660_10101298
990 Ga0207662_10066120
991 Ga0207657_10004384
992 Ga0207657_10026159
993 Ga0207657_10030571
994 Ga0207657_10141002
995 Ga0207649_10113007
996 Ga0207652_10068746
997 Ga0207681_10006914
998 Ga0207681_10010182
999 Ga0207694_10012939
1000 Ga0207694_10014250
1001 Ga0207694_10024599
1002 Ga0207694_10143346
1003 Ga0207650_10002442
1004 Ga0207650_10165995
1005 Ga0207659_10000135
1006 Ga0207659_10012550
1007 Ga0207687_10192296
1008 Ga0207664_10291567
1009 Ga0207644_10020254
1010 Ga0207644_10454550
1011 Ga0207690_10054941
1012 Ga0207706_10002883
1013 Ga0207706_10110757
1014 Ga0207706_10116533
1015 Ga0207706_10472640
1016 Ga0207669_10012119
1017 Ga0207704_10031670
1018 Ga0207704_10066234
1019 Ga0207665_10000339
1020 Ga0207691_10002113
1021 Ga0207691_10025132
1022 Ga0207691_10364215
1023 Ga0207711_10032396
1024 Ga0207661_10036834
1025 Ga0207661_10088109
1026 Ga0207661_10190172
1027 Ga0207679_10003707
1028 Ga0207667_10215284
1029 Ga0207651_10000647
1030 Ga0207712_10017129
1031 Ga0207658_10014926
1032 Ga0207658_10058472
1033 Ga0207677_10005607
1034 Ga0207703_10005700
1035 Ga0207703_10151611
1036 Ga0207639_10406187
1037 Ga0207678_10016124
1038 Ga0207678_10040249
1039 Ga0207678_10086017
1040 Ga0207708_10087740
1041 Ga0207702_10200973
1042 Ga0207702_10497536
1043 Ga0207648_10002879
1044 Ga0207648_10036193
1045 Ga0207648_10489998
1046 Ga0207676_10040495
1047 Ga0207676_10155254
1048 Ga0207676_10158341
1049 Ga0207674_10078524
1050 Ga0207674_10139575
1051 Ga0207674_10303432
1052 Ga0207698_10004390
1053 Ga0207698_10059392
1054 Ga0207698_10305421
1055 Ga0209389_1000001
1056 Ga0209589_1000011
1057 Ga0209489_100012
1058 Ga0209489_102213
1059 Ga0209700_100007
1060 Ga0209700_100019
1061 Ga0268266_10060289
1062 Ga0268264_10337985
1063 Ga0268264_10342113
1064 Ga0307511_10114407
1065 Ga0265339_10053306
1066 Ga0307508_10000015
1067 Ga0265342_10007168
1068 Ga0307410_10005624
1069 Ga0307410_10210576
1070 Ga0307406_10003804
1071 Ga0307407_10031383
1072 Ga0307412_10435276
1073 Ga0307416_100002779
1074 Ga0307416_100003421
1075 Ga0307411_10039581
1076 Ga0307415_100104199
1077 Ga0307507_10006824
1078 Ga0307510_10037374
1079 Ga0307510_10055134
1080 Ga0307510_10096620
1081 Ga0315911_1000002
1082 Ga0316215_1002146
1083 Ga0373945_0107247
1084 Ga0373953_0035797
1085 Ga0373957_0013071
1086 Ga0373957_0077728
1087 Ga0373955_0072253
1088 Ga0373962_0008156
1089 Ga0316574_0000847
1090 Ga0373924_0033008
1091 Ga0373931_0011120
1092 Ga0373931_0132514
1093 Ga0373935_0055887
1094 Ga0373927_0027113
1095 Ga0373947_0007716
1096 Ga0373937_0100979
1097 Ga0373925_0022318
1098 Ga0373925_0072696
1099 Ga0395900_0201794
1100 Ga0395898_0105086
1101 Ga0436364_1074833
1102 Ga0395901_0410324
1103 Ga0237816_02524
1104 Ga0436365_0496646
1105 Ga0436365_1276870
1106 Ga0436363_1359162
1107 Ga0436362_0966777
1108 Ga0466969_0042525
1109 Ga0466972_0000134
1110 Ga0466965_0032173
1111 Ga0466966_0061017
1112 Ga0466963_0179628
1113 Ga0466957_0059293
1114 Ga0466960_0037434
1115 Ga0466959_0033350
1116 Ga0466967_0184717
1117 Ga0466967_0377309
1118 Ga0495592_0024435
1119 Ga0495592_0190651
1120 Ga0495603_0025442
1121 Ga0495603_0028282
1122 Ga0495629_0007286
1123 Ga0495638_0047278
1124 Ga0495651_0004240
1125 Ga0495651_0098201
1126 Ga0495651_0100648
1127 Ga0495653_0064213
1128 Ga0495664_0015208
1129 Ga0495664_0055337
1130 Ga0495608_0030206
1131 Ga0495618_0057476
1132 Ga0495618_0096450
1133 Ga0495628_0055591
1134 Ga0495628_0235997
1135 Ga0495630_0052973
1136 Ga0495643_0008377
1137 Ga0495644_0063291
1138 Ga0495648_0004316
1139 Ga0495648_0075860
1140 Ga0495652_0000938
1141 Ga0495652_0025055
1142 Ga0495640_0007993
1143 Ga0495640_0036648
1144 Ga0495640_0135972
1145 Ga0495587_0051821
1146 Ga0495645_0041434
1147 Ga0495645_0052596
1148 Ga0495645_0156327
1149 Ga0495622_0051205
1150 Ga0495622_0127491
1151 Ga0495667_0031082
1152 Ga0495667_0031460
1153 Ga0495634_0080979
1154 Ga0495635_0005160
1155 Ga0495635_0111434
1156 Ga0495657_0008941
1157 Ga0495657_0018176
1158 Ga0495599_0047674
1159 Ga0495599_0171615
1160 Ga0495646_0053536
1161 Ga0495646_0065458
1162 Ga0495658_0031727
1163 Ga0495613_0218574
1164 Ga0495624_0017354
1165 Ga0495649_0105856
1166 Ga0495600_0050226
1167 Ga0495600_0061677
1168 Ga0495600_0256848
1169 Ga0495581_0136633
1170 Ga0495604_0003325
1171 Ga0495604_0033572
1172 Ga0495674_0036465
1173 Ga0495674_0079109
1174 Ga0495674_0422590
1175 Ga0495672_0174664
1176 Ga0495680_0007102
1177 Ga0495675_0011426
1178 Ga0495684_0024756
1179 Ga0495684_0052157
1180 Ga0495686_0041367
1181 Ga0495602_0016046
1182 Ga0495602_0053918
1183 Ga0495614_0007563
1184 Ga0496100_0028657
1185 Ga0496100_0128972
1186 Ga0496101_0004214
1187 Ga0496101_0058748
1188 Ga0496101_0061665
1189 Ga0496102_0006143
1190 Ga0496102_0072396
1191 Ga0496102_0097001
1192 Ga0496102_0119146
1193 Ga0496102_0132063
1194 Ga0496103_0062146
1195 Ga0496104_0018203
1196 Ga0496104_0428269
1197 Ga0496105_0005595
1198 Ga0496105_0092877
1199 Ga0496105_0213215
1200 Ga0496106_0048620
1201 Ga0496106_0050208
1202 Ga0496106_0057918
1203 Ga0496107_0002113
1204 Ga0496107_0007328
1205 Ga0496107_0046023
1206 Ga0496107_0109796
1207 Ga0496108_0071294
1208 Ga0496108_0348436
1209 Ga0496108_0447246
1210 Ga0496109_0063257
1211 Ga0496109_0438307
1212 Ga0496110_0205416
1213 Ga0496111_0033737
1214 Ga0496112_0000044
1215 Ga0496112_0015095
1216 Ga0496112_0018080
1217 Ga0496112_0139350
1218 Ga0496113_0051531
1219 Ga0496114_0072007
1220 Ga0496114_0075757
1221 Ga0496114_0156020
1222 Ga0496114_0320533
1223 Ga0496115_0004269
1224 Ga0496115_0067760
1225 Ga0496115_0175726
1226 Ga0496115_0255204
1227 Ga0496115_0321083
1228 Ga0496117_0067801
1229 Ga0496117_0118927
1230 Ga0496118_0003016
1231 Ga0496118_0119224
1232 Ga0496118_0188289
1233 Ga0496120_0010703
1234 Ga0496121_0000041
1235 Ga0496121_0011806
1236 Ga0496121_0071824
1237 Ga0496122_0071759
1238 Ga0496124_0006721
1239 Ga0496125_0000712
1240 Ga0496125_0104374
1241 Ga0496126_0032037
1242 Ga0496126_0049685
1243 Ga0496126_0053820
1244 Ga0496126_0070101
1245 Ga0496126_0208115
1246 Ga0496126_0232309
1247 Ga0496126_0369665
1248 Ga0495682_0078011
1249 Ga0501031_0000652
1250 Ga0501032_0002299
1251 Ga0501032_0036945
1252 Ga0501033_0000091
1253 Ga0501034_0000039
1254 Ga0501034_0636407
1255 Ga0501036_0000052
1256 Ga0501037_0000025
1257 Ga0501038_0002924
1258 Ga0501038_0211707
1259 Ga0501039_0000719
1260 Ga0501043_0000928
1261 Ga0501046_0000231
1262 Ga0501046_0075551
1263 Ga0501047_0000457
1264 Ga0501047_0024108
1265 Ga0501048_0000218
1266 Ga0501067_0003111
1267 Ga0501067_0021251
1268 Ga0501068_0001352
1269 Ga0501070_0002829
1270 Ga0501071_0026801
1271 Ga0501072_0004469
1272 Ga0501073_0000877
1273 Ga0501074_0000273
1274 Ga0501079_0011695
1275 Ga0501080_0000124
1276 Ga0501083_0000785
1277 Ga0501035_0000052
1278 Ga0501035_0135984
1279 Ga0501044_0000217
1280 Ga0501044_0100080
1281 Ga0501045_0010874
1282 nmdc:mga00v17_143506_c1
1283 nmdc:mga0yw44_198777_c1
1284 nmdc:mga0yw44_35390_c1
1285 nmdc:mga0k408_45179_c1
1286 nmdc:mga07m45_51757_c1
1287 nmdc:mga0sz30_48771_c1
1288 Ga0495601_0199096
1289 Ga0500635_0017688
1290 Ga0500635_0020322
1291 Ga0495595_0151629
1292 Ga0495619_0019088
1293 Ga0495619_0181079
1294 Ga0500643_000069
1295 Ga0500644_0003960
1296 Ga0500566_0000608
1297 Ga0500566_0032348
1298 Ga0500566_0043837
1299 Ga0500650_0055084
1300 Ga0500554_000716
1301 Ga0500555_009231
1302 Ga0500556_0004962
1303 Ga0500557_000003
1304 Ga0500569_014459
1305 Ga0500595_000200
1306 Ga0500595_009172
1307 Ga0500642_0000051
1308 Ga0500642_0011959
1309 Ga0500568_0010968
1310 Ga0500568_0017137
1311 Ga0500577_0033509
1312 Ga0500589_035950
1313 Ga0500603_000240
1314 Ga0500603_067225
1315 Ga0500604_0023161
1316 Ga0500622_0008815
1317 Ga0500638_000785
1318 Ga0500636_0000166
1319 Ga0500637_0000144
1320 Ga0500576_028192
1321 Ga0500625_003024
1322 Ga0500609_002156
1323 Ga0500552_000771
1324 Ga0500596_001440
1325 Ga0500599_000151
1326 Ga0501084_0000683
1327 Ga0501082_0007986
1328 Ga0466962_0045345
1329 Ga0466962_0065872
1330 2507507596
1331 2508541715
1332 2508692743
1333 2509152987
1334 2511397091
1335 2513621797
1336 2513636760
1337 2513647581
1338 2513654154
1339 2513674841
1340 2513697094
1341 2513701382
1342 2513721226
1343 2513856909
1344 2513878709
1345 2513918494
1346 2514009363
1347 2515626140
1348 2517104225
1349 2517891271
1350 2524436213
1351 2524468220
1352 2524533524
1353 2528848913
1354 2617346864
1355 2617372795
1356 2644291325
1357 2671123801
1358 2723843626
1359 2728749968
1360 2745080831
1361 2793060941
1362 2793066634
1363 2793083853
1364 2805921358
1365 2818236618
1366 2824605198
1367 2824615517
1368 2824620486
1369 2824628466
1370 2824637166
1371 2824645911
1372 2824656404
1373 2824666194
1374 2824673704
1375 2824681761
1376 2824690671
1377 2824709824
1378 2824716578
1379 2824725559
1380 2824736080
1381 2824748798
1382 2824756048
1383 2824767586
1384 2824775059
1385 2838129286
1386 2841948058
1387 2841953545
1388 2841962857
1389 2841973050
1390 2841978273
1391 2841990492
1392 2842040716
1393 2842046338
1394 2844320094
1395 2847937387
1396 2847947812
1397 2849078330
1398 2857512710
1399 2874598712
1400 2874607162
1401 2874614505
1402 2874628144
1403 2874634940
1404 2874652167
1405 2876768154
1406 2876778751
1407 2876824354
1408 2879082544
1409 2879086688
1410 2879107777
1411 2879114049
1412 2879131461
1413 2879147907
1414 2881371396
1415 2881666650
1416 2885370031
1417 2885376582
1418 2885415667
1419 2888385518
1420 2888392712
1421 2888425650
1422 2889037948
1423 2903730232
1424 2903757683
1425 2904674238
1426 2904694201
1427 2904701194
1428 2904711907
1429 2906609919
1430 2906616455
1431 2906627660
1432 2906640011
1433 2906647358
1434 2906662951
1435 2908741609
1436 2908759227
1437 2908781239
1438 2922361886
1439 2922372338
1440 2922386881
1441 2922397012
1442 2922431529
1443 2929621091
1444 2929626078
1445 2932785048
1446 2932795087
1447 2932805615
1448 2932810076
1449 2932821650
1450 2932828884
1451 2933583039
1452 2935609896
1453 2935619696
1454 2935636168
1455 2935638676
1456 2935652074
1457 2935659953
1458 2935666472
1459 2935676485
1460 2935690999
1461 2935694567
1462 2935703682
1463 2935718380
1464 2935727640
1465 2935736343
1466 2935745723
1467 2935756104
1468 2935760636
1469 2935776055
1470 2935783487
1471 2935791932
1472 2935800258
1473 2935801820
1474 2935814765
1475 2935823056
1476 2935828170
1477 2935842375
1478 2935848638
1479 2935857989
1480 2935867893
1481 2935874083
1482 2935885815
1483 2935909556
1484 2935917281
1485 2935927037
1486 2935937119
1487 2935944578
1488 2935953015
1489 2935962783
1490 2935969855
1491 2935976452
1492 2935987098
1493 2935992992
1494 2936002904
1495 2936014369
1496 2936023791
1497 2936031434
1498 2936040592
1499 2936049475
1500 2936062225
1501 2940561921
1502 2941512799
1503 2941520634
1504 2941528648
1505 2941531276
1506 2941542424
1507 3005481323
1508 3005485468
1509 3005508373
1510 3005588127
1511 3005600380
1512 3005715674
1513 3005715872
1514 3005723229
1515 8006930103
1516 8006939387
1517 8006968821
1518 8006979042
1519 8006984500
1520 8007000961
1521 8016520582
1522 8016528618
1523 8016533788
1524 8016547006
1525 8016555105
1526 8016563470
1527 8016572124
1528 8016576322
1529 8016594428
1530 8016601217
1531 8016609221
1532 8016615682
1533 8016625543
1534 8016639102
1535 8017064996
1536 8019533564
1537 8019546106
1538 8019552600
1539 8019565257
1540 8019575361
1541 8019584374
1542 8019592145
1543 8019599136
1544 8019619882
1545 8019633235
1546 8019646664
1547 8019661104
1548 8019670662
1549 8019685569
1550 8019691138
1551 8055745046
1552 8056677483
1553 8056690725
1554 8056975000

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08386

Abhydrolase_4

TAP-like protein

287

359

0.86

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

92

346

0.84

PF12146

Hydrolase_4

Serine aminopeptidase, S33

92

346

0.71

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

95

355

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ie6-assembly2.cif.gz_C-2 crystal structure of a lactonase mutant in complex with substrate b 0.9515 111 154
6eb3-assembly3.cif.gz_C structural and enzymatic characterization of an esterase from a metagenomic library 0.8825 16 309
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.8761 14 157
6eb3-assembly3.cif.gz_C structural and enzymatic characterization of an esterase from a metagenomic library 0.8761 16 309
6eb3-assembly1.cif.gz_A structural and enzymatic characterization of an esterase from a metagenomic library 0.8746 16 309
ID Description Score Start End Superfamily
af_P96935_7_300_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9479 18 307 3.40.50.1820
af_Q4CQ95_18_306_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9455 23 304 3.40.50.1820
af_A4HXH8_39_324_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9432 23 299 3.40.50.1820
af_P96935_7_300_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9322 18 307 3.40.50.1820
af_A4I3N6_52_340_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9233 23 303 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A431JT55-F1-model_v4 Alpha/beta hydrolase 0.9714 10 304 GO:0004806
GO:0046503
AF-A0A3S0BND3-F1-model_v4 Alpha/beta fold hydrolase 0.9677 13 286 GO:0004806
GO:0046503
AF-A0A1G0IAP8-F1-model_v4 AB hydrolase-1 domain-containing protein 0.96 14 310 GO:0004806
GO:0046503
AF-A0A431JT55-F1-model_v4 Alpha/beta hydrolase 0.9586 10 304 GO:0004806
GO:0046503
AF-A0A7I8MJP8-F1-model_v4 Carboxyl esterase, a/b hydrolase 0.956 16 307 GO:0016787

Map