F480391

General Info

Members Datasets Scaffolds Average Seq Length
777 504 1554 447

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2516143018|2516206331
Length 490
Sequence PWEVCQRGPTQAQPPPSRRGPHRKTFAKADSMESPIALNRLAENNVFRKGDVFVLFGELFGRGYATGLVEEARRAGMEIVGITVGRRDENNALRPLNAEELSAAEARLGGRIINIPLMAGFDLDAPAGGPTPTDLLATMTLESWQHDRLDWDYIGLCRDIATARFTNSLSQVMAVLDGMIADGRNVFFAHTMAGGIPKAKVFLVVANRIYKGVGPRHMSSQTLIDSDMGKLILQNFDEVSAITFRHLIDFSAAIRERVEASGGQVRYTAYGYHGTAILIDGSYRWQTYTNYTQGYAKMRXEGIAEDAWAAGVKATVYNCPEIRTNSSDVFTGIELPLIPLLLALRKENGGQWAEEQWRDCQQLLADGFTMKDVFQKITDMQANEVMHPFYDFSAWPMANSQAQADLTIGTSIEITQMHRDSKAMISDLLSALVVEATGQLIFGASSDPXGPIRWLNHDIVARRLNASHLQRESPAPLIAQGAKASHLEMA

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
20 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
23 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
24 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
25 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
26 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
30 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
33 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
34 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
35 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
36 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
37 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
38 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
39 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
40 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
43 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
45 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
49 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
59 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
61 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
62 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
63 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
64 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
65 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
66 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
67 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
68 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
69 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
70 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
71 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
72 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
73 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
74 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
75 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
76 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
77 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
78 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
79 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
80 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
86 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
87 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
88 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
91 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
92 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
93 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
100 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
101 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
102 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
105 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
106 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
107 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
108 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
109 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
110 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
111 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
112 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
113 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
114 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
115 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
116 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
117 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
118 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
119 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
120 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
121 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
122 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
123 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
124 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
125 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
126 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
127 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
128 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
131 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
135 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
138 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
139 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
150 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
151 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
152 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
153 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
161 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
164 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
165 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
166 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
167 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
168 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
171 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
172 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
189 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
190 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
191 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
195 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
199 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
200 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
201 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
202 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
203 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
204 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
205 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
206 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
207 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
208 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
209 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
210 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
211 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
212 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
213 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
214 2516143018 Ensifer sp. BR816 Isolate Nodule
215 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
216 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
217 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
218 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
219 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
220 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
221 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
222 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
223 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
224 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
225 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
226 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
227 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
228 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
229 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
230 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
231 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
232 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
233 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
234 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
235 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
236 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
237 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
238 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
239 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
240 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
241 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
242 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
243 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
244 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
245 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
246 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
247 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
248 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
249 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
250 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
251 2643221556 Massilia sp. Root1485 Isolate Unclassified
252 2643221557 Ensifer sp. Root558 Isolate Unclassified
253 2643221568 Rhizobium sp. Root564 Isolate Unclassified
254 2643221582 Rhizobium sp. Root651 Isolate Unclassified
255 2643221610 Ensifer sp. Root74 Isolate Unclassified
256 2643221618 Ensifer sp. Root231 Isolate Unclassified
257 2643221626 Ensifer sp. Root31 Isolate Unclassified
258 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
259 2643221655 Ensifer sp. Root1252 Isolate Unclassified
260 2643221659 Ensifer sp. Root127 Isolate Unclassified
261 2643221668 Ensifer sp. Root423 Isolate Unclassified
262 2643221675 Ensifer sp. Root1298 Isolate Unclassified
263 2643221680 Ensifer sp. Root1312 Isolate Unclassified
264 2643221684 Massilia sp. Root133 Isolate Unclassified
265 2643221688 Rhizobium sp. Root482 Isolate Unclassified
266 2643221693 Rhizobium sp. Root491 Isolate Unclassified
267 2643221698 Ensifer sp. Root142 Isolate Unclassified
268 2643221712 Ensifer sp. Root258 Isolate Unclassified
269 2643221719 Rhizobium sp. Root274 Isolate Unclassified
270 2643221723 Ensifer sp. Root278 Isolate Unclassified
271 2643221726 Ensifer sp. Root954 Isolate Unclassified
272 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
273 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
274 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
275 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
276 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
277 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
278 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
279 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
280 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
281 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
282 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
283 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
284 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
285 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
286 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
287 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
288 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
289 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
290 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
291 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
292 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
293 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
294 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
295 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
296 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
297 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
298 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
299 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
300 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
301 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
302 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
303 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
304 2844163670 Ensifer sp. 1H6 Isolate Unclassified
305 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
306 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
307 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
308 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
309 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
310 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
311 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
312 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
313 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
314 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
315 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
316 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
317 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
318 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
319 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
320 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
321 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
322 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
323 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
324 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
325 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
326 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
327 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
328 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
329 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
330 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
331 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
332 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
333 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
334 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
335 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
336 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
337 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
338 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
339 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
340 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
341 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
342 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
343 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
344 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
345 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
346 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
347 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
348 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
349 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
350 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
351 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
352 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
353 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
354 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
355 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
356 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
357 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
358 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
359 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
360 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
361 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
362 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
363 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
364 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
365 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
366 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
367 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
368 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
369 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
370 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
371 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
372 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
373 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
374 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
375 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
376 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
377 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
378 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
379 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
380 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
381 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
382 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
383 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
384 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
385 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
386 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
387 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
388 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
389 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
390 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
391 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
392 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
393 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
394 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
395 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
396 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
397 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
398 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
399 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
400 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
401 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
402 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
403 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
404 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
405 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
406 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
407 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
408 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
409 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
410 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
411 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
412 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
413 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
414 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
415 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
416 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
417 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
418 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
419 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
420 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
421 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
422 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
423 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
424 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
425 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
426 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
427 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
428 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
429 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
430 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
431 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
432 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
433 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
434 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
435 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
436 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
437 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
438 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
439 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
440 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
441 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
442 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
443 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
444 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
445 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
446 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
447 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
448 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
449 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
450 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
451 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
452 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
453 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
454 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
455 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
456 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
457 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
458 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
459 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
460 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
461 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
462 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
463 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
464 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
465 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
466 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
467 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
468 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
469 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
470 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
471 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
472 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
473 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
474 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
475 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
476 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
477 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
478 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
479 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
480 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
481 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
482 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
483 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
484 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
485 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
486 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
487 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
488 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
489 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
490 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
491 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
492 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
493 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
494 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
495 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
496 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
497 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
498 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
499 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
500 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
501 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
502 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
503 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
504 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 61.78
Metatranscriptomes 0.13
Isolates 38.1

Biome Distribution

Category Percentage (%)
Aerial Root 0.64
Bulb 0
Endosphere 6.56
Nodule 29.47
Rhizoplane 2.83
Rhizosphere 48.91
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000024 3300002987 Bacteria 116245
2 rootL2_10028561 3300003322 Bacteria 2520
3 rootL2_10092725 3300003322 Bacteria 1889
4 rootH1_10280334 3300003323 Bacteria 3028
5 JGI25160J50197_1000063 3300003354 Bacteria 116245
6 JGI25161J50226_1000358 3300003374 Bacteria 23639
7 Ga0055525_1000001 3300003759 Bacteria 1016948
8 Ga0055526_1003144 3300003771 Bacteria 10697
9 Ga0055543_1000197 3300004625 Bacteria 49269
10 Ga0065165_1000163 3300005262 Bacteria 116283
11 Ga0065165_1003015 3300005262 Bacteria 12716
12 Ga0070670_100000147 3300005331 Bacteria 65190
13 Ga0068869_100156676 3300005334 Bacteria 1770
14 Ga0070661_100019074 3300005344 Bacteria 4883
15 Ga0070665_100004381 3300005548 Bacteria 14846
16 Ga0070664_100025699 3300005564 Bacteria 4883
17 Ga0075365_10115171 3300006038 Unclassified 1850
18 Ga0075368_10002071 3300006042 Bacteria 6482
19 Ga0075363_100003862 3300006048 Bacteria 6462
20 Ga0075364_10000015 3300006051 Bacteria 57651
21 Ga0075364_10096877 3300006051 Bacteria 1962
22 Ga0075369_10010085 3300006186 Bacteria 3690
23 Ga0075366_10074424 3300006195 Bacteria 2025
24 Ga0075370_10005086 3300006353 Bacteria 6482
25 Ga0068865_100111980 3300006881 Bacteria 2015
26 Ga0079104_1000063 3300006946 Bacteria 159519
27 Ga0099826_10000042 3300006948 Bacteria 92895
28 Ga0099826_10016476 3300006948 Bacteria 5582
29 Ga0105244_10079072 3300009036 Bacteria 1630
30 Ga0105250_10040531 3300009092 Bacteria 1868
31 Ga0105241_10078393 3300009174 Bacteria 2581
32 Ga0105237_10132619 3300009545 Bacteria 2486
33 Ga0157373_10007223 3300013100 Bacteria 8284
34 Ga0157373_10095013 3300013100 Bacteria 2098
35 Ga0157371_10000078 3300013102 Bacteria 154095
36 Ga0157371_10000295 3300013102 Bacteria 66319
37 Ga0157369_10017861 3300013105 Bacteria 7962
38 Ga0171463_1005 3300013249 Bacteria 358236
39 Ga0182006_1000010 3300015261 Bacteria 413414
40 Ga0182007_10000030 3300015262 Bacteria 156866
41 Ga0182005_1000009 3300015265 Bacteria 455334
42 Ga0183363_1026 3300015690 Bacteria 53052
43 Ga0228711_1005616 3300022739 Bacteria 19035
44 Ga0228710_1003183 3300022740 Bacteria 26184
45 Ga0209436_100188 3300025208 Bacteria 28869
46 Ga0209563_100007 3300025230 Bacteria 1579402
47 Ga0209563_105479 3300025230 Bacteria 2294
48 Ga0209148_1000360 3300025254 Bacteria 57908
49 Ga0209130_1000138 3300025284 Bacteria 116297
50 Ga0209676_1017779 3300025292 Bacteria 2503
51 Ga0209025_1000602 3300025294 Bacteria 64825
52 Ga0209564_1000250 3300025295 Bacteria 114790
53 Ga0209050_1006059 3300025298 Bacteria 7318
54 Ga0209256_1000623 3300025299 Bacteria 48795
55 Ga0207426_1000255 3300025302 Bacteria 116297
56 Ga0209257_1009054 3300025304 Bacteria 5449
57 Ga0209257_1019456 3300025304 Bacteria 2556
58 Ga0207705_10009135 3300025909 Bacteria 7226
59 Ga0207654_10017823 3300025911 Bacteria 3720
60 Ga0207657_10016079 3300025919 Bacteria 7222
61 Ga0207650_10000958 3300025925 Bacteria 21723
62 Ga0207706_10070925 3300025933 Bacteria 3064
63 Ga0207709_10014320 3300025935 Bacteria 4378
64 Ga0207709_10071287 3300025935 Bacteria 2206
65 Ga0207689_10214942 3300025942 Bacteria 1589
66 Ga0207667_10047456 3300025949 Bacteria 4546
67 Ga0209281_1000110 3300027111 Bacteria 215631
68 Ga0209281_1000640 3300027111 Bacteria 38244
69 Ga0209281_1000934 3300027111 Bacteria 24031
70 Ga0209371_1000003 3300027312 Bacteria 1122971
71 Ga0209282_1000049 3300027666 Bacteria 109875
72 Ga0209282_1000065 3300027666 Bacteria 91676
73 Ga0209813_10011799 3300027866 Bacteria 2293
74 Ga0307515_10007595 3300028794 Bacteria 21407
75 Ga0265324_10000002 3300029957 Bacteria 382754
76 Ga0265324_10011442 3300029957 Bacteria 3380
77 Ga0265324_10029404 3300029957 Bacteria 1932
78 Ga0268256_1000004 3300030500 Bacteria 1122967
79 Ga0316177_1061589 3300030731 Bacteria 3499
80 Ga0316180_1070198 3300030736 Bacteria 7367
81 Ga0316181_1099231 3300030744 Bacteria 4075
82 Ga0265330_10014461 3300031235 Bacteria 3662
83 Ga0265332_10000083 3300031238 Bacteria 83040
84 Ga0265325_10002420 3300031241 Bacteria 12605
85 Ga0265331_10001280 3300031250 Bacteria 18739
86 Ga0265331_10036760 3300031250 Bacteria 2402
87 Ga0265327_10000308 3300031251 Bacteria 94808
88 Ga0265327_10027045 3300031251 Bacteria 3309
89 Ga0307513_10008185 3300031456 Bacteria 13407
90 Ga0316575_10000193 3300031665 Bacteria 16106
91 Ga0265314_10012713 3300031711 Bacteria 6843
92 Ga0265314_10041955 3300031711 Bacteria 3269
93 Ga0307410_10183478 3300031852 Bacteria 1586
94 Ga0315914_1000005 3300031967 Bacteria 242195
95 Ga0315913_1001476 3300033430 Bacteria 26019
96 Ga0315915_1000004 3300033464 Bacteria 403083
97 Ga0395899_0091948 3300037312 Bacteria 2197
98 Ga0395899_0163293 3300037312 Bacteria 1572
99 Ga0395900_0000393 3300037418 Bacteria 63296
100 Ga0395900_0004592 3300037418 Bacteria 14575
101 Ga0395900_0022206 3300037418 Bacteria 6491
102 Ga0395900_0179936 3300037418 Bacteria 2149
103 Ga0395898_0123255 3300037466 Bacteria 2483
104 Ga0395905_0081853 3300037471 Bacteria 3025
105 Ga0395905_0272155 3300037471 Bacteria 1579
106 Ga0395901_0000054 3300038443 Bacteria 160505
107 Ga0395901_0044933 3300038443 Bacteria 4582
108 Ga0395901_0117491 3300038443 Bacteria 2794
109 Ga0395901_0311696 3300038443 Bacteria 1629
110 Ga0439433_0021500 3300041999 Bacteria 1444
111 Ga0439448_0000525 3300042005 Bacteria 8907
112 Ga0439449_0019438 3300042007 Bacteria 2546
113 Ga0450904_000737 3300042139 Bacteria 5692
114 Ga0451577_0000002 3300042876 Bacteria 1731375
115 Ga0451577_0000186 3300042876 Bacteria 131630
116 Ga0451577_0004547 3300042876 Bacteria 14597
117 Ga0451577_0009735 3300042876 Bacteria 9215
118 Ga0453683_0000003 3300044673 Bacteria 942572
119 Ga0466965_0033102 3300044683 Bacteria 2525
120 Ga0466966_0050421 3300044684 Bacteria 2647
121 Ga0466964_0000091 3300044706 Bacteria 21332
122 Ga0466964_0001048 3300044706 Bacteria 9221
123 Ga0453684_0000002 3300044712 Bacteria 1731375
124 Ga0453684_0000121 3300044712 Bacteria 341067
125 Ga0453684_0000671 3300044712 Bacteria 122605
126 Ga0453684_0094025 3300044712 Bacteria 3690
127 Ga0453684_0106376 3300044712 Bacteria 3419
128 Ga0466968_0000777 3300044735 Bacteria 11090
129 Ga0466957_0000064 3300044842 Bacteria 40442
130 Ga0451576_0000004 3300045051 Bacteria 1312238
131 Ga0451576_0000029 3300045051 Bacteria 404449
132 Ga0451576_0001359 3300045051 Bacteria 42151
133 Ga0451576_0001448 3300045051 Bacteria 40341
134 Ga0451576_0002532 3300045051 Bacteria 27073
135 Ga0466967_0046796 3300045976 Bacteria 3768
136 Ga0495617_000057 3300046452 Bacteria 100673
137 Ga0495627_001004 3300046453 Bacteria 18981
138 Ga0495627_006353 3300046453 Bacteria 4639
139 Ga0495590_0000018 3300046457 Bacteria 216375
140 Ga0495590_0000251 3300046457 Bacteria 29217
141 Ga0495591_009423 3300046458 Bacteria 3886
142 Ga0495629_0012542 3300046459 Bacteria 6137
143 Ga0495638_0002966 3300046460 Bacteria 13544
144 Ga0495653_0017058 3300046463 Bacteria 5907
145 Ga0495653_0022552 3300046463 Bacteria 5092
146 Ga0495653_0047458 3300046463 Bacteria 3321
147 Ga0495650_0000108 3300046471 Bacteria 200369
148 Ga0495650_0000140 3300046471 Bacteria 169317
149 Ga0495580_0012103 3300046472 Bacteria 6639
150 Ga0495582_0003828 3300046473 Bacteria 8471
151 Ga0495582_0029620 3300046473 Bacteria 3004
152 Ga0495605_0001736 3300046474 Bacteria 13967
153 Ga0495605_0004622 3300046474 Bacteria 8049
154 Ga0495605_0010846 3300046474 Bacteria 5089
155 Ga0495605_0024015 3300046474 Bacteria 3195
156 Ga0495605_0026784 3300046474 Bacteria 2993
157 Ga0495605_0033370 3300046474 Bacteria 2612
158 Ga0495605_0045798 3300046474 Bacteria 2153
159 Ga0495584_0000006 3300046491 Bacteria 301775
160 Ga0495584_0001835 3300046491 Bacteria 12335
161 Ga0495584_0001841 3300046491 Bacteria 12302
162 Ga0495584_0002247 3300046491 Bacteria 11024
163 Ga0495584_0003129 3300046491 Bacteria 9193
164 Ga0495584_0013323 3300046491 Bacteria 4198
165 Ga0495584_0015640 3300046491 Bacteria 3869
166 Ga0495585_0000282 3300046492 Bacteria 50936
167 Ga0495585_0000926 3300046492 Bacteria 24849
168 Ga0495585_0003548 3300046492 Bacteria 10477
169 Ga0495585_0004128 3300046492 Bacteria 9503
170 Ga0495585_0015998 3300046492 Bacteria 4349
171 Ga0495585_0016685 3300046492 Bacteria 4254
172 Ga0495585_0019085 3300046492 Bacteria 3956
173 Ga0495585_0022737 3300046492 Bacteria 3599
174 Ga0495585_0026321 3300046492 Bacteria 3322
175 Ga0495585_0030642 3300046492 Bacteria 3058
176 Ga0495585_0070315 3300046492 Bacteria 1909
177 Ga0495594_0012257 3300046499 Bacteria 4464
178 Ga0495594_0014904 3300046499 Bacteria 4080
179 Ga0495594_0027573 3300046499 Bacteria 3061
180 Ga0495594_0065339 3300046499 Bacteria 2018
181 Ga0495594_0068029 3300046499 Bacteria 1977
182 Ga0495596_0000236 3300046500 Bacteria 37630
183 Ga0495596_0001429 3300046500 Bacteria 13705
184 Ga0495596_0003685 3300046500 Bacteria 7661
185 Ga0495596_0004853 3300046500 Bacteria 6459
186 Ga0495596_0004975 3300046500 Bacteria 6367
187 Ga0495596_0005735 3300046500 Bacteria 5828
188 Ga0495596_0008161 3300046500 Bacteria 4675
189 Ga0495607_0002952 3300046501 Bacteria 13366
190 Ga0495607_0003634 3300046501 Bacteria 11712
191 Ga0495607_0012015 3300046501 Bacteria 5730
192 Ga0495607_0018606 3300046501 Bacteria 4426
193 Ga0495607_0023386 3300046501 Bacteria 3869
194 Ga0495607_0040184 3300046501 Bacteria 2787
195 Ga0495607_0086821 3300046501 Bacteria 1704
196 Ga0495583_0000525 3300046506 Bacteria 54370
197 Ga0495583_0000608 3300046506 Bacteria 48449
198 Ga0495583_0001445 3300046506 Bacteria 24126
199 Ga0495583_0002759 3300046506 Bacteria 14503
200 Ga0495583_0004051 3300046506 Bacteria 10773
201 Ga0495583_0004346 3300046506 Bacteria 10215
202 Ga0495583_0021769 3300046506 Bacteria 3289
203 Ga0495583_0026390 3300046506 Bacteria 2881
204 Ga0495583_0034605 3300046506 Bacteria 2418
205 Ga0495606_0008706 3300046507 Bacteria 8739
206 Ga0495606_0020392 3300046507 Bacteria 4889
207 Ga0495606_0027660 3300046507 Bacteria 4015
208 Ga0495606_0060853 3300046507 Bacteria 2417
209 Ga0495610_0001162 3300046512 Bacteria 23954
210 Ga0495616_0000343 3300046513 Bacteria 36983
211 Ga0495616_0000680 3300046513 Bacteria 25142
212 Ga0495616_0001661 3300046513 Bacteria 15228
213 Ga0495616_0002034 3300046513 Bacteria 13597
214 Ga0495616_0004092 3300046513 Bacteria 9255
215 Ga0495616_0007916 3300046513 Bacteria 6335
216 Ga0495616_0008070 3300046513 Bacteria 6269
217 Ga0495616_0021589 3300046513 Bacteria 3482
218 Ga0495616_0029476 3300046513 Bacteria 2897
219 Ga0495616_0034327 3300046513 Bacteria 2635
220 Ga0495616_0097257 3300046513 Bacteria 1385
221 Ga0495620_0007596 3300046515 Bacteria 5874
222 Ga0495631_0001685 3300046518 Bacteria 13139
223 Ga0495631_0002105 3300046518 Bacteria 11552
224 Ga0495631_0010589 3300046518 Bacteria 4560
225 Ga0495631_0012359 3300046518 Bacteria 4172
226 Ga0495631_0014148 3300046518 Bacteria 3856
227 Ga0495631_0014540 3300046518 Bacteria 3795
228 Ga0495631_0038282 3300046518 Bacteria 2132
229 Ga0495631_0053968 3300046518 Bacteria 1753
230 Ga0495632_0000062 3300046519 Bacteria 118205
231 Ga0495632_0000235 3300046519 Bacteria 55317
232 Ga0495632_0000901 3300046519 Bacteria 26017
233 Ga0495632_0002631 3300046519 Bacteria 13521
234 Ga0495632_0003209 3300046519 Bacteria 11766
235 Ga0495637_0000004 3300046520 Bacteria 589740
236 Ga0495643_0000648 3300046522 Bacteria 41187
237 Ga0495643_0009797 3300046522 Bacteria 5927
238 Ga0495643_0022182 3300046522 Bacteria 3627
239 Ga0495643_0025078 3300046522 Bacteria 3377
240 Ga0495643_0028822 3300046522 Bacteria 3109
241 Ga0495643_0037842 3300046522 Bacteria 2644
242 Ga0495644_0003759 3300046523 Bacteria 5974
243 Ga0495644_0010904 3300046523 Bacteria 3502
244 Ga0495644_0015469 3300046523 Bacteria 2921
245 Ga0495648_0000109 3300046524 Bacteria 101519
246 Ga0495648_0002349 3300046524 Bacteria 17563
247 Ga0495648_0003866 3300046524 Bacteria 12989
248 Ga0495648_0028952 3300046524 Bacteria 3682
249 Ga0495648_0030560 3300046524 Bacteria 3559
250 Ga0495648_0081248 3300046524 Bacteria 1844
251 Ga0495663_0003044 3300046525 Bacteria 4911
252 Ga0495666_0012630 3300046526 Bacteria 4209
253 Ga0495666_0019304 3300046526 Bacteria 3384
254 Ga0495666_0027785 3300046526 Bacteria 2785
255 Ga0495642_0000196 3300046528 Bacteria 35510
256 Ga0495642_0007659 3300046528 Bacteria 4138
257 Ga0495642_0018362 3300046528 Bacteria 2737
258 Ga0495642_0022002 3300046528 Bacteria 2509
259 Ga0495642_0116420 3300046528 Bacteria 1145
260 Ga0495652_0034667 3300046529 Bacteria 4398
261 Ga0495654_0007827 3300046530 Bacteria 5941
262 Ga0495654_0031073 3300046530 Bacteria 2712
263 Ga0495665_0016501 3300046531 Bacteria 3978
264 Ga0495665_0034983 3300046531 Bacteria 2685
265 Ga0495586_0002686 3300046535 Bacteria 9618
266 Ga0495586_0007801 3300046535 Bacteria 5706
267 Ga0495586_0023565 3300046535 Bacteria 3288
268 Ga0495587_0014029 3300046536 Bacteria 5030
269 Ga0495609_0000009 3300046538 Bacteria 354860
270 Ga0495609_0002695 3300046538 Bacteria 10719
271 Ga0495609_0003510 3300046538 Bacteria 8955
272 Ga0495609_0010793 3300046538 Bacteria 4369
273 Ga0495609_0013432 3300046538 Bacteria 3866
274 Ga0495597_0001393 3300046542 Bacteria 17466
275 Ga0495597_0001796 3300046542 Bacteria 14723
276 Ga0495597_0003920 3300046542 Bacteria 8402
277 Ga0495597_0009770 3300046542 Bacteria 4723
278 Ga0495597_0016794 3300046542 Bacteria 3453
279 Ga0495645_0074946 3300046543 Bacteria 2436
280 Ga0495645_0105229 3300046543 Bacteria 2002
281 Ga0495622_0012031 3300046557 Bacteria 4000
282 Ga0495622_0029887 3300046557 Bacteria 2545
283 Ga0495633_0008068 3300046558 Bacteria 5982
284 Ga0495633_0011835 3300046558 Bacteria 4677
285 Ga0495633_0014994 3300046558 Bacteria 4028
286 Ga0495633_0034597 3300046558 Bacteria 2429
287 Ga0495656_0004998 3300046615 Bacteria 4568
288 Ga0495668_0000805 3300046616 Bacteria 36034
289 Ga0495668_0002455 3300046616 Bacteria 15251
290 Ga0495668_0002669 3300046616 Bacteria 14315
291 Ga0495668_0010820 3300046616 Bacteria 5500
292 Ga0495668_0031535 3300046616 Bacteria 2986
293 Ga0495668_0045336 3300046616 Bacteria 2444
294 Ga0495668_0055741 3300046616 Bacteria 2182
295 Ga0495634_0033244 3300046642 Bacteria 3544
296 Ga0495611_0000861 3300046648 Bacteria 16634
297 Ga0495611_0011073 3300046648 Bacteria 3819
298 Ga0495611_0014360 3300046648 Bacteria 3382
299 Ga0495625_0009819 3300046660 Bacteria 7965
300 Ga0495625_0027108 3300046660 Bacteria 4319
301 Ga0495625_0045996 3300046660 Bacteria 3151
302 Ga0495625_0080676 3300046660 Bacteria 2265
303 Ga0495625_0131297 3300046660 Bacteria 1696
304 Ga0495661_0000368 3300046665 Bacteria 48926
305 Ga0495661_0001167 3300046665 Bacteria 22911
306 Ga0495661_0002320 3300046665 Bacteria 14679
307 Ga0495661_0002363 3300046665 Bacteria 14562
308 Ga0495661_0017362 3300046665 Bacteria 4754
309 Ga0495661_0022436 3300046665 Bacteria 4106
310 Ga0495661_0024071 3300046665 Bacteria 3943
311 Ga0495661_0024473 3300046665 Bacteria 3907
312 Ga0495661_0036897 3300046665 Bacteria 3055
313 Ga0495661_0050603 3300046665 Bacteria 2514
314 Ga0495661_0069884 3300046665 Bacteria 2056
315 Ga0495588_0000077 3300046674 Bacteria 215338
316 Ga0495588_0004598 3300046674 Bacteria 6098
317 Ga0495588_0013800 3300046674 Bacteria 3854
318 Ga0495588_0022764 3300046674 Bacteria 3098
319 Ga0495623_0029147 3300046679 Bacteria 3553
320 Ga0495623_0047237 3300046679 Bacteria 2732
321 Ga0495669_0000217 3300046684 Bacteria 34603
322 Ga0495669_0016969 3300046684 Bacteria 3122
323 Ga0495669_0049513 3300046684 Bacteria 1881
324 Ga0495669_0067517 3300046684 Bacteria 1625
325 Ga0495624_0018758 3300046690 Bacteria 4623
326 Ga0495670_0000391 3300046691 Bacteria 20872
327 Ga0495670_0009281 3300046691 Bacteria 4839
328 Ga0495670_0016326 3300046691 Bacteria 3648
329 Ga0495670_0021313 3300046691 Bacteria 3195
330 Ga0495670_0037325 3300046691 Bacteria 2421
331 Ga0495671_0000848 3300046692 Bacteria 21841
332 Ga0495671_0003909 3300046692 Bacteria 9038
333 Ga0495671_0018278 3300046692 Bacteria 3721
334 Ga0495649_0001146 3300046694 Bacteria 20628
335 Ga0495649_0004293 3300046694 Bacteria 9357
336 Ga0495589_0000037 3300046794 Bacteria 150603
337 Ga0495589_0001177 3300046794 Bacteria 15597
338 Ga0495589_0001412 3300046794 Bacteria 13925
339 Ga0495589_0013696 3300046794 Bacteria 4182
340 Ga0495589_0043769 3300046794 Bacteria 2227
341 Ga0495660_0000178 3300046810 Bacteria 68956
342 Ga0495660_0022967 3300046810 Bacteria 3559
343 Ga0495581_0009512 3300047315 Bacteria 5625
344 Ga0495604_0003606 3300047317 Bacteria 12337
345 Ga0495604_0059718 3300047317 Bacteria 2922
346 Ga0495674_0003699 3300047319 Bacteria 14870
347 Ga0495672_0000424 3300047320 Bacteria 50607
348 Ga0495672_0000590 3300047320 Bacteria 41027
349 Ga0495672_0002152 3300047320 Bacteria 18417
350 Ga0495672_0066230 3300047320 Bacteria 2062
351 Ga0495672_0104919 3300047320 Bacteria 1526
352 Ga0495676_0000342 3300047321 Bacteria 38031
353 Ga0495680_0015839 3300047322 Bacteria 6490
354 Ga0495680_0048605 3300047322 Bacteria 3330
355 Ga0495683_0000144 3300047323 Bacteria 69959
356 Ga0495683_0001039 3300047323 Bacteria 19287
357 Ga0495683_0004193 3300047323 Bacteria 8238
358 Ga0495683_0009068 3300047323 Bacteria 5300
359 Ga0495683_0022173 3300047323 Bacteria 3267
360 Ga0495687_000002 3300047443 Bacteria 1085770
361 Ga0495687_000017 3300047443 Bacteria 350429
362 Ga0495687_000024 3300047443 Bacteria 316676
363 Ga0495687_001539 3300047443 Bacteria 20979
364 Ga0495687_010589 3300047443 Bacteria 5047
365 Ga0495675_0008085 3300047444 Bacteria 6511
366 Ga0495677_0000011 3300047445 Bacteria 149837
367 Ga0495677_0001358 3300047445 Bacteria 9771
368 Ga0495677_0001586 3300047445 Bacteria 9165
369 Ga0495677_0002619 3300047445 Bacteria 7039
370 Ga0495677_0010720 3300047445 Bacteria 3358
371 Ga0495679_003113 3300047446 Bacteria 8123
372 Ga0495679_003713 3300047446 Bacteria 7264
373 Ga0495679_011569 3300047446 Bacteria 3398
374 Ga0495685_012525 3300047447 Bacteria 2873
375 Ga0495681_0002294 3300047470 Bacteria 13753
376 Ga0495681_0007392 3300047470 Bacteria 7027
377 Ga0495681_0009181 3300047470 Bacteria 6115
378 Ga0495681_0011982 3300047470 Bacteria 5120
379 Ga0495681_0027321 3300047470 Bacteria 2954
380 Ga0495681_0053496 3300047470 Bacteria 1889
381 Ga0495686_0130207 3300047472 Bacteria 1492
382 Ga0495593_0006706 3300047673 Bacteria 6742
383 Ga0495593_0015080 3300047673 Bacteria 4389
384 Ga0495593_0040184 3300047673 Bacteria 2519
385 Ga0495602_0157696 3300048088 Bacteria 1775
386 Ga0495614_0006251 3300048089 Bacteria 5354
387 Ga0495614_0010600 3300048089 Bacteria 4063
388 Ga0495615_0001140 3300048090 Bacteria 3823
389 Ga0495626_0000004 3300048091 Bacteria 356599
390 Ga0495626_0000016 3300048091 Bacteria 232214
391 Ga0495626_0002550 3300048091 Bacteria 12494
392 Ga0495626_0003138 3300048091 Bacteria 10816
393 Ga0495626_0016542 3300048091 Bacteria 3743
394 Ga0495626_0025701 3300048091 Bacteria 2876
395 Ga0495626_0033369 3300048091 Bacteria 2467
396 Ga0496102_0000340 3300048905 Bacteria 57233
397 Ga0496102_0000461 3300048905 Bacteria 45293
398 Ga0496102_0031308 3300048905 Bacteria 4771
399 Ga0496102_0056486 3300048905 Bacteria 3581
400 Ga0496103_0038605 3300048906 Bacteria 2931
401 Ga0496103_0039131 3300048906 Bacteria 2913
402 Ga0496106_0000336 3300048909 Bacteria 32967
403 Ga0496106_0018536 3300048909 Bacteria 5148
404 Ga0496107_0027743 3300048910 Bacteria 4022
405 Ga0496109_0063011 3300048912 Bacteria 3391
406 Ga0496110_0000019 3300048913 Bacteria 79137
407 Ga0496110_0158452 3300048913 Bacteria 2051
408 Ga0496110_0234656 3300048913 Bacteria 1669
409 Ga0496111_0003186 3300048914 Bacteria 10114
410 Ga0496113_0055353 3300048916 Bacteria 2973
411 Ga0496113_0069951 3300048916 Bacteria 2666
412 Ga0496115_0097165 3300048918 Bacteria 2412
413 Ga0496116_0000042 3300048919 Bacteria 330516
414 Ga0496116_0030397 3300048919 Bacteria 3881
415 Ga0496117_0000010 3300048920 Bacteria 611954
416 Ga0496117_0000033 3300048920 Bacteria 345605
417 Ga0496117_0054884 3300048920 Bacteria 2788
418 Ga0496117_0125634 3300048920 Bacteria 1566
419 Ga0496118_0000009 3300048921 Bacteria 611954
420 Ga0496118_0012983 3300048921 Bacteria 7930
421 Ga0496118_0043993 3300048921 Bacteria 3502
422 Ga0496118_0045925 3300048921 Bacteria 3402
423 Ga0496119_0029172 3300048922 Bacteria 3748
424 Ga0496120_0001142 3300048923 Bacteria 34112
425 Ga0496120_0066610 3300048923 Bacteria 1991
426 Ga0496121_0000001 3300048924 Bacteria 1830318
427 Ga0496121_0004353 3300048924 Bacteria 19143
428 Ga0496121_0145848 3300048924 Bacteria 1749
429 Ga0496122_0000835 3300048925 Bacteria 58311
430 Ga0496122_0002798 3300048925 Bacteria 23968
431 Ga0496122_0004501 3300048925 Bacteria 17220
432 Ga0496122_0050889 3300048925 Bacteria 3154
433 Ga0496122_0052373 3300048925 Bacteria 3090
434 Ga0496123_0000338 3300048926 Bacteria 88635
435 Ga0496123_0001003 3300048926 Bacteria 43216
436 Ga0496123_0004574 3300048926 Bacteria 14422
437 Ga0496124_0000080 3300048927 Bacteria 210439
438 Ga0496124_0002249 3300048927 Bacteria 25656
439 Ga0496124_0008260 3300048927 Bacteria 10916
440 Ga0496124_0061412 3300048927 Bacteria 3150
441 Ga0496124_0072866 3300048927 Bacteria 2843
442 Ga0496124_0114032 3300048927 Bacteria 2171
443 Ga0496124_0167740 3300048927 Bacteria 1704
444 Ga0496125_0000001 3300048928 Bacteria 1766138
445 Ga0496125_0001280 3300048928 Bacteria 37321
446 Ga0496125_0008739 3300048928 Bacteria 10538
447 Ga0496125_0053573 3300048928 Bacteria 3305
448 Ga0496126_0000053 3300048929 Bacteria 311989
449 Ga0496126_0062520 3300048929 Bacteria 3340
450 Ga0496126_0099547 3300048929 Bacteria 2546
451 Ga0501308_000138 3300049128 Bacteria 3699
452 Ga0495678_000515 3300049459 Bacteria 37716
453 Ga0495678_000866 3300049459 Bacteria 26949
454 Ga0495678_002343 3300049459 Bacteria 13026
455 Ga0495678_005217 3300049459 Bacteria 7260
456 Ga0495678_014253 3300049459 Bacteria 3702
457 Ga0495682_0001115 3300049460 Bacteria 15630
458 Ga0501033_0000050 3300049570 Bacteria 111819
459 Ga0501035_0000965 3300049822 Bacteria 30391
460 Ga0501035_0011491 3300049822 Bacteria 8205
461 nmdc:mga00v17_33_c1 3300050491 Bacteria 87180
462 nmdc:mga00v17_81_c1 3300050491 Bacteria 57650
463 nmdc:mga0yw44_57688_c1 3300050492 Unclassified 2369
464 nmdc:mga06z11_2959_c1 3300050494 Bacteria 6544
465 nmdc:mga07m45_5127_c1 3300050496 Bacteria 6489
466 nmdc:mga0sz30_21286_c1 3300050516 Bacteria 2623
467 nmdc:mga0sz30_28667_c1 3300050516 Bacteria 2292
468 nmdc:mga0sz30_3772_c1 3300050516 Bacteria 5458
469 Ga0500560_002138 3300053107 Bacteria 3693
470 Ga0500658_0003054 3300053134 Bacteria 6406
471 Ga0500561_0000165 3300053137 Bacteria 12340
472 Ga0500568_0000230 3300053139 Bacteria 48007
473 Ga0500616_0000134 3300053153 Bacteria 129376
474 Ga0500616_0000564 3300053153 Bacteria 45665
475 Ga0500624_001152 3300053157 Bacteria 4843
476 Ga0500633_0001107 3300053160 Bacteria 4850
477 Ga0500634_0065545 3300053161 Bacteria 1916
478 Ga0500636_0000038 3300053177 Bacteria 70653
479 Ga0500636_0000186 3300053177 Bacteria 33515
480 Ga0500637_0001211 3300053178 Bacteria 10774
481 Ga0500625_009093 3300053729 Bacteria 4418
482 2516206331 2516143018 Bacteria 6951533
483 2510306868 2510065057 Bacteria 6649661
484 2511170357 2510917026 Bacteria 7046020
485 2511500023 2511231052 Bacteria 6974333
486 2512974935 2512875026 Bacteria 6861065
487 2513586314 2513237086 Bacteria 7265287
488 2513603730 2513237089 Bacteria 6553624
489 2513618905 2513237091 Bacteria 6900273
490 2513883203 2513237140 Bacteria 7076289
491 2513904217 2513237143 Bacteria 6664116
492 2513987724 2513237156 Bacteria 6402557
493 2514004312 2513237160 Bacteria 6650282
494 2515612525 2515154107 Bacteria 6795637
495 2516206991 2516143018 Bacteria 6951533
496 2516897562 2516653046 Bacteria 6989037
497 2517567582 2517487022 Bacteria 7227575
498 2524449813 2524023207 Bacteria 6813453
499 2551674405 2551306084 Bacteria 8942552
500 2551686853 2551306085 Bacteria 7347181
501 2551690932 2551306086 Bacteria 6843938
502 2551702479 2551306087 Bacteria 7351905
503 2551714479 2551306089 Bacteria 7162724
504 2551715752 2551306090 Bacteria 7953713
505 2551730860 2551306091 Bacteria 7086830
506 2551732705 2551306092 Bacteria 6992595
507 2551735918 2551306092 Bacteria 6992595
508 2551740702 2551306093 Bacteria 7064773
509 2554249569 2554235003 Bacteria 5877155
510 2559298082 2558860242 Bacteria 5568029
511 2585233718 2582581299 Bacteria 6518058
512 2585266529 2582581306 Bacteria 6450535
513 2585387545 2582581865 Bacteria 6644329
514 2585390589 2582581865 Bacteria 6644329
515 2585396954 2582581866 Bacteria 6859583
516 2586004395 2585427634 Bacteria 6455027
517 2599335276 2599185156 Bacteria 5403036
518 2600196241 2599185352 Bacteria 7228948
519 2600374018 2600254933 Bacteria 4750527
520 2601612556 2600255279 Bacteria 5605316
521 2601749327 2600255308 Bacteria 5611129
522 2643802323 2643221556 Bacteria 7251154
523 2643808733 2643221557 Bacteria 7184309
524 2643856898 2643221568 Bacteria 5187270
525 2643917916 2643221582 Bacteria 5804683
526 2644064185 2643221610 Bacteria 7480339
527 2644106257 2643221618 Bacteria 7717186
528 2644146755 2643221626 Bacteria 8069654
529 2644297253 2643221653 Bacteria 4569637
530 2644310868 2643221655 Bacteria 7722067
531 2644334329 2643221659 Bacteria 7890716
532 2644376352 2643221668 Bacteria 7306521
533 2644416016 2643221675 Bacteria 7473456
534 2644449057 2643221680 Bacteria 7473610
535 2644475831 2643221684 Bacteria 7145183
536 2644492844 2643221688 Bacteria 5260751
537 2644519997 2643221693 Bacteria 5513853
538 2644545458 2643221698 Bacteria 7756764
539 2644616702 2643221712 Bacteria 7729434
540 2644655506 2643221719 Bacteria 4568197
541 2644673371 2643221723 Bacteria 7095460
542 2644692118 2643221726 Bacteria 7455827
543 2753461925 2751185821 Bacteria 6189929
544 2792624761 2791355091 Bacteria 6135441
545 2792629683 2791355092 Bacteria 6248105
546 2792643977 2791355094 Bacteria 7011481
547 2802718224 2802428858 Bacteria 6636079
548 2802725981 2802428859 Bacteria 6667919
549 2802731307 2802428860 Bacteria 6525526
550 2802736499 2802428861 Bacteria 6534206
551 2802744474 2802428862 Bacteria 6633353
552 2802749937 2802428863 Bacteria 6410669
553 2804754362 2802429268 Bacteria 6094027
554 2808989390 2808606387 Bacteria 5697198
555 2809145368 2808606418 Bacteria 6724496
556 2819242923 2818991272 Bacteria 4622173
557 2819557031 2818991439 Bacteria 6907412
558 2821126326 2821123053 Bacteria 7836056
559 2838079200 2838074704 Bacteria 6785777
560 2838718624 2838714209 Bacteria 5525906
561 2838723622 2838719591 Bacteria 5523910
562 2838737198 2838736955 Bacteria 5760694
563 2841842433 2841840854 Bacteria 5761912
564 2841845780 2841840854 Bacteria 5761912
565 2841851516 2841846520 Bacteria 5345850
566 2841863057 2841859092 Bacteria 5436171
567 2842129484 2842124991 Bacteria 5346824
568 2842142213 2842140634 Bacteria 5759631
569 2842145484 2842140634 Bacteria 5759631
570 2842174779 2842170452 Bacteria 5525737
571 2842191261 2842187318 Bacteria 5524014
572 2842215666 2842211629 Bacteria 5523832
573 2842228387 2842224351 Bacteria 5524473
574 2842519426 2842515876 Bacteria 5436280
575 2842927101 2842922631 Bacteria 5824079
576 2843692402 2843690924 Bacteria 5169057
577 2844166034 2844163670 Bacteria 7266046
578 2846036288 2846033681 Bacteria 4377894
579 2846038150 2846037992 Bacteria 4526407
580 2855830531 2855825444 Bacteria 6785811
581 2855845695 2855839649 Bacteria 7135830
582 2857532887 2857531043 Bacteria 6754041
583 2858805558 2858800743 Bacteria 6603254
584 2885085541 2885080285 Bacteria 6355622
585 2899846204 2899845264 Bacteria 5672268
586 2913300717 2913295892 Bacteria 6333755
587 2915986880 2915980308 Bacteria 6624279
588 2915987077 2915986958 Bacteria 6739310
589 2915997751 2915993759 Bacteria 7016183
590 2916001507 2916000859 Bacteria 6865702
591 2916011360 2916007675 Bacteria 6898660
592 2916014756 2916014648 Bacteria 6946486
593 2916025223 2916021584 Bacteria 6854472
594 2916032263 2916028427 Bacteria 6748433
595 2916039118 2916035215 Bacteria 6755766
596 2916045433 2916041962 Bacteria 6820487
597 2916051289 2916048683 Bacteria 6543552
598 2916059057 2916055098 Bacteria 6758838
599 2916063783 2916061851 Bacteria 6737736
600 2916069550 2916068649 Bacteria 6943657
601 2916081921 2916076590 Bacteria 6596108
602 2919104884 2919100787 Bacteria 7710546
603 2919119001 2919114240 Bacteria 5700270
604 2919170017 2919166419 Bacteria 4952238
605 2920761969 2920760137 Bacteria 7427611
606 2920822663 2920822456 Bacteria 6897201
607 2921203241 2921201388 Bacteria 6926299
608 2921209362 2921208531 Bacteria 6745326
609 2921239626 2921237296 Bacteria 6876710
610 2921244972 2921244191 Bacteria 6568419
611 2921253465 2921250672 Bacteria 6677771
612 2921263804 2921257292 Bacteria 6808382
613 2921269965 2921263974 Bacteria 6864552
614 2921283283 2921282425 Bacteria 6826397
615 2921294386 2921289301 Bacteria 7316391
616 2921304022 2921296804 Bacteria 7176999
617 2924146253 2924144063 Bacteria 6883928
618 2924155568 2924150972 Bacteria 7169444
619 2924162095 2924158325 Bacteria 7188855
620 2924170049 2924165586 Bacteria 7260590
621 2924176607 2924172951 Bacteria 6749356
622 2924180095 2924179722 Bacteria 6843264
623 2924199102 2924193448 Bacteria 6955718
624 2924202880 2924200457 Bacteria 6757188
625 2924209833 2924207177 Bacteria 6917007
626 2924216897 2924214083 Bacteria 7080103
627 2924227566 2924221636 Bacteria 7113495
628 2924230598 2924228884 Bacteria 6633132
629 2926759516 2926754445 Bacteria 5964435
630 2926765508 2926760298 Bacteria 5505990
631 2929140281 2929138655 Bacteria 5810547
632 2933016631 2933011516 Bacteria 5439334
633 2933598762 2933594066 Bacteria 5594265
634 2937001911 2936996657 Bacteria 6298727
635 2937004198 2937002841 Bacteria 6934057
636 2937011651 2937009748 Bacteria 6746052
637 2937017853 2937016420 Bacteria 6782579
638 2937028740 2937023124 Bacteria 6815156
639 2937035322 2937029754 Bacteria 6424026
640 2937040091 2937036028 Bacteria 6846469
641 2937046523 2937042894 Bacteria 6741576
642 2937052011 2937049772 Bacteria 6757901
643 2937057640 2937056579 Bacteria 7107896
644 2937065881 2937063883 Bacteria 7199456
645 2937077864 2937071275 Bacteria 6984483
646 2937079115 2937078374 Bacteria 6610289
647 2937085032 2937084907 Bacteria 6618516
648 2937097184 2937091812 Bacteria 6979387
649 2937102182 2937098957 Bacteria 7249374
650 2937107492 2937106411 Bacteria 6947143
651 2937116749 2937113482 Bacteria 6505872
652 2937125092 2937119839 Bacteria 6597547
653 2937132134 2937126314 Bacteria 6771275
654 2941505350 2941499720 Bacteria 7599444
655 2957376162 2957375807 Bacteria 6425588
656 2957385287 2957382221 Bacteria 6737050
657 2957394403 2957388812 Bacteria 6778072
658 2957402293 2957395598 Bacteria 6822399
659 2957405709 2957402308 Bacteria 6741770
660 2957410419 2957408893 Bacteria 6558585
661 2957415321 2957415311 Bacteria 6991633
662 2957423374 2957422303 Bacteria 7172205
663 2957434971 2957430029 Bacteria 7022557
664 2957440884 2957437181 Bacteria 6568994
665 2957453573 2957450854 Bacteria 6765715
666 2957459284 2957457609 Bacteria 6967680
667 2957465858 2957464669 Bacteria 6568877
668 2957471736 2957471148 Bacteria 6797643
669 2957482119 2957478035 Bacteria 6756658
670 2957484962 2957484790 Bacteria 6703082
671 2957495688 2957491536 Bacteria 6695180
672 2957502739 2957498199 Bacteria 7126688
673 2957510466 2957505466 Bacteria 7253085
674 2960588520 2960584000 Bacteria 6864594
675 2960597543 2960591022 Bacteria 6622873
676 2960601495 2960597568 Bacteria 6550735
677 2960605111 2960603979 Bacteria 6898737
678 2960614531 2960610863 Bacteria 6691244
679 2960628421 2960624210 Bacteria 6875384
680 2960636737 2960631154 Bacteria 6732508
681 2960639972 2960637947 Bacteria 7296468
682 2960650666 2960645483 Bacteria 7211087
683 2960654049 2960652885 Bacteria 7083688
684 2960670557 2960667422 Bacteria 6763020
685 2960686241 2960680706 Bacteria 6624464
686 2960690175 2960687367 Bacteria 6535474
687 2960696997 2960693952 Bacteria 6749742
688 2964609173 2964607997 Bacteria 7101408
689 2964621889 2964615318 Bacteria 6809089
690 2964628555 2964621998 Bacteria 6834995
691 2964634609 2964628898 Bacteria 7083044
692 2964641500 2964636051 Bacteria 7091832
693 2964645802 2964643177 Bacteria 6820887
694 2964654339 2964649959 Bacteria 6675118
695 2964658405 2964656573 Bacteria 7100150
696 2964666461 2964663802 Bacteria 7019362
697 2964673013 2964670856 Bacteria 6851364
698 2964682581 2964678106 Bacteria 6792020
699 2964691433 2964685014 Bacteria 6839111
700 2964697423 2964691889 Bacteria 6802758
701 2964703089 2964698721 Bacteria 6765331
702 2964711590 2964705432 Bacteria 7114648
703 2964715867 2964712639 Bacteria 6695970
704 2964721389 2964719344 Bacteria 7286602
705 2967665895 2967664464 Bacteria 6948836
706 2967672693 2967671571 Bacteria 7021409
707 2967682291 2967678726 Bacteria 7264382
708 2967689854 2967686174 Bacteria 6678622
709 2967697712 2967693043 Bacteria 6804451
710 2967702315 2967699805 Bacteria 6854538
711 2967707366 2967706974 Bacteria 7186053
712 2967718460 2967714385 Bacteria 7000047
713 2967727791 2967721400 Bacteria 7073753
714 2967733262 2967728569 Bacteria 6641507
715 2967740779 2967735183 Bacteria 6827012
716 2967748414 2967742019 Bacteria 6794534
717 2967751376 2967748971 Bacteria 6733771
718 2967761555 2967755722 Bacteria 6814706
719 2967764822 2967762386 Bacteria 6923502
720 2967771726 2967769361 Bacteria 6587838
721 2967778865 2967775926 Bacteria 6738189
722 2970023153 2970019648 Bacteria 7072033
723 2970031432 2970026789 Bacteria 6785236
724 2970035288 2970033650 Bacteria 7118744
725 2970044643 2970040964 Bacteria 6731123
726 2970050383 2970047711 Bacteria 7088379
727 2970060478 2970054988 Bacteria 6611507
728 2970068391 2970061556 Bacteria 7099761
729 2970070427 2970068827 Bacteria 7123112
730 2970079018 2970076120 Bacteria 6697332
731 2970094450 2970088815 Bacteria 6933825
732 2970102034 2970095765 Bacteria 6936963
733 2970108245 2970102677 Bacteria 6812532
734 2970114942 2970109326 Bacteria 6863976
735 2970119794 2970116247 Bacteria 6501857
736 2970127880 2970122695 Bacteria 6625855
737 2970133902 2970129317 Bacteria 6806560
738 2970142552 2970136068 Bacteria 7207982
739 2970147876 2970143518 Bacteria 6446480
740 2970155330 2970149975 Bacteria 6779706
741 2970161994 2970156795 Bacteria 7168044
742 2970168586 2970164137 Bacteria 6861252
743 2970176352 2970170962 Bacteria 6876229
744 2970181636 2970177841 Bacteria 6768001
745 2970184659 2970184632 Bacteria 7054431
746 2970197248 2970191845 Bacteria 7032787
747 2977522369 2977516862 Bacteria 6940108
748 2977536595 2977530762 Bacteria 6951399
749 2977542514 2977537788 Bacteria 6929320
750 2977548698 2977544691 Bacteria 6875412
751 2977554967 2977551784 Bacteria 7125765
752 2977559818 2977558990 Bacteria 6863948
753 2977568565 2977565890 Bacteria 6901543
754 2977577741 2977572785 Bacteria 6763888
755 2977583816 2977579622 Bacteria 6772100
756 2978970161 2978969890 Bacteria 5400756
757 2979095250 2979089926 Bacteria 5670289
758 2979097502 2979095461 Bacteria 5669583
759 2979102025 2979100975 Bacteria 5423623
760 2984510028 2984509177 Bacteria 5274802
761 2984519271 2984518228 Bacteria 5277463
762 2984538369 2984537506 Bacteria 5277481
763 2984587188 2984587000 Bacteria 5263363
764 2984605094 2984601300 Bacteria 5455244
765 2989349821 2989349275 Bacteria 6349068
766 2989777808 2989776772 Bacteria 4843317
767 2998345975 2998344455 Bacteria 4222996
768 648739277 648276728 Bacteria 6968865
769 650741850 650716007 Bacteria 5573770
770 8003573580 8003570095 Bacteria 5747666
771 8003998381 8003992118 Bacteria 7266902
772 8004005123 8003999396 Bacteria 7063185
773 8005247006 8005246636 Bacteria 4933972
774 8005659480 8005658619 Bacteria 4500593
775 8047673819 8047673197 Bacteria 7395230
776 8049297708 8049293176 Bacteria 6128433
777 8054464906 8054460903 Bacteria 4872905
778 JGI25159J45721_1000024
779 rootL2_10028561
780 rootL2_10092725
781 rootH1_10280334
782 JGI25160J50197_1000063
783 JGI25161J50226_1000358
784 Ga0055525_1000001
785 Ga0055526_1003144
786 Ga0055543_1000197
787 Ga0065165_1000163
788 Ga0065165_1003015
789 Ga0070670_100000147
790 Ga0068869_100156676
791 Ga0070661_100019074
792 Ga0070665_100004381
793 Ga0070664_100025699
794 Ga0075365_10115171
795 Ga0075368_10002071
796 Ga0075363_100003862
797 Ga0075364_10000015
798 Ga0075364_10096877
799 Ga0075369_10010085
800 Ga0075366_10074424
801 Ga0075370_10005086
802 Ga0068865_100111980
803 Ga0079104_1000063
804 Ga0099826_10000042
805 Ga0099826_10016476
806 Ga0105244_10079072
807 Ga0105250_10040531
808 Ga0105241_10078393
809 Ga0105237_10132619
810 Ga0157373_10007223
811 Ga0157373_10095013
812 Ga0157371_10000078
813 Ga0157371_10000295
814 Ga0157369_10017861
815 Ga0171463_1005
816 Ga0182006_1000010
817 Ga0182007_10000030
818 Ga0182005_1000009
819 Ga0183363_1026
820 Ga0228711_1005616
821 Ga0228710_1003183
822 Ga0209436_100188
823 Ga0209563_100007
824 Ga0209563_105479
825 Ga0209148_1000360
826 Ga0209130_1000138
827 Ga0209676_1017779
828 Ga0209025_1000602
829 Ga0209564_1000250
830 Ga0209050_1006059
831 Ga0209256_1000623
832 Ga0207426_1000255
833 Ga0209257_1009054
834 Ga0209257_1019456
835 Ga0207705_10009135
836 Ga0207654_10017823
837 Ga0207657_10016079
838 Ga0207650_10000958
839 Ga0207706_10070925
840 Ga0207709_10014320
841 Ga0207709_10071287
842 Ga0207689_10214942
843 Ga0207667_10047456
844 Ga0209281_1000110
845 Ga0209281_1000640
846 Ga0209281_1000934
847 Ga0209371_1000003
848 Ga0209282_1000049
849 Ga0209282_1000065
850 Ga0209813_10011799
851 Ga0307515_10007595
852 Ga0265324_10000002
853 Ga0265324_10011442
854 Ga0265324_10029404
855 Ga0268256_1000004
856 Ga0316177_1061589
857 Ga0316180_1070198
858 Ga0316181_1099231
859 Ga0265330_10014461
860 Ga0265332_10000083
861 Ga0265325_10002420
862 Ga0265331_10001280
863 Ga0265331_10036760
864 Ga0265327_10000308
865 Ga0265327_10027045
866 Ga0307513_10008185
867 Ga0316575_10000193
868 Ga0265314_10012713
869 Ga0265314_10041955
870 Ga0307410_10183478
871 Ga0315914_1000005
872 Ga0315913_1001476
873 Ga0315915_1000004
874 Ga0395899_0091948
875 Ga0395899_0163293
876 Ga0395900_0000393
877 Ga0395900_0004592
878 Ga0395900_0022206
879 Ga0395900_0179936
880 Ga0395898_0123255
881 Ga0395905_0081853
882 Ga0395905_0272155
883 Ga0395901_0000054
884 Ga0395901_0044933
885 Ga0395901_0117491
886 Ga0395901_0311696
887 Ga0439433_0021500
888 Ga0439448_0000525
889 Ga0439449_0019438
890 Ga0450904_000737
891 Ga0451577_0000002
892 Ga0451577_0000186
893 Ga0451577_0004547
894 Ga0451577_0009735
895 Ga0453683_0000003
896 Ga0466965_0033102
897 Ga0466966_0050421
898 Ga0466964_0000091
899 Ga0466964_0001048
900 Ga0453684_0000002
901 Ga0453684_0000121
902 Ga0453684_0000671
903 Ga0453684_0094025
904 Ga0453684_0106376
905 Ga0466968_0000777
906 Ga0466957_0000064
907 Ga0451576_0000004
908 Ga0451576_0000029
909 Ga0451576_0001359
910 Ga0451576_0001448
911 Ga0451576_0002532
912 Ga0466967_0046796
913 Ga0495617_000057
914 Ga0495627_001004
915 Ga0495627_006353
916 Ga0495590_0000018
917 Ga0495590_0000251
918 Ga0495591_009423
919 Ga0495629_0012542
920 Ga0495638_0002966
921 Ga0495653_0017058
922 Ga0495653_0022552
923 Ga0495653_0047458
924 Ga0495650_0000108
925 Ga0495650_0000140
926 Ga0495580_0012103
927 Ga0495582_0003828
928 Ga0495582_0029620
929 Ga0495605_0001736
930 Ga0495605_0004622
931 Ga0495605_0010846
932 Ga0495605_0024015
933 Ga0495605_0026784
934 Ga0495605_0033370
935 Ga0495605_0045798
936 Ga0495584_0000006
937 Ga0495584_0001835
938 Ga0495584_0001841
939 Ga0495584_0002247
940 Ga0495584_0003129
941 Ga0495584_0013323
942 Ga0495584_0015640
943 Ga0495585_0000282
944 Ga0495585_0000926
945 Ga0495585_0003548
946 Ga0495585_0004128
947 Ga0495585_0015998
948 Ga0495585_0016685
949 Ga0495585_0019085
950 Ga0495585_0022737
951 Ga0495585_0026321
952 Ga0495585_0030642
953 Ga0495585_0070315
954 Ga0495594_0012257
955 Ga0495594_0014904
956 Ga0495594_0027573
957 Ga0495594_0065339
958 Ga0495594_0068029
959 Ga0495596_0000236
960 Ga0495596_0001429
961 Ga0495596_0003685
962 Ga0495596_0004853
963 Ga0495596_0004975
964 Ga0495596_0005735
965 Ga0495596_0008161
966 Ga0495607_0002952
967 Ga0495607_0003634
968 Ga0495607_0012015
969 Ga0495607_0018606
970 Ga0495607_0023386
971 Ga0495607_0040184
972 Ga0495607_0086821
973 Ga0495583_0000525
974 Ga0495583_0000608
975 Ga0495583_0001445
976 Ga0495583_0002759
977 Ga0495583_0004051
978 Ga0495583_0004346
979 Ga0495583_0021769
980 Ga0495583_0026390
981 Ga0495583_0034605
982 Ga0495606_0008706
983 Ga0495606_0020392
984 Ga0495606_0027660
985 Ga0495606_0060853
986 Ga0495610_0001162
987 Ga0495616_0000343
988 Ga0495616_0000680
989 Ga0495616_0001661
990 Ga0495616_0002034
991 Ga0495616_0004092
992 Ga0495616_0007916
993 Ga0495616_0008070
994 Ga0495616_0021589
995 Ga0495616_0029476
996 Ga0495616_0034327
997 Ga0495616_0097257
998 Ga0495620_0007596
999 Ga0495631_0001685
1000 Ga0495631_0002105
1001 Ga0495631_0010589
1002 Ga0495631_0012359
1003 Ga0495631_0014148
1004 Ga0495631_0014540
1005 Ga0495631_0038282
1006 Ga0495631_0053968
1007 Ga0495632_0000062
1008 Ga0495632_0000235
1009 Ga0495632_0000901
1010 Ga0495632_0002631
1011 Ga0495632_0003209
1012 Ga0495637_0000004
1013 Ga0495643_0000648
1014 Ga0495643_0009797
1015 Ga0495643_0022182
1016 Ga0495643_0025078
1017 Ga0495643_0028822
1018 Ga0495643_0037842
1019 Ga0495644_0003759
1020 Ga0495644_0010904
1021 Ga0495644_0015469
1022 Ga0495648_0000109
1023 Ga0495648_0002349
1024 Ga0495648_0003866
1025 Ga0495648_0028952
1026 Ga0495648_0030560
1027 Ga0495648_0081248
1028 Ga0495663_0003044
1029 Ga0495666_0012630
1030 Ga0495666_0019304
1031 Ga0495666_0027785
1032 Ga0495642_0000196
1033 Ga0495642_0007659
1034 Ga0495642_0018362
1035 Ga0495642_0022002
1036 Ga0495642_0116420
1037 Ga0495652_0034667
1038 Ga0495654_0007827
1039 Ga0495654_0031073
1040 Ga0495665_0016501
1041 Ga0495665_0034983
1042 Ga0495586_0002686
1043 Ga0495586_0007801
1044 Ga0495586_0023565
1045 Ga0495587_0014029
1046 Ga0495609_0000009
1047 Ga0495609_0002695
1048 Ga0495609_0003510
1049 Ga0495609_0010793
1050 Ga0495609_0013432
1051 Ga0495597_0001393
1052 Ga0495597_0001796
1053 Ga0495597_0003920
1054 Ga0495597_0009770
1055 Ga0495597_0016794
1056 Ga0495645_0074946
1057 Ga0495645_0105229
1058 Ga0495622_0012031
1059 Ga0495622_0029887
1060 Ga0495633_0008068
1061 Ga0495633_0011835
1062 Ga0495633_0014994
1063 Ga0495633_0034597
1064 Ga0495656_0004998
1065 Ga0495668_0000805
1066 Ga0495668_0002455
1067 Ga0495668_0002669
1068 Ga0495668_0010820
1069 Ga0495668_0031535
1070 Ga0495668_0045336
1071 Ga0495668_0055741
1072 Ga0495634_0033244
1073 Ga0495611_0000861
1074 Ga0495611_0011073
1075 Ga0495611_0014360
1076 Ga0495625_0009819
1077 Ga0495625_0027108
1078 Ga0495625_0045996
1079 Ga0495625_0080676
1080 Ga0495625_0131297
1081 Ga0495661_0000368
1082 Ga0495661_0001167
1083 Ga0495661_0002320
1084 Ga0495661_0002363
1085 Ga0495661_0017362
1086 Ga0495661_0022436
1087 Ga0495661_0024071
1088 Ga0495661_0024473
1089 Ga0495661_0036897
1090 Ga0495661_0050603
1091 Ga0495661_0069884
1092 Ga0495588_0000077
1093 Ga0495588_0004598
1094 Ga0495588_0013800
1095 Ga0495588_0022764
1096 Ga0495623_0029147
1097 Ga0495623_0047237
1098 Ga0495669_0000217
1099 Ga0495669_0016969
1100 Ga0495669_0049513
1101 Ga0495669_0067517
1102 Ga0495624_0018758
1103 Ga0495670_0000391
1104 Ga0495670_0009281
1105 Ga0495670_0016326
1106 Ga0495670_0021313
1107 Ga0495670_0037325
1108 Ga0495671_0000848
1109 Ga0495671_0003909
1110 Ga0495671_0018278
1111 Ga0495649_0001146
1112 Ga0495649_0004293
1113 Ga0495589_0000037
1114 Ga0495589_0001177
1115 Ga0495589_0001412
1116 Ga0495589_0013696
1117 Ga0495589_0043769
1118 Ga0495660_0000178
1119 Ga0495660_0022967
1120 Ga0495581_0009512
1121 Ga0495604_0003606
1122 Ga0495604_0059718
1123 Ga0495674_0003699
1124 Ga0495672_0000424
1125 Ga0495672_0000590
1126 Ga0495672_0002152
1127 Ga0495672_0066230
1128 Ga0495672_0104919
1129 Ga0495676_0000342
1130 Ga0495680_0015839
1131 Ga0495680_0048605
1132 Ga0495683_0000144
1133 Ga0495683_0001039
1134 Ga0495683_0004193
1135 Ga0495683_0009068
1136 Ga0495683_0022173
1137 Ga0495687_000002
1138 Ga0495687_000017
1139 Ga0495687_000024
1140 Ga0495687_001539
1141 Ga0495687_010589
1142 Ga0495675_0008085
1143 Ga0495677_0000011
1144 Ga0495677_0001358
1145 Ga0495677_0001586
1146 Ga0495677_0002619
1147 Ga0495677_0010720
1148 Ga0495679_003113
1149 Ga0495679_003713
1150 Ga0495679_011569
1151 Ga0495685_012525
1152 Ga0495681_0002294
1153 Ga0495681_0007392
1154 Ga0495681_0009181
1155 Ga0495681_0011982
1156 Ga0495681_0027321
1157 Ga0495681_0053496
1158 Ga0495686_0130207
1159 Ga0495593_0006706
1160 Ga0495593_0015080
1161 Ga0495593_0040184
1162 Ga0495602_0157696
1163 Ga0495614_0006251
1164 Ga0495614_0010600
1165 Ga0495615_0001140
1166 Ga0495626_0000004
1167 Ga0495626_0000016
1168 Ga0495626_0002550
1169 Ga0495626_0003138
1170 Ga0495626_0016542
1171 Ga0495626_0025701
1172 Ga0495626_0033369
1173 Ga0496102_0000340
1174 Ga0496102_0000461
1175 Ga0496102_0031308
1176 Ga0496102_0056486
1177 Ga0496103_0038605
1178 Ga0496103_0039131
1179 Ga0496106_0000336
1180 Ga0496106_0018536
1181 Ga0496107_0027743
1182 Ga0496109_0063011
1183 Ga0496110_0000019
1184 Ga0496110_0158452
1185 Ga0496110_0234656
1186 Ga0496111_0003186
1187 Ga0496113_0055353
1188 Ga0496113_0069951
1189 Ga0496115_0097165
1190 Ga0496116_0000042
1191 Ga0496116_0030397
1192 Ga0496117_0000010
1193 Ga0496117_0000033
1194 Ga0496117_0054884
1195 Ga0496117_0125634
1196 Ga0496118_0000009
1197 Ga0496118_0012983
1198 Ga0496118_0043993
1199 Ga0496118_0045925
1200 Ga0496119_0029172
1201 Ga0496120_0001142
1202 Ga0496120_0066610
1203 Ga0496121_0000001
1204 Ga0496121_0004353
1205 Ga0496121_0145848
1206 Ga0496122_0000835
1207 Ga0496122_0002798
1208 Ga0496122_0004501
1209 Ga0496122_0050889
1210 Ga0496122_0052373
1211 Ga0496123_0000338
1212 Ga0496123_0001003
1213 Ga0496123_0004574
1214 Ga0496124_0000080
1215 Ga0496124_0002249
1216 Ga0496124_0008260
1217 Ga0496124_0061412
1218 Ga0496124_0072866
1219 Ga0496124_0114032
1220 Ga0496124_0167740
1221 Ga0496125_0000001
1222 Ga0496125_0001280
1223 Ga0496125_0008739
1224 Ga0496125_0053573
1225 Ga0496126_0000053
1226 Ga0496126_0062520
1227 Ga0496126_0099547
1228 Ga0501308_000138
1229 Ga0495678_000515
1230 Ga0495678_000866
1231 Ga0495678_002343
1232 Ga0495678_005217
1233 Ga0495678_014253
1234 Ga0495682_0001115
1235 Ga0501033_0000050
1236 Ga0501035_0000965
1237 Ga0501035_0011491
1238 nmdc:mga00v17_33_c1
1239 nmdc:mga00v17_81_c1
1240 nmdc:mga0yw44_57688_c1
1241 nmdc:mga06z11_2959_c1
1242 nmdc:mga07m45_5127_c1
1243 nmdc:mga0sz30_21286_c1
1244 nmdc:mga0sz30_28667_c1
1245 nmdc:mga0sz30_3772_c1
1246 Ga0500560_002138
1247 Ga0500658_0003054
1248 Ga0500561_0000165
1249 Ga0500568_0000230
1250 Ga0500616_0000134
1251 Ga0500616_0000564
1252 Ga0500624_001152
1253 Ga0500633_0001107
1254 Ga0500634_0065545
1255 Ga0500636_0000038
1256 Ga0500636_0000186
1257 Ga0500637_0001211
1258 Ga0500625_009093
1259 2516206331
1260 2510306868
1261 2511170357
1262 2511500023
1263 2512974935
1264 2513586314
1265 2513603730
1266 2513618905
1267 2513883203
1268 2513904217
1269 2513987724
1270 2514004312
1271 2515612525
1272 2516206991
1273 2516897562
1274 2517567582
1275 2524449813
1276 2551674405
1277 2551686853
1278 2551690932
1279 2551702479
1280 2551714479
1281 2551715752
1282 2551730860
1283 2551732705
1284 2551735918
1285 2551740702
1286 2554249569
1287 2559298082
1288 2585233718
1289 2585266529
1290 2585387545
1291 2585390589
1292 2585396954
1293 2586004395
1294 2599335276
1295 2600196241
1296 2600374018
1297 2601612556
1298 2601749327
1299 2643802323
1300 2643808733
1301 2643856898
1302 2643917916
1303 2644064185
1304 2644106257
1305 2644146755
1306 2644297253
1307 2644310868
1308 2644334329
1309 2644376352
1310 2644416016
1311 2644449057
1312 2644475831
1313 2644492844
1314 2644519997
1315 2644545458
1316 2644616702
1317 2644655506
1318 2644673371
1319 2644692118
1320 2753461925
1321 2792624761
1322 2792629683
1323 2792643977
1324 2802718224
1325 2802725981
1326 2802731307
1327 2802736499
1328 2802744474
1329 2802749937
1330 2804754362
1331 2808989390
1332 2809145368
1333 2819242923
1334 2819557031
1335 2821126326
1336 2838079200
1337 2838718624
1338 2838723622
1339 2838737198
1340 2841842433
1341 2841845780
1342 2841851516
1343 2841863057
1344 2842129484
1345 2842142213
1346 2842145484
1347 2842174779
1348 2842191261
1349 2842215666
1350 2842228387
1351 2842519426
1352 2842927101
1353 2843692402
1354 2844166034
1355 2846036288
1356 2846038150
1357 2855830531
1358 2855845695
1359 2857532887
1360 2858805558
1361 2885085541
1362 2899846204
1363 2913300717
1364 2915986880
1365 2915987077
1366 2915997751
1367 2916001507
1368 2916011360
1369 2916014756
1370 2916025223
1371 2916032263
1372 2916039118
1373 2916045433
1374 2916051289
1375 2916059057
1376 2916063783
1377 2916069550
1378 2916081921
1379 2919104884
1380 2919119001
1381 2919170017
1382 2920761969
1383 2920822663
1384 2921203241
1385 2921209362
1386 2921239626
1387 2921244972
1388 2921253465
1389 2921263804
1390 2921269965
1391 2921283283
1392 2921294386
1393 2921304022
1394 2924146253
1395 2924155568
1396 2924162095
1397 2924170049
1398 2924176607
1399 2924180095
1400 2924199102
1401 2924202880
1402 2924209833
1403 2924216897
1404 2924227566
1405 2924230598
1406 2926759516
1407 2926765508
1408 2929140281
1409 2933016631
1410 2933598762
1411 2937001911
1412 2937004198
1413 2937011651
1414 2937017853
1415 2937028740
1416 2937035322
1417 2937040091
1418 2937046523
1419 2937052011
1420 2937057640
1421 2937065881
1422 2937077864
1423 2937079115
1424 2937085032
1425 2937097184
1426 2937102182
1427 2937107492
1428 2937116749
1429 2937125092
1430 2937132134
1431 2941505350
1432 2957376162
1433 2957385287
1434 2957394403
1435 2957402293
1436 2957405709
1437 2957410419
1438 2957415321
1439 2957423374
1440 2957434971
1441 2957440884
1442 2957453573
1443 2957459284
1444 2957465858
1445 2957471736
1446 2957482119
1447 2957484962
1448 2957495688
1449 2957502739
1450 2957510466
1451 2960588520
1452 2960597543
1453 2960601495
1454 2960605111
1455 2960614531
1456 2960628421
1457 2960636737
1458 2960639972
1459 2960650666
1460 2960654049
1461 2960670557
1462 2960686241
1463 2960690175
1464 2960696997
1465 2964609173
1466 2964621889
1467 2964628555
1468 2964634609
1469 2964641500
1470 2964645802
1471 2964654339
1472 2964658405
1473 2964666461
1474 2964673013
1475 2964682581
1476 2964691433
1477 2964697423
1478 2964703089
1479 2964711590
1480 2964715867
1481 2964721389
1482 2967665895
1483 2967672693
1484 2967682291
1485 2967689854
1486 2967697712
1487 2967702315
1488 2967707366
1489 2967718460
1490 2967727791
1491 2967733262
1492 2967740779
1493 2967748414
1494 2967751376
1495 2967761555
1496 2967764822
1497 2967771726
1498 2967778865
1499 2970023153
1500 2970031432
1501 2970035288
1502 2970044643
1503 2970050383
1504 2970060478
1505 2970068391
1506 2970070427
1507 2970079018
1508 2970094450
1509 2970102034
1510 2970108245
1511 2970114942
1512 2970119794
1513 2970127880
1514 2970133902
1515 2970142552
1516 2970147876
1517 2970155330
1518 2970161994
1519 2970168586
1520 2970176352
1521 2970181636
1522 2970184659
1523 2970197248
1524 2977522369
1525 2977536595
1526 2977542514
1527 2977548698
1528 2977554967
1529 2977559818
1530 2977568565
1531 2977577741
1532 2977583816
1533 2978970161
1534 2979095250
1535 2979097502
1536 2979102025
1537 2984510028
1538 2984519271
1539 2984538369
1540 2984587188
1541 2984605094
1542 2989349821
1543 2989777808
1544 2998345975
1545 648739277
1546 650741850
1547 8003573580
1548 8003998381
1549 8004005123
1550 8005247006
1551 8005659480
1552 8047673819
1553 8049297708
1554 8054464906

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22046

DUF6936

Family of unknown function (DUF6936)

34

464

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kia-assembly2.cif.gz_B nadh bound structure of fabmg, novel type of enoyl-acyl carrier protein reductase 0.9832 1 439
6ki9-assembly2.cif.gz_B apo structure of fabmg, novel types of enoyl-acyl carrier protein reductase 0.9826 1 441
6kia-assembly2.cif.gz_B nadh bound structure of fabmg, novel type of enoyl-acyl carrier protein reductase 0.9788 1 439
6kia-assembly3.cif.gz_C nadh bound structure of fabmg, novel type of enoyl-acyl carrier protein reductase 0.9734 1 437
6ki9-assembly3.cif.gz_C apo structure of fabmg, novel types of enoyl-acyl carrier protein reductase 0.9717 1 437
ID Description Score Start End Superfamily
1vivB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.7728 14 54 3.40.50.10490
af_Q8MNM6_143_282_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7387 16 83 3.40.50.720
af_I1MXX4_25_354_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.7357 16 51 3.40.1190.20
4bjhB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase 0.7258 16 82 3.40.50.1370
2p91A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.694 18 310 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4V2QY24-F1-model_v4 Uncharacterized protein 0.9912 1 439
AF-A0A7X7LWX0-F1-model_v4 Uncharacterized protein 0.989 95 437
AF-A0A1J5R7I7-F1-model_v4 Uncharacterized protein 0.9876 1 437
AF-H4F2C2-F1-model_v4 Uncharacterized protein 0.9873 1 386
AF-A0A498F7X6-F1-model_v4 deleted 0.9859 262 437

Map