F480401

General Info

Members Datasets Scaffolds Average Seq Length
778 267 1556 109

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10849234|Ga0070658_108492342
Length 107
Sequence MIGTAFAQSAGGSPAGMDMMSMLPIVIMFVILYFIMIRPQMRKAKEHKTMLDALAKGDEVVAVGILGRIEGISDNYLSVEIAPNTVIQVQKQAVTQLLPKGTIKSAR

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
204 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
205 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
206 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
207 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
214 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
215 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
216 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
217 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
218 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
221 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
222 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
223 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
224 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
242 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
249 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
250 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
256 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.24
Rhizosphere 95.5
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10849234 3300005327 Bacteria 793
2 JGI24752J21851_1003457 3300001976 Bacteria 2078
3 JGI24743J22301_10008236 3300001991 Bacteria 1825
4 JGI24035J26624_1004929 3300002126 Bacteria 1271
5 JGI24033J26618_1008168 3300002155 Bacteria 1201
6 JGI24751J29686_10060056 3300002459 Bacteria 783
7 Ga0065714_10199405 3300005288 Bacteria 900
8 Ga0065712_10097071 3300005290 Bacteria 2157
9 Ga0065712_10422768 3300005290 Bacteria 710
10 Ga0065715_10226336 3300005293 Bacteria 1251
11 Ga0065715_11101890 3300005293 Bacteria 520
12 Ga0065715_11108883 3300005293 Bacteria 518
13 Ga0065707_10105687 3300005295 Bacteria 2601
14 Ga0070658_10271339 3300005327 Bacteria 1443
15 Ga0070658_11398776 3300005327 Bacteria 607
16 Ga0070676_10001503 3300005328 Bacteria 11811
17 Ga0070676_10022086 3300005328 Bacteria 3567
18 Ga0070676_10108116 3300005328 Bacteria 1728
19 Ga0070676_10137267 3300005328 Bacteria 1553
20 Ga0070676_10397613 3300005328 Bacteria 958
21 Ga0070676_10696366 3300005328 Bacteria 741
22 Ga0070683_100012394 3300005329 Bacteria 7408
23 Ga0070683_100393919 3300005329 Bacteria 1321
24 Ga0070690_100001622 3300005330 Bacteria 11824
25 Ga0070690_100634905 3300005330 Bacteria 814
26 Ga0070670_100016035 3300005331 Bacteria 6430
27 Ga0070670_100072954 3300005331 Bacteria 2948
28 Ga0070670_100093166 3300005331 Bacteria 2591
29 Ga0070670_100230820 3300005331 Bacteria 1610
30 Ga0070670_100628932 3300005331 Bacteria 962
31 Ga0070670_101109651 3300005331 Bacteria 722
32 Ga0070670_101501057 3300005331 Bacteria 619
33 Ga0070677_10001330 3300005333 Bacteria 7890
34 Ga0070677_10004494 3300005333 Bacteria 4557
35 Ga0070677_10097094 3300005333 Bacteria 1292
36 Ga0070677_10443595 3300005333 Bacteria 693
37 Ga0068869_100020382 3300005334 Bacteria 4545
38 Ga0068869_100147320 3300005334 Bacteria 1823
39 Ga0068869_100579201 3300005334 Bacteria 946
40 Ga0068869_100595003 3300005334 Bacteria 934
41 Ga0070666_10022208 3300005335 Bacteria 4118
42 Ga0070666_10060883 3300005335 Bacteria 2555
43 Ga0070666_10600454 3300005335 Bacteria 803
44 Ga0070666_10966195 3300005335 Bacteria 631
45 Ga0070680_100155969 3300005336 Bacteria 1918
46 Ga0070680_100306037 3300005336 Bacteria 1348
47 Ga0068868_100007221 3300005338 Bacteria 7896
48 Ga0068868_100073739 3300005338 Bacteria 2725
49 Ga0068868_100168787 3300005338 Bacteria 1811
50 Ga0068868_100609707 3300005338 Bacteria 968
51 Ga0068868_100809299 3300005338 Bacteria 846
52 Ga0068868_101106070 3300005338 Bacteria 729
53 Ga0070660_100006963 3300005339 Bacteria 7845
54 Ga0070660_100009658 3300005339 Bacteria 6795
55 Ga0070660_100010635 3300005339 Bacteria 6505
56 Ga0070660_100027115 3300005339 Bacteria 4274
57 Ga0070689_100004833 3300005340 Bacteria 9148
58 Ga0070689_100276146 3300005340 Bacteria 1393
59 Ga0070689_100733193 3300005340 Bacteria 865
60 Ga0070689_101182021 3300005340 Unclassified 686
61 Ga0070689_101621971 3300005340 Bacteria 588
62 Ga0070687_100056484 3300005343 Bacteria 2054
63 Ga0070661_100002676 3300005344 Bacteria 12196
64 Ga0070661_100012213 3300005344 Bacteria 6005
65 Ga0070661_100013146 3300005344 Bacteria 5809
66 Ga0070661_100925427 3300005344 Bacteria 721
67 Ga0070692_10794126 3300005345 Bacteria 646
68 Ga0070668_100012194 3300005347 Bacteria 6402
69 Ga0070668_100016206 3300005347 Bacteria 5576
70 Ga0070668_100023760 3300005347 Bacteria 4639
71 Ga0070668_100122516 3300005347 Bacteria 2080
72 Ga0070668_100238673 3300005347 Bacteria 1505
73 Ga0070669_100030011 3300005353 Bacteria 3921
74 Ga0070669_100070320 3300005353 Bacteria 2587
75 Ga0070669_100126570 3300005353 Bacteria 1955
76 Ga0070669_100348886 3300005353 Bacteria 1201
77 Ga0070669_100757969 3300005353 Bacteria 823
78 Ga0070669_101177328 3300005353 Bacteria 662
79 Ga0070675_100002777 3300005354 Bacteria 13172
80 Ga0070675_100004574 3300005354 Bacteria 10561
81 Ga0070675_100014792 3300005354 Bacteria 6158
82 Ga0070675_100055887 3300005354 Bacteria 3250
83 Ga0070675_100113668 3300005354 Bacteria 2293
84 Ga0070675_100785532 3300005354 Bacteria 870
85 Ga0070675_101687151 3300005354 Bacteria 585
86 Ga0070675_101992123 3300005354 Bacteria 535
87 Ga0070671_100010529 3300005355 Bacteria 7425
88 Ga0070671_100026435 3300005355 Bacteria 4769
89 Ga0070671_100085895 3300005355 Bacteria 2632
90 Ga0070671_100282724 3300005355 Bacteria 1411
91 Ga0070674_100005067 3300005356 Bacteria 7572
92 Ga0070674_100189417 3300005356 Bacteria 1581
93 Ga0070674_100260584 3300005356 Bacteria 1366
94 Ga0070674_100957238 3300005356 Bacteria 749
95 Ga0070673_100001510 3300005364 Bacteria 13674
96 Ga0070673_100030213 3300005364 Bacteria 4050
97 Ga0070673_100051153 3300005364 Bacteria 3233
98 Ga0070673_100111726 3300005364 Bacteria 2267
99 Ga0070673_100115868 3300005364 Bacteria 2228
100 Ga0070688_100001281 3300005365 Bacteria 12524
101 Ga0070659_100000775 3300005366 Bacteria 23182
102 Ga0070659_100011020 3300005366 Bacteria 6677
103 Ga0070659_100053304 3300005366 Bacteria 3183
104 Ga0070667_100010761 3300005367 Bacteria 7560
105 Ga0070667_100050280 3300005367 Bacteria 3513
106 Ga0070667_100185355 3300005367 Bacteria 1842
107 Ga0070667_100218498 3300005367 Bacteria 1696
108 Ga0070667_100222223 3300005367 Bacteria 1681
109 Ga0070667_100796835 3300005367 Bacteria 877
110 Ga0070667_100946092 3300005367 Bacteria 803
111 Ga0070667_101162333 3300005367 Bacteria 722
112 Ga0070714_100023434 3300005435 Bacteria 5071
113 Ga0070713_100086547 3300005436 Bacteria 2687
114 Ga0070701_10011312 3300005438 Bacteria 3985
115 Ga0070701_11139293 3300005438 Bacteria 551
116 Ga0070711_100490992 3300005439 Bacteria 1011
117 Ga0070705_100101466 3300005440 Bacteria 1818
118 Ga0070705_100124178 3300005440 Bacteria 1672
119 Ga0070700_100012660 3300005441 Bacteria 4717
120 Ga0070700_100107535 3300005441 Bacteria 1849
121 Ga0070700_100217688 3300005441 Bacteria 1351
122 Ga0070700_100347025 3300005441 Bacteria 1099
123 Ga0070700_101032621 3300005441 Bacteria 678
124 Ga0070694_100082265 3300005444 Bacteria 2242
125 Ga0070694_100347937 3300005444 Bacteria 1147
126 Ga0070663_100003531 3300005455 Bacteria 9026
127 Ga0070663_100062756 3300005455 Bacteria 2680
128 Ga0070663_100070060 3300005455 Bacteria 2549
129 Ga0070663_100140407 3300005455 Bacteria 1844
130 Ga0070678_100001864 3300005456 Bacteria 11368
131 Ga0070678_100247261 3300005456 Bacteria 1494
132 Ga0070678_100867969 3300005456 Bacteria 823
133 Ga0070678_100935709 3300005456 Bacteria 794
134 Ga0070678_101997501 3300005456 Bacteria 548
135 Ga0070662_100006101 3300005457 Bacteria 7743
136 Ga0070662_100728950 3300005457 Bacteria 840
137 Ga0070681_10009268 3300005458 Bacteria 9678
138 Ga0068867_100002941 3300005459 Bacteria 11995
139 Ga0068867_100178981 3300005459 Bacteria 1685
140 Ga0068867_100337860 3300005459 Bacteria 1253
141 Ga0070685_10002100 3300005466 Bacteria 10285
142 Ga0070685_10303707 3300005466 Bacteria 1076
143 Ga0070685_10749548 3300005466 Bacteria 716
144 Ga0070707_100522552 3300005468 Bacteria 1149
145 Ga0070698_100010362 3300005471 Bacteria 9954
146 Ga0070699_100009041 3300005518 Bacteria 8632
147 Ga0070699_100071189 3300005518 Bacteria 3024
148 Ga0070699_100865217 3300005518 Bacteria 828
149 Ga0070699_101299167 3300005518 Bacteria 667
150 Ga0070679_100021908 3300005530 Bacteria 6243
151 Ga0070684_100008314 3300005535 Bacteria 8105
152 Ga0070684_100024579 3300005535 Bacteria 5056
153 Ga0070684_101743373 3300005535 Bacteria 588
154 Ga0068853_100018218 3300005539 Bacteria 5809
155 Ga0068853_100031794 3300005539 Bacteria 4466
156 Ga0068853_100034090 3300005539 Bacteria 4320
157 Ga0068853_100037786 3300005539 Bacteria 4110
158 Ga0068853_100633677 3300005539 Bacteria 1017
159 Ga0068853_100695828 3300005539 Bacteria 969
160 Ga0068853_100706697 3300005539 Bacteria 962
161 Ga0070672_100010643 3300005543 Bacteria 6387
162 Ga0070672_100052948 3300005543 Bacteria 3171
163 Ga0070672_100082201 3300005543 Bacteria 2584
164 Ga0070672_100114468 3300005543 Bacteria 2202
165 Ga0070672_100490790 3300005543 Bacteria 1061
166 Ga0070672_100592574 3300005543 Bacteria 965
167 Ga0070672_100774780 3300005543 Bacteria 843
168 Ga0070672_100801083 3300005543 Bacteria 829
169 Ga0070686_100007051 3300005544 Bacteria 6265
170 Ga0070686_100109038 3300005544 Bacteria 1883
171 Ga0070695_100313421 3300005545 Bacteria 1164
172 Ga0070695_101495921 3300005545 Bacteria 562
173 Ga0070696_101931150 3300005546 Bacteria 512
174 Ga0070693_100022314 3300005547 Bacteria 3363
175 Ga0070693_100845393 3300005547 Bacteria 682
176 Ga0070693_100934346 3300005547 Bacteria 652
177 Ga0070665_100016657 3300005548 Bacteria 7366
178 Ga0070665_100020139 3300005548 Bacteria 6698
179 Ga0070665_100032024 3300005548 Bacteria 5292
180 Ga0070665_100351881 3300005548 Bacteria 1479
181 Ga0070665_100395406 3300005548 Bacteria 1390
182 Ga0070665_100470272 3300005548 Bacteria 1268
183 Ga0070665_101827868 3300005548 Bacteria 614
184 Ga0070704_100148893 3300005549 Bacteria 1838
185 Ga0070704_100353309 3300005549 Bacteria 1241
186 Ga0068855_100002431 3300005563 Bacteria 22996
187 Ga0068855_100026060 3300005563 Bacteria 6994
188 Ga0068855_100209040 3300005563 Bacteria 2194
189 Ga0068855_101615315 3300005563 Bacteria 663
190 Ga0070664_100000232 3300005564 Bacteria 39918
191 Ga0070664_100002189 3300005564 Bacteria 15703
192 Ga0070664_100006956 3300005564 Bacteria 9118
193 Ga0070664_100042213 3300005564 Bacteria 3850
194 Ga0070664_100093292 3300005564 Bacteria 2608
195 Ga0070664_100212309 3300005564 Bacteria 1730
196 Ga0070664_100290227 3300005564 Bacteria 1477
197 Ga0070664_100635344 3300005564 Bacteria 991
198 Ga0068857_100000150 3300005577 Bacteria 43268
199 Ga0068857_100003300 3300005577 Bacteria 13405
200 Ga0068857_100186323 3300005577 Bacteria 1889
201 Ga0068854_100003871 3300005578 Bacteria 9380
202 Ga0068854_100152640 3300005578 Bacteria 1782
203 Ga0068854_100267591 3300005578 Bacteria 1371
204 Ga0068856_100000121 3300005614 Bacteria 78250
205 Ga0068856_100015939 3300005614 Bacteria 7266
206 Ga0068856_100076208 3300005614 Bacteria 3323
207 Ga0068856_102432301 3300005614 Bacteria 531
208 Ga0070702_100004941 3300005615 Bacteria 6147
209 Ga0070702_100770555 3300005615 Bacteria 741
210 Ga0068852_100002603 3300005616 Bacteria 12468
211 Ga0068852_100002736 3300005616 Bacteria 12195
212 Ga0068852_100011689 3300005616 Bacteria 6622
213 Ga0068852_100023842 3300005616 Bacteria 4934
214 Ga0068852_101303544 3300005616 Bacteria 748
215 Ga0068859_100018722 3300005617 Bacteria 6957
216 Ga0068859_100019845 3300005617 Bacteria 6747
217 Ga0068859_100157800 3300005617 Bacteria 2347
218 Ga0068859_100265691 3300005617 Bacteria 1808
219 Ga0068859_100301763 3300005617 Bacteria 1695
220 Ga0068859_100355500 3300005617 Bacteria 1560
221 Ga0068859_100413201 3300005617 Bacteria 1445
222 Ga0068859_100942312 3300005617 Bacteria 947
223 Ga0068859_101191547 3300005617 Bacteria 839
224 Ga0068864_100002176 3300005618 Bacteria 16182
225 Ga0068864_100002637 3300005618 Bacteria 14802
226 Ga0068864_100004662 3300005618 Bacteria 11247
227 Ga0068864_100255259 3300005618 Bacteria 1629
228 Ga0068864_100628760 3300005618 Bacteria 1044
229 Ga0068864_100719655 3300005618 Bacteria 976
230 Ga0068864_101593077 3300005618 Bacteria 657
231 Ga0068866_10001297 3300005718 Bacteria 10818
232 Ga0068866_10093873 3300005718 Bacteria 1640
233 Ga0068866_10286444 3300005718 Bacteria 1023
234 Ga0068861_100048238 3300005719 Bacteria 3218
235 Ga0068861_100506771 3300005719 Bacteria 1092
236 Ga0068851_10005887 3300005834 Bacteria 5581
237 Ga0068851_10006428 3300005834 Bacteria 5364
238 Ga0068851_10024417 3300005834 Bacteria 2959
239 Ga0068851_10043987 3300005834 Bacteria 2252
240 Ga0068851_10324060 3300005834 Bacteria 891
241 Ga0068870_10001159 3300005840 Bacteria 10552
242 Ga0068870_10593473 3300005840 Bacteria 752
243 Ga0068863_100007864 3300005841 Bacteria 10424
244 Ga0068863_100024596 3300005841 Bacteria 5743
245 Ga0068863_100031853 3300005841 Bacteria 5029
246 Ga0068863_100237836 3300005841 Bacteria 1758
247 Ga0068863_100313834 3300005841 Bacteria 1522
248 Ga0068863_100436622 3300005841 Bacteria 1284
249 Ga0068858_100009634 3300005842 Bacteria 9206
250 Ga0068858_100011839 3300005842 Bacteria 8224
251 Ga0068858_100183034 3300005842 Bacteria 1979
252 Ga0068858_100465717 3300005842 Bacteria 1219
253 Ga0068858_101339869 3300005842 Bacteria 705
254 Ga0068860_100011798 3300005843 Bacteria 8612
255 Ga0068860_100036564 3300005843 Bacteria 4704
256 Ga0068860_100113567 3300005843 Bacteria 2590
257 Ga0068860_100339101 3300005843 Bacteria 1478
258 Ga0068860_100401698 3300005843 Bacteria 1356
259 Ga0068860_101206294 3300005843 Bacteria 777
260 Ga0068860_101386464 3300005843 Bacteria 724
261 Ga0068860_102655485 3300005843 Bacteria 520
262 Ga0068862_100022480 3300005844 Bacteria 5275
263 Ga0068862_100175480 3300005844 Bacteria 1921
264 Ga0068862_100212643 3300005844 Bacteria 1748
265 Ga0068862_100756888 3300005844 Bacteria 945
266 Ga0068862_101822845 3300005844 Bacteria 618
267 Ga0081455_10148316 3300005937 Bacteria 1811
268 Ga0097621_100069324 3300006237 Bacteria 2912
269 Ga0097621_100459162 3300006237 Bacteria 1148
270 Ga0097621_100477861 3300006237 Bacteria 1126
271 Ga0097621_100542543 3300006237 Bacteria 1058
272 Ga0097621_101359390 3300006237 Bacteria 672
273 Ga0068871_100003356 3300006358 Bacteria 11001
274 Ga0068871_100523554 3300006358 Bacteria 1071
275 Ga0075428_100141496 3300006844 Bacteria 2616
276 Ga0075428_100884931 3300006844 Bacteria 947
277 Ga0075428_100961053 3300006844 Bacteria 905
278 Ga0075428_101247171 3300006844 Bacteria 783
279 Ga0075430_100804039 3300006846 Bacteria 775
280 Ga0075431_100193952 3300006847 Bacteria 2080
281 Ga0075431_100266062 3300006847 Bacteria 1739
282 Ga0075431_100284833 3300006847 Bacteria 1673
283 Ga0075433_10078268 3300006852 Bacteria 2913
284 Ga0075433_10326687 3300006852 Bacteria 1357
285 Ga0075433_10813455 3300006852 Bacteria 816
286 Ga0075429_100001466 3300006880 Bacteria 19392
287 Ga0068865_100041607 3300006881 Bacteria 3128
288 Ga0068865_100086000 3300006881 Bacteria 2269
289 Ga0068865_100207213 3300006881 Bacteria 1526
290 Ga0068865_101058502 3300006881 Bacteria 713
291 Ga0075436_100000090 3300006914 Bacteria 52278
292 Ga0075436_100480933 3300006914 Bacteria 907
293 Ga0097620_100018724 3300006931 Bacteria 6957
294 Ga0097620_100019845 3300006931 Bacteria 6747
295 Ga0097620_100157796 3300006931 Bacteria 2347
296 Ga0097620_100265697 3300006931 Bacteria 1808
297 Ga0097620_100301770 3300006931 Bacteria 1695
298 Ga0097620_100355481 3300006931 Bacteria 1560
299 Ga0097620_100413227 3300006931 Bacteria 1445
300 Ga0097620_100942116 3300006931 Bacteria 947
301 Ga0097620_101191387 3300006931 Bacteria 839
302 Ga0075435_100394911 3300007076 Bacteria 1189
303 Ga0075435_100547866 3300007076 Bacteria 1002
304 Ga0075435_100960126 3300007076 Bacteria 746
305 Ga0105240_10012137 3300009093 Bacteria 11926
306 Ga0111539_10019136 3300009094 Bacteria 8460
307 Ga0111539_10028889 3300009094 Bacteria 6762
308 Ga0111539_10605075 3300009094 Bacteria 1276
309 Ga0105245_10225435 3300009098 Bacteria 1810
310 Ga0105245_10387341 3300009098 Bacteria 1393
311 Ga0105245_10723645 3300009098 Bacteria 1030
312 Ga0105245_10938102 3300009098 Bacteria 908
313 Ga0105245_13040858 3300009098 Bacteria 520
314 Ga0105247_10502975 3300009101 Bacteria 883
315 Ga0105247_10549258 3300009101 Bacteria 849
316 Ga0105247_11172083 3300009101 Bacteria 610
317 Ga0114129_10024209 3300009147 Bacteria 8604
318 Ga0105243_10037337 3300009148 Bacteria 3775
319 Ga0105243_10226021 3300009148 Bacteria 1657
320 Ga0105243_11422444 3300009148 Bacteria 715
321 Ga0105241_10159687 3300009174 Bacteria 1852
322 Ga0105241_10710165 3300009174 Bacteria 918
323 Ga0105242_10018528 3300009176 Bacteria 5445
324 Ga0105242_10477994 3300009176 Bacteria 1180
325 Ga0105242_11139547 3300009176 Bacteria 796
326 Ga0105248_10066758 3300009177 Bacteria 4039
327 Ga0105248_10276502 3300009177 Bacteria 1890
328 Ga0105237_10389017 3300009545 Bacteria 1399
329 Ga0105238_10004955 3300009551 Bacteria 13167
330 Ga0105238_11512243 3300009551 Bacteria 700
331 Ga0105249_10042235 3300009553 Bacteria 4146
332 Ga0105249_10080143 3300009553 Bacteria 3032
333 Ga0105249_10633140 3300009553 Bacteria 1126
334 Ga0105239_10368054 3300010375 Bacteria 1624
335 Ga0105239_10457074 3300010375 Bacteria 1449
336 Ga0105239_11112888 3300010375 Bacteria 909
337 Ga0105246_10392365 3300011119 Bacteria 1150
338 Ga0105246_10796343 3300011119 Bacteria 838
339 Ga0157373_10000313 3300013100 Bacteria 39072
340 Ga0157373_10034594 3300013100 Bacteria 3629
341 Ga0157373_10597962 3300013100 Bacteria 803
342 Ga0157371_10001031 3300013102 Bacteria 30547
343 Ga0157371_10056458 3300013102 Bacteria 2785
344 Ga0157370_10021258 3300013104 Bacteria 6469
345 Ga0157370_10457949 3300013104 Bacteria 1172
346 Ga0157369_10010469 3300013105 Bacteria 10564
347 Ga0157369_10044535 3300013105 Bacteria 4828
348 Ga0157374_10000271 3300013296 Bacteria 48054
349 Ga0157374_10016090 3300013296 Bacteria 6572
350 Ga0157374_11035949 3300013296 Bacteria 840
351 Ga0157374_11193868 3300013296 Bacteria 782
352 Ga0157374_11670958 3300013296 Bacteria 661
353 Ga0157374_11877240 3300013296 Bacteria 625
354 Ga0157378_10014211 3300013297 Bacteria 6967
355 Ga0157378_10114479 3300013297 Bacteria 2477
356 Ga0157378_10262576 3300013297 Bacteria 1657
357 Ga0157378_10329130 3300013297 Bacteria 1486
358 Ga0157378_10915896 3300013297 Bacteria 908
359 Ga0157378_11164020 3300013297 Bacteria 810
360 Ga0157378_11857659 3300013297 Bacteria 651
361 Ga0163162_10102069 3300013306 Bacteria 2961
362 Ga0163162_10549619 3300013306 Bacteria 1283
363 Ga0163162_10858323 3300013306 Bacteria 1023
364 Ga0163162_10907284 3300013306 Bacteria 994
365 Ga0163162_11054898 3300013306 Bacteria 920
366 Ga0163162_11598569 3300013306 Bacteria 744
367 Ga0157372_10000985 3300013307 Bacteria 31124
368 Ga0157372_10014220 3300013307 Bacteria 8506
369 Ga0157375_10006967 3300013308 Bacteria 9870
370 Ga0157375_10086744 3300013308 Bacteria 3181
371 Ga0157375_10563236 3300013308 Bacteria 1300
372 Ga0157375_10708975 3300013308 Bacteria 1160
373 Ga0157375_11151346 3300013308 Bacteria 909
374 Ga0157375_11321775 3300013308 Bacteria 848
375 Ga0157375_11724389 3300013308 Bacteria 742
376 Ga0163163_10004614 3300014325 Bacteria 11764
377 Ga0163163_10055514 3300014325 Bacteria 3915
378 Ga0163163_11469032 3300014325 Bacteria 743
379 Ga0157380_10005087 3300014326 Bacteria 9182
380 Ga0157380_10056113 3300014326 Bacteria 3131
381 Ga0157380_10728088 3300014326 Bacteria 1000
382 Ga0157380_11264387 3300014326 Bacteria 784
383 Ga0182008_10118295 3300014497 Bacteria 1316
384 Ga0157377_10004602 3300014745 Bacteria 6375
385 Ga0157377_10281873 3300014745 Bacteria 1090
386 Ga0157377_10956891 3300014745 Bacteria 645
387 Ga0157379_10023535 3300014968 Bacteria 5467
388 Ga0157379_10049691 3300014968 Bacteria 3745
389 Ga0157379_10180925 3300014968 Bacteria 1905
390 Ga0157379_10636543 3300014968 Bacteria 997
391 Ga0157376_10216690 3300014969 Bacteria 1770
392 Ga0157376_10502162 3300014969 Bacteria 1192
393 Ga0163161_10050562 3300017792 Bacteria 3009
394 Ga0163161_10332084 3300017792 Bacteria 1204
395 Ga0163161_10607547 3300017792 Unclassified 902
396 Ga0207666_1000621 3300025271 Bacteria 4246
397 Ga0207673_1004119 3300025290 Bacteria 1727
398 Ga0207697_10007413 3300025315 Bacteria 4895
399 Ga0207697_10013718 3300025315 Bacteria 3376
400 Ga0207697_10017641 3300025315 Bacteria 2932
401 Ga0207656_10004803 3300025321 Bacteria 4743
402 Ga0207656_10006766 3300025321 Bacteria 4143
403 Ga0207656_10072875 3300025321 Bacteria 1530
404 Ga0207656_10182260 3300025321 Bacteria 1008
405 Ga0207656_10308176 3300025321 Bacteria 785
406 Ga0207713_1238909 3300025735 Bacteria 540
407 Ga0207653_10121641 3300025885 Bacteria 940
408 Ga0207682_10000731 3300025893 Bacteria 15253
409 Ga0207682_10001222 3300025893 Bacteria 11869
410 Ga0207682_10164761 3300025893 Bacteria 1006
411 Ga0207642_10034543 3300025899 Bacteria 2151
412 Ga0207642_10070216 3300025899 Bacteria 1664
413 Ga0207642_11028871 3300025899 Bacteria 531
414 Ga0207710_10459065 3300025900 Bacteria 658
415 Ga0207688_10005395 3300025901 Bacteria 6947
416 Ga0207688_10134775 3300025901 Bacteria 1449
417 Ga0207688_10292030 3300025901 Bacteria 995
418 Ga0207688_10408283 3300025901 Bacteria 843
419 Ga0207680_10026583 3300025903 Bacteria 3210
420 Ga0207680_10196791 3300025903 Bacteria 1371
421 Ga0207680_10265174 3300025903 Bacteria 1190
422 Ga0207680_10632500 3300025903 Bacteria 766
423 Ga0207645_10000077 3300025907 Bacteria 69960
424 Ga0207645_10003858 3300025907 Bacteria 11218
425 Ga0207645_10031496 3300025907 Bacteria 3411
426 Ga0207645_10086857 3300025907 Bacteria 2010
427 Ga0207645_10112486 3300025907 Bacteria 1763
428 Ga0207643_10000267 3300025908 Bacteria 36372
429 Ga0207643_10009075 3300025908 Bacteria 5341
430 Ga0207643_10197608 3300025908 Bacteria 1223
431 Ga0207643_10251539 3300025908 Bacteria 1089
432 Ga0207705_10102076 3300025909 Bacteria 2111
433 Ga0207705_10164440 3300025909 Bacteria 1668
434 Ga0207705_11328132 3300025909 Bacteria 548
435 Ga0207705_11345050 3300025909 Bacteria 544
436 Ga0207684_10910169 3300025910 Bacteria 739
437 Ga0207684_11293719 3300025910 Unclassified 601
438 Ga0207654_10078915 3300025911 Bacteria 1976
439 Ga0207695_10030233 3300025913 Bacteria 5966
440 Ga0207671_10262845 3300025914 Bacteria 1358
441 Ga0207663_10362553 3300025916 Bacteria 1100
442 Ga0207660_10241528 3300025917 Bacteria 1423
443 Ga0207662_10006514 3300025918 Bacteria 6308
444 Ga0207662_10454652 3300025918 Bacteria 876
445 Ga0207657_10000995 3300025919 Bacteria 30092
446 Ga0207657_10012006 3300025919 Bacteria 8567
447 Ga0207657_10023022 3300025919 Bacteria 5812
448 Ga0207657_11216459 3300025919 Bacteria 572
449 Ga0207649_10001599 3300025920 Bacteria 13166
450 Ga0207649_10010084 3300025920 Bacteria 5183
451 Ga0207649_10332081 3300025920 Bacteria 1120
452 Ga0207649_10438155 3300025920 Bacteria 984
453 Ga0207652_10096692 3300025921 Bacteria 2602
454 Ga0207646_10739072 3300025922 Bacteria 878
455 Ga0207681_10016081 3300025923 Bacteria 4674
456 Ga0207681_10045524 3300025923 Bacteria 2946
457 Ga0207681_10140279 3300025923 Bacteria 1799
458 Ga0207681_10236080 3300025923 Bacteria 1421
459 Ga0207681_10549388 3300025923 Bacteria 950
460 Ga0207681_10880908 3300025923 Bacteria 749
461 Ga0207694_10006116 3300025924 Bacteria 9202
462 Ga0207650_10001468 3300025925 Bacteria 16928
463 Ga0207650_10002076 3300025925 Bacteria 14007
464 Ga0207650_10018406 3300025925 Bacteria 4903
465 Ga0207650_10050188 3300025925 Bacteria 3084
466 Ga0207650_10192049 3300025925 Bacteria 1632
467 Ga0207650_10256187 3300025925 Bacteria 1418
468 Ga0207650_10876201 3300025925 Bacteria 762
469 Ga0207659_10015519 3300025926 Bacteria 4938
470 Ga0207659_10019297 3300025926 Bacteria 4485
471 Ga0207659_10024323 3300025926 Bacteria 4056
472 Ga0207659_10116057 3300025926 Bacteria 2043
473 Ga0207659_10228355 3300025926 Bacteria 1500
474 Ga0207659_10447171 3300025926 Bacteria 1088
475 Ga0207659_10668894 3300025926 Bacteria 888
476 Ga0207659_10827963 3300025926 Bacteria 795
477 Ga0207687_10241733 3300025927 Bacteria 1431
478 Ga0207687_10264097 3300025927 Bacteria 1373
479 Ga0207664_10004425 3300025929 Bacteria 9514
480 Ga0207644_10003838 3300025931 Bacteria 9735
481 Ga0207644_10045114 3300025931 Bacteria 3134
482 Ga0207644_10051893 3300025931 Bacteria 2945
483 Ga0207644_10196207 3300025931 Bacteria 1590
484 Ga0207644_11369743 3300025931 Bacteria 594
485 Ga0207690_10002015 3300025932 Bacteria 12446
486 Ga0207690_10002295 3300025932 Bacteria 11669
487 Ga0207690_10542396 3300025932 Bacteria 945
488 Ga0207706_10000351 3300025933 Bacteria 49664
489 Ga0207706_10000644 3300025933 Bacteria 37010
490 Ga0207706_10195577 3300025933 Bacteria 1774
491 Ga0207706_10580662 3300025933 Bacteria 964
492 Ga0207686_10011883 3300025934 Bacteria 4778
493 Ga0207686_10208009 3300025934 Bacteria 1405
494 Ga0207686_10895893 3300025934 Bacteria 716
495 Ga0207709_10197535 3300025935 Bacteria 1434
496 Ga0207709_11038912 3300025935 Bacteria 671
497 Ga0207670_10577658 3300025936 Bacteria 921
498 Ga0207670_10816565 3300025936 Bacteria 777
499 Ga0207669_10000673 3300025937 Bacteria 14737
500 Ga0207669_10001618 3300025937 Bacteria 9580
501 Ga0207669_10093030 3300025937 Bacteria 1969
502 Ga0207669_10681769 3300025937 Bacteria 843
503 Ga0207704_10079745 3300025938 Bacteria 2111
504 Ga0207704_10258726 3300025938 Bacteria 1311
505 Ga0207704_10331098 3300025938 Bacteria 1178
506 Ga0207704_10626159 3300025938 Bacteria 884
507 Ga0207691_10000499 3300025940 Bacteria 39022
508 Ga0207691_10007167 3300025940 Bacteria 10755
509 Ga0207691_10057572 3300025940 Bacteria 3536
510 Ga0207691_10112859 3300025940 Bacteria 2415
511 Ga0207691_10117738 3300025940 Bacteria 2357
512 Ga0207691_10282445 3300025940 Bacteria 1428
513 Ga0207691_10961484 3300025940 Bacteria 713
514 Ga0207691_11071093 3300025940 Bacteria 671
515 Ga0207691_11071907 3300025940 Bacteria 671
516 Ga0207691_11330143 3300025940 Bacteria 593
517 Ga0207711_10028179 3300025941 Bacteria 4725
518 Ga0207711_10065246 3300025941 Bacteria 3147
519 Ga0207689_10001154 3300025942 Bacteria 25407
520 Ga0207689_10049737 3300025942 Bacteria 3458
521 Ga0207689_10212191 3300025942 Bacteria 1600
522 Ga0207689_10742948 3300025942 Bacteria 828
523 Ga0207661_10020377 3300025944 Bacteria 4956
524 Ga0207661_10474595 3300025944 Bacteria 1141
525 Ga0207661_10635210 3300025944 Bacteria 981
526 Ga0207679_10006231 3300025945 Bacteria 7528
527 Ga0207679_10014817 3300025945 Bacteria 5136
528 Ga0207679_10018627 3300025945 Bacteria 4655
529 Ga0207679_10118655 3300025945 Bacteria 2102
530 Ga0207679_10801880 3300025945 Bacteria 858
531 Ga0207679_11569957 3300025945 Bacteria 603
532 Ga0207667_10001918 3300025949 Bacteria 26099
533 Ga0207667_10009543 3300025949 Bacteria 11419
534 Ga0207667_10296162 3300025949 Bacteria 1653
535 Ga0207667_11071085 3300025949 Bacteria 790
536 Ga0207651_10020462 3300025960 Bacteria 3994
537 Ga0207651_10033189 3300025960 Bacteria 3326
538 Ga0207651_10062789 3300025960 Bacteria 2590
539 Ga0207651_10346528 3300025960 Bacteria 1249
540 Ga0207651_10478610 3300025960 Bacteria 1073
541 Ga0207651_10582587 3300025960 Bacteria 976
542 Ga0207712_10087166 3300025961 Bacteria 2289
543 Ga0207668_10022978 3300025972 Bacteria 3999
544 Ga0207668_10029010 3300025972 Bacteria 3623
545 Ga0207668_10106152 3300025972 Bacteria 2097
546 Ga0207668_10134880 3300025972 Bacteria 1890
547 Ga0207668_10196695 3300025972 Bacteria 1602
548 Ga0207668_10405630 3300025972 Bacteria 1153
549 Ga0207668_10545310 3300025972 Bacteria 1004
550 Ga0207640_10022374 3300025981 Bacteria 3782
551 Ga0207640_10167130 3300025981 Bacteria 1635
552 Ga0207658_10002918 3300025986 Bacteria 12240
553 Ga0207658_10080416 3300025986 Bacteria 2496
554 Ga0207658_10148288 3300025986 Bacteria 1908
555 Ga0207658_10382099 3300025986 Bacteria 1234
556 Ga0207658_10673874 3300025986 Bacteria 933
557 Ga0207658_10914442 3300025986 Bacteria 799
558 Ga0207677_10014097 3300026023 Bacteria 4655
559 Ga0207677_10074342 3300026023 Bacteria 2411
560 Ga0207677_10130185 3300026023 Bacteria 1909
561 Ga0207677_10615527 3300026023 Bacteria 954
562 Ga0207703_10006351 3300026035 Bacteria 9447
563 Ga0207703_10029206 3300026035 Bacteria 4349
564 Ga0207703_10227974 3300026035 Bacteria 1669
565 Ga0207703_10294263 3300026035 Bacteria 1478
566 Ga0207703_10432352 3300026035 Bacteria 1227
567 Ga0207703_10947339 3300026035 Bacteria 825
568 Ga0207639_10012950 3300026041 Bacteria 5820
569 Ga0207639_10043737 3300026041 Bacteria 3364
570 Ga0207639_10068759 3300026041 Bacteria 2761
571 Ga0207639_10265685 3300026041 Bacteria 1503
572 Ga0207639_11250933 3300026041 Bacteria 697
573 Ga0207678_10002008 3300026067 Bacteria 18521
574 Ga0207678_10008115 3300026067 Bacteria 9256
575 Ga0207678_10131754 3300026067 Bacteria 2133
576 Ga0207678_10211775 3300026067 Bacteria 1658
577 Ga0207678_10557235 3300026067 Bacteria 1003
578 Ga0207708_10013301 3300026075 Bacteria 6146
579 Ga0207708_10496630 3300026075 Bacteria 1022
580 Ga0207708_10677684 3300026075 Bacteria 880
581 Ga0207708_11618776 3300026075 Bacteria 569
582 Ga0207702_10001905 3300026078 Bacteria 20378
583 Ga0207702_10002122 3300026078 Bacteria 19074
584 Ga0207702_10127510 3300026078 Bacteria 2286
585 Ga0207641_10009454 3300026088 Bacteria 8032
586 Ga0207641_10143293 3300026088 Bacteria 2158
587 Ga0207641_10505166 3300026088 Bacteria 1174
588 Ga0207641_10806140 3300026088 Bacteria 929
589 Ga0207648_10000589 3300026089 Bacteria 40773
590 Ga0207648_10007227 3300026089 Bacteria 10946
591 Ga0207648_10043114 3300026089 Bacteria 3962
592 Ga0207648_10612301 3300026089 Bacteria 1004
593 Ga0207648_10632523 3300026089 Bacteria 988
594 Ga0207676_10011120 3300026095 Bacteria 6425
595 Ga0207676_10022772 3300026095 Bacteria 4611
596 Ga0207676_10032647 3300026095 Bacteria 3925
597 Ga0207676_10044387 3300026095 Bacteria 3429
598 Ga0207676_10612502 3300026095 Bacteria 1047
599 Ga0207676_11539202 3300026095 Bacteria 662
600 Ga0207674_10000369 3300026116 Bacteria 58569
601 Ga0207674_10003357 3300026116 Bacteria 19642
602 Ga0207674_10062151 3300026116 Bacteria 3772
603 Ga0207675_100003777 3300026118 Bacteria 14745
604 Ga0207675_100179829 3300026118 Bacteria 2025
605 Ga0207675_100487653 3300026118 Bacteria 1226
606 Ga0207675_100823092 3300026118 Bacteria 943
607 Ga0207675_101976035 3300026118 Bacteria 601
608 Ga0207683_10000280 3300026121 Bacteria 45558
609 Ga0207683_10008777 3300026121 Bacteria 8631
610 Ga0207683_10163908 3300026121 Bacteria 2011
611 Ga0207683_10298674 3300026121 Bacteria 1473
612 Ga0207683_10391339 3300026121 Bacteria 1278
613 Ga0207683_12030082 3300026121 Bacteria 523
614 Ga0207698_10002438 3300026142 Bacteria 11017
615 Ga0207698_10007795 3300026142 Bacteria 6728
616 Ga0207698_10012550 3300026142 Bacteria 5551
617 Ga0207698_10483629 3300026142 Bacteria 1201
618 Ga0207698_10499894 3300026142 Bacteria 1183
619 Ga0207698_10695561 3300026142 Bacteria 1011
620 Ga0207698_10767394 3300026142 Bacteria 964
621 Ga0209969_1012137 3300027360 Bacteria 1240
622 Ga0209981_1020177 3300027378 Bacteria 949
623 Ga0209982_1023254 3300027552 Bacteria 959
624 Ga0210002_1003266 3300027617 Bacteria 2381
625 Ga0209983_1034032 3300027665 Bacteria 1091
626 Ga0209974_10012607 3300027876 Bacteria 2824
627 Ga0268266_10010702 3300028379 Bacteria 7993
628 Ga0268266_10061589 3300028379 Bacteria 3236
629 Ga0268266_10081640 3300028379 Bacteria 2819
630 Ga0268266_10118388 3300028379 Bacteria 2355
631 Ga0268266_10485486 3300028379 Bacteria 1178
632 Ga0268266_10525897 3300028379 Bacteria 1131
633 Ga0268265_10002348 3300028380 Bacteria 14344
634 Ga0268265_10193807 3300028380 Bacteria 1757
635 Ga0268265_10271622 3300028380 Bacteria 1512
636 Ga0268265_10291964 3300028380 Bacteria 1464
637 Ga0268265_11263326 3300028380 Bacteria 738
638 Ga0268265_12235683 3300028380 Bacteria 554
639 Ga0268264_10053919 3300028381 Bacteria 3356
640 Ga0268264_10132723 3300028381 Bacteria 2210
641 Ga0268264_10323419 3300028381 Bacteria 1459
642 Ga0268264_10633718 3300028381 Bacteria 1056
643 Ga0268264_10685940 3300028381 Bacteria 1016
644 Ga0268264_11203575 3300028381 Bacteria 767
645 Ga0307408_100004193 3300031548 Bacteria 9824
646 Ga0307408_100025686 3300031548 Bacteria 4036
647 Ga0307408_100214262 3300031548 Bacteria 1567
648 Ga0307408_101558061 3300031548 Bacteria 626
649 Ga0307408_101964382 3300031548 Bacteria 562
650 Ga0307405_10009760 3300031731 Bacteria 4936
651 Ga0307405_10017861 3300031731 Bacteria 3902
652 Ga0307413_10003113 3300031824 Bacteria 6910
653 Ga0307413_10426152 3300031824 Bacteria 1046
654 Ga0307413_10934435 3300031824 Bacteria 739
655 Ga0307410_10000921 3300031852 Bacteria 12567
656 Ga0307410_10004177 3300031852 Bacteria 7413
657 Ga0307410_10019754 3300031852 Bacteria 4106
658 Ga0307406_10006332 3300031901 Bacteria 6531
659 Ga0307406_10010231 3300031901 Bacteria 5286
660 Ga0307406_10022446 3300031901 Bacteria 3745
661 Ga0307407_10221143 3300031903 Bacteria 1280
662 Ga0307407_10364164 3300031903 Bacteria 1027
663 Ga0307412_10014385 3300031911 Bacteria 4665
664 Ga0307412_10056819 3300031911 Bacteria 2610
665 Ga0307412_10374120 3300031911 Bacteria 1151
666 Ga0307409_100014278 3300031995 Bacteria 5157
667 Ga0307409_100041375 3300031995 Bacteria 3441
668 Ga0307409_100293166 3300031995 Bacteria 1509
669 Ga0307409_100431529 3300031995 Bacteria 1267
670 Ga0307409_100998311 3300031995 Bacteria 855
671 Ga0307409_101370316 3300031995 Bacteria 733
672 Ga0307416_100008070 3300032002 Bacteria 6750
673 Ga0307416_100011450 3300032002 Bacteria 5917
674 Ga0307416_100161589 3300032002 Bacteria 2071
675 Ga0307416_100723920 3300032002 Bacteria 1086
676 Ga0307414_10038539 3300032004 Bacteria 3211
677 Ga0307411_10026945 3300032005 Bacteria 3468
678 Ga0307411_10034405 3300032005 Bacteria 3153
679 Ga0307411_10304856 3300032005 Bacteria 1279
680 Ga0307411_10433224 3300032005 Bacteria 1095
681 Ga0307415_100008244 3300032126 Bacteria 5766
682 Ga0307415_100057098 3300032126 Bacteria 2680
683 Ga0307415_100459567 3300032126 Bacteria 1103
684 Ga0373928_0126764 3300035084 Bacteria 689
685 Ga0373934_0262230 3300035086 Bacteria 715
686 Ga0373939_0011443 3300035114 Bacteria 2239
687 Ga0373939_0268991 3300035114 Bacteria 669
688 Ga0373960_0092328 3300035121 Bacteria 970
689 Ga0373943_0134767 3300035170 Bacteria 1325
690 Ga0373943_0193549 3300035170 Bacteria 1123
691 Ga0373931_0199995 3300035691 Bacteria 1193
692 Ga0373931_0338925 3300035691 Bacteria 938
693 Ga0373931_0417201 3300035691 Bacteria 853
694 Ga0373931_0487697 3300035691 Bacteria 793
695 Ga0373933_0226619 3300035724 Bacteria 1200
696 Ga0373937_0130248 3300036401 Bacteria 2349
697 Ga0373937_1404752 3300036401 Bacteria 646
698 Ga0373925_1106113 3300037068 Bacteria 652
699 Ga0436365_1105890 3300039437 Bacteria 815
700 Ga0451793_0975526 3300041452 Bacteria 701
701 Ga0451849_1474642 3300041505 Bacteria 557
702 Ga0450889_046187 3300042144 Bacteria 531
703 Ga0439435_0053313 3300042436 Bacteria 1163
704 Ga0466963_0400401 3300044694 Bacteria 968
705 Ga0453684_0751244 3300044712 Bacteria 1056
706 Ga0451576_0189580 3300045051 Bacteria 2147
707 Ga0451576_0282070 3300045051 Bacteria 1737
708 Ga0495584_0460235 3300046491 Bacteria 647
709 Ga0495620_0237679 3300046515 Bacteria 696
710 Ga0495642_0036626 3300046528 Bacteria 1983
711 Ga0495642_0200515 3300046528 Bacteria 870
712 Ga0495598_0021341 3300046537 Bacteria 1722
713 Ga0495621_0035684 3300046539 Bacteria 1723
714 Ga0495621_0039462 3300046539 Bacteria 1651
715 Ga0495669_0516472 3300046684 Bacteria 581
716 Ga0496100_0046877 3300048903 Bacteria 2782
717 Ga0496100_0256183 3300048903 Bacteria 1296
718 Ga0496101_0009002 3300048904 Bacteria 6545
719 Ga0496101_0020149 3300048904 Bacteria 4561
720 Ga0496101_0758263 3300048904 Bacteria 766
721 Ga0496102_0002745 3300048905 Bacteria 15008
722 Ga0496104_0011927 3300048907 Bacteria 7796
723 Ga0496105_0045848 3300048908 Bacteria 3607
724 Ga0496105_0451466 3300048908 Bacteria 1015
725 Ga0496106_0002746 3300048909 Bacteria 13028
726 Ga0496106_0036069 3300048909 Bacteria 3699
727 Ga0496106_0505509 3300048909 Bacteria 971
728 Ga0496107_0014219 3300048910 Bacteria 5573
729 Ga0496107_0015023 3300048910 Bacteria 5424
730 Ga0496108_0047549 3300048911 Bacteria 3586
731 Ga0496108_0709071 3300048911 Bacteria 872
732 Ga0496108_1442396 3300048911 Bacteria 574
733 Ga0496109_0003042 3300048912 Bacteria 13979
734 Ga0496109_0156168 3300048912 Bacteria 2137
735 Ga0496109_0662476 3300048912 Bacteria 981
736 Ga0496110_0031041 3300048913 Bacteria 4609
737 Ga0496110_0761389 3300048913 Bacteria 872
738 Ga0496110_1312691 3300048913 Bacteria 633
739 Ga0496110_1373744 3300048913 Bacteria 616
740 Ga0496111_0293967 3300048914 Bacteria 1204
741 Ga0496111_0967940 3300048914 Bacteria 611
742 Ga0496112_0001624 3300048915 Bacteria 17413
743 Ga0496112_1306990 3300048915 Bacteria 641
744 Ga0496113_0184766 3300048916 Bacteria 1653
745 Ga0496114_0013013 3300048917 Bacteria 6667
746 Ga0496114_0311744 3300048917 Bacteria 1390
747 Ga0496115_0336813 3300048918 Bacteria 1232
748 Ga0501299_039631 3300049522 Bacteria 941
749 Ga0501036_0159495 3300049572 Bacteria 1902
750 Ga0501037_0516346 3300049573 Bacteria 809
751 Ga0501038_0510783 3300049574 Bacteria 918
752 Ga0501042_0103549 3300049578 Bacteria 2048
753 Ga0501046_0276807 3300049580 Bacteria 1230
754 Ga0501048_0507070 3300049582 Bacteria 865
755 Ga0501068_0187553 3300049584 Bacteria 1309
756 Ga0501069_0247972 3300049585 Bacteria 1038
757 Ga0501071_0013804 3300049587 Bacteria 5512
758 Ga0501072_0076776 3300049588 Bacteria 2643
759 Ga0501074_0256221 3300049590 Bacteria 1244
760 Ga0501075_0041836 3300049591 Bacteria 3434
761 Ga0501076_0359855 3300049592 Bacteria 1195
762 Ga0501199_070975 3300049650 Bacteria 500
763 Ga0501079_0742699 3300049741 Bacteria 772
764 Ga0501080_0006311 3300049742 Bacteria 10637
765 nmdc:mga05p37_224_c1 3300050507 Bacteria 57339
766 nmdc:mga09592_4452_c1 3300050508 Bacteria 11337
767 nmdc:mga0qj67_885756_c1 3300050509 Bacteria 704
768 nmdc:mga06r32_39490_c1 3300050510 Bacteria 4478
769 nmdc:mga06r32_575548_c1 3300050510 Bacteria 1099
770 nmdc:mga0n895_148965_c1 3300050512 Bacteria 2369
771 nmdc:mga0rr50_381258_c1 3300050513 Bacteria 1189
772 nmdc:mga0rr50_811685_c1 3300050513 Bacteria 798
773 nmdc:mga08x19_281_c1 3300050514 Bacteria 38370
774 nmdc:mga08x19_480139_c1 3300050514 Bacteria 876
775 nmdc:mga0a205_137424_c1 3300050515 Bacteria 2344
776 nmdc:mga0a205_832073_c1 3300050515 Bacteria 770
777 Ga0501084_0239283 3300054114 Bacteria 1532
778 Ga0501082_0174480 3300060353 Bacteria 1869
779 Ga0070658_10849234
780 JGI24752J21851_1003457
781 JGI24743J22301_10008236
782 JGI24035J26624_1004929
783 JGI24033J26618_1008168
784 JGI24751J29686_10060056
785 Ga0065714_10199405
786 Ga0065712_10097071
787 Ga0065712_10422768
788 Ga0065715_10226336
789 Ga0065715_11101890
790 Ga0065715_11108883
791 Ga0065707_10105687
792 Ga0070658_10271339
793 Ga0070658_11398776
794 Ga0070676_10001503
795 Ga0070676_10022086
796 Ga0070676_10108116
797 Ga0070676_10137267
798 Ga0070676_10397613
799 Ga0070676_10696366
800 Ga0070683_100012394
801 Ga0070683_100393919
802 Ga0070690_100001622
803 Ga0070690_100634905
804 Ga0070670_100016035
805 Ga0070670_100072954
806 Ga0070670_100093166
807 Ga0070670_100230820
808 Ga0070670_100628932
809 Ga0070670_101109651
810 Ga0070670_101501057
811 Ga0070677_10001330
812 Ga0070677_10004494
813 Ga0070677_10097094
814 Ga0070677_10443595
815 Ga0068869_100020382
816 Ga0068869_100147320
817 Ga0068869_100579201
818 Ga0068869_100595003
819 Ga0070666_10022208
820 Ga0070666_10060883
821 Ga0070666_10600454
822 Ga0070666_10966195
823 Ga0070680_100155969
824 Ga0070680_100306037
825 Ga0068868_100007221
826 Ga0068868_100073739
827 Ga0068868_100168787
828 Ga0068868_100609707
829 Ga0068868_100809299
830 Ga0068868_101106070
831 Ga0070660_100006963
832 Ga0070660_100009658
833 Ga0070660_100010635
834 Ga0070660_100027115
835 Ga0070689_100004833
836 Ga0070689_100276146
837 Ga0070689_100733193
838 Ga0070689_101182021
839 Ga0070689_101621971
840 Ga0070687_100056484
841 Ga0070661_100002676
842 Ga0070661_100012213
843 Ga0070661_100013146
844 Ga0070661_100925427
845 Ga0070692_10794126
846 Ga0070668_100012194
847 Ga0070668_100016206
848 Ga0070668_100023760
849 Ga0070668_100122516
850 Ga0070668_100238673
851 Ga0070669_100030011
852 Ga0070669_100070320
853 Ga0070669_100126570
854 Ga0070669_100348886
855 Ga0070669_100757969
856 Ga0070669_101177328
857 Ga0070675_100002777
858 Ga0070675_100004574
859 Ga0070675_100014792
860 Ga0070675_100055887
861 Ga0070675_100113668
862 Ga0070675_100785532
863 Ga0070675_101687151
864 Ga0070675_101992123
865 Ga0070671_100010529
866 Ga0070671_100026435
867 Ga0070671_100085895
868 Ga0070671_100282724
869 Ga0070674_100005067
870 Ga0070674_100189417
871 Ga0070674_100260584
872 Ga0070674_100957238
873 Ga0070673_100001510
874 Ga0070673_100030213
875 Ga0070673_100051153
876 Ga0070673_100111726
877 Ga0070673_100115868
878 Ga0070688_100001281
879 Ga0070659_100000775
880 Ga0070659_100011020
881 Ga0070659_100053304
882 Ga0070667_100010761
883 Ga0070667_100050280
884 Ga0070667_100185355
885 Ga0070667_100218498
886 Ga0070667_100222223
887 Ga0070667_100796835
888 Ga0070667_100946092
889 Ga0070667_101162333
890 Ga0070714_100023434
891 Ga0070713_100086547
892 Ga0070701_10011312
893 Ga0070701_11139293
894 Ga0070711_100490992
895 Ga0070705_100101466
896 Ga0070705_100124178
897 Ga0070700_100012660
898 Ga0070700_100107535
899 Ga0070700_100217688
900 Ga0070700_100347025
901 Ga0070700_101032621
902 Ga0070694_100082265
903 Ga0070694_100347937
904 Ga0070663_100003531
905 Ga0070663_100062756
906 Ga0070663_100070060
907 Ga0070663_100140407
908 Ga0070678_100001864
909 Ga0070678_100247261
910 Ga0070678_100867969
911 Ga0070678_100935709
912 Ga0070678_101997501
913 Ga0070662_100006101
914 Ga0070662_100728950
915 Ga0070681_10009268
916 Ga0068867_100002941
917 Ga0068867_100178981
918 Ga0068867_100337860
919 Ga0070685_10002100
920 Ga0070685_10303707
921 Ga0070685_10749548
922 Ga0070707_100522552
923 Ga0070698_100010362
924 Ga0070699_100009041
925 Ga0070699_100071189
926 Ga0070699_100865217
927 Ga0070699_101299167
928 Ga0070679_100021908
929 Ga0070684_100008314
930 Ga0070684_100024579
931 Ga0070684_101743373
932 Ga0068853_100018218
933 Ga0068853_100031794
934 Ga0068853_100034090
935 Ga0068853_100037786
936 Ga0068853_100633677
937 Ga0068853_100695828
938 Ga0068853_100706697
939 Ga0070672_100010643
940 Ga0070672_100052948
941 Ga0070672_100082201
942 Ga0070672_100114468
943 Ga0070672_100490790
944 Ga0070672_100592574
945 Ga0070672_100774780
946 Ga0070672_100801083
947 Ga0070686_100007051
948 Ga0070686_100109038
949 Ga0070695_100313421
950 Ga0070695_101495921
951 Ga0070696_101931150
952 Ga0070693_100022314
953 Ga0070693_100845393
954 Ga0070693_100934346
955 Ga0070665_100016657
956 Ga0070665_100020139
957 Ga0070665_100032024
958 Ga0070665_100351881
959 Ga0070665_100395406
960 Ga0070665_100470272
961 Ga0070665_101827868
962 Ga0070704_100148893
963 Ga0070704_100353309
964 Ga0068855_100002431
965 Ga0068855_100026060
966 Ga0068855_100209040
967 Ga0068855_101615315
968 Ga0070664_100000232
969 Ga0070664_100002189
970 Ga0070664_100006956
971 Ga0070664_100042213
972 Ga0070664_100093292
973 Ga0070664_100212309
974 Ga0070664_100290227
975 Ga0070664_100635344
976 Ga0068857_100000150
977 Ga0068857_100003300
978 Ga0068857_100186323
979 Ga0068854_100003871
980 Ga0068854_100152640
981 Ga0068854_100267591
982 Ga0068856_100000121
983 Ga0068856_100015939
984 Ga0068856_100076208
985 Ga0068856_102432301
986 Ga0070702_100004941
987 Ga0070702_100770555
988 Ga0068852_100002603
989 Ga0068852_100002736
990 Ga0068852_100011689
991 Ga0068852_100023842
992 Ga0068852_101303544
993 Ga0068859_100018722
994 Ga0068859_100019845
995 Ga0068859_100157800
996 Ga0068859_100265691
997 Ga0068859_100301763
998 Ga0068859_100355500
999 Ga0068859_100413201
1000 Ga0068859_100942312
1001 Ga0068859_101191547
1002 Ga0068864_100002176
1003 Ga0068864_100002637
1004 Ga0068864_100004662
1005 Ga0068864_100255259
1006 Ga0068864_100628760
1007 Ga0068864_100719655
1008 Ga0068864_101593077
1009 Ga0068866_10001297
1010 Ga0068866_10093873
1011 Ga0068866_10286444
1012 Ga0068861_100048238
1013 Ga0068861_100506771
1014 Ga0068851_10005887
1015 Ga0068851_10006428
1016 Ga0068851_10024417
1017 Ga0068851_10043987
1018 Ga0068851_10324060
1019 Ga0068870_10001159
1020 Ga0068870_10593473
1021 Ga0068863_100007864
1022 Ga0068863_100024596
1023 Ga0068863_100031853
1024 Ga0068863_100237836
1025 Ga0068863_100313834
1026 Ga0068863_100436622
1027 Ga0068858_100009634
1028 Ga0068858_100011839
1029 Ga0068858_100183034
1030 Ga0068858_100465717
1031 Ga0068858_101339869
1032 Ga0068860_100011798
1033 Ga0068860_100036564
1034 Ga0068860_100113567
1035 Ga0068860_100339101
1036 Ga0068860_100401698
1037 Ga0068860_101206294
1038 Ga0068860_101386464
1039 Ga0068860_102655485
1040 Ga0068862_100022480
1041 Ga0068862_100175480
1042 Ga0068862_100212643
1043 Ga0068862_100756888
1044 Ga0068862_101822845
1045 Ga0081455_10148316
1046 Ga0097621_100069324
1047 Ga0097621_100459162
1048 Ga0097621_100477861
1049 Ga0097621_100542543
1050 Ga0097621_101359390
1051 Ga0068871_100003356
1052 Ga0068871_100523554
1053 Ga0075428_100141496
1054 Ga0075428_100884931
1055 Ga0075428_100961053
1056 Ga0075428_101247171
1057 Ga0075430_100804039
1058 Ga0075431_100193952
1059 Ga0075431_100266062
1060 Ga0075431_100284833
1061 Ga0075433_10078268
1062 Ga0075433_10326687
1063 Ga0075433_10813455
1064 Ga0075429_100001466
1065 Ga0068865_100041607
1066 Ga0068865_100086000
1067 Ga0068865_100207213
1068 Ga0068865_101058502
1069 Ga0075436_100000090
1070 Ga0075436_100480933
1071 Ga0097620_100018724
1072 Ga0097620_100019845
1073 Ga0097620_100157796
1074 Ga0097620_100265697
1075 Ga0097620_100301770
1076 Ga0097620_100355481
1077 Ga0097620_100413227
1078 Ga0097620_100942116
1079 Ga0097620_101191387
1080 Ga0075435_100394911
1081 Ga0075435_100547866
1082 Ga0075435_100960126
1083 Ga0105240_10012137
1084 Ga0111539_10019136
1085 Ga0111539_10028889
1086 Ga0111539_10605075
1087 Ga0105245_10225435
1088 Ga0105245_10387341
1089 Ga0105245_10723645
1090 Ga0105245_10938102
1091 Ga0105245_13040858
1092 Ga0105247_10502975
1093 Ga0105247_10549258
1094 Ga0105247_11172083
1095 Ga0114129_10024209
1096 Ga0105243_10037337
1097 Ga0105243_10226021
1098 Ga0105243_11422444
1099 Ga0105241_10159687
1100 Ga0105241_10710165
1101 Ga0105242_10018528
1102 Ga0105242_10477994
1103 Ga0105242_11139547
1104 Ga0105248_10066758
1105 Ga0105248_10276502
1106 Ga0105237_10389017
1107 Ga0105238_10004955
1108 Ga0105238_11512243
1109 Ga0105249_10042235
1110 Ga0105249_10080143
1111 Ga0105249_10633140
1112 Ga0105239_10368054
1113 Ga0105239_10457074
1114 Ga0105239_11112888
1115 Ga0105246_10392365
1116 Ga0105246_10796343
1117 Ga0157373_10000313
1118 Ga0157373_10034594
1119 Ga0157373_10597962
1120 Ga0157371_10001031
1121 Ga0157371_10056458
1122 Ga0157370_10021258
1123 Ga0157370_10457949
1124 Ga0157369_10010469
1125 Ga0157369_10044535
1126 Ga0157374_10000271
1127 Ga0157374_10016090
1128 Ga0157374_11035949
1129 Ga0157374_11193868
1130 Ga0157374_11670958
1131 Ga0157374_11877240
1132 Ga0157378_10014211
1133 Ga0157378_10114479
1134 Ga0157378_10262576
1135 Ga0157378_10329130
1136 Ga0157378_10915896
1137 Ga0157378_11164020
1138 Ga0157378_11857659
1139 Ga0163162_10102069
1140 Ga0163162_10549619
1141 Ga0163162_10858323
1142 Ga0163162_10907284
1143 Ga0163162_11054898
1144 Ga0163162_11598569
1145 Ga0157372_10000985
1146 Ga0157372_10014220
1147 Ga0157375_10006967
1148 Ga0157375_10086744
1149 Ga0157375_10563236
1150 Ga0157375_10708975
1151 Ga0157375_11151346
1152 Ga0157375_11321775
1153 Ga0157375_11724389
1154 Ga0163163_10004614
1155 Ga0163163_10055514
1156 Ga0163163_11469032
1157 Ga0157380_10005087
1158 Ga0157380_10056113
1159 Ga0157380_10728088
1160 Ga0157380_11264387
1161 Ga0182008_10118295
1162 Ga0157377_10004602
1163 Ga0157377_10281873
1164 Ga0157377_10956891
1165 Ga0157379_10023535
1166 Ga0157379_10049691
1167 Ga0157379_10180925
1168 Ga0157379_10636543
1169 Ga0157376_10216690
1170 Ga0157376_10502162
1171 Ga0163161_10050562
1172 Ga0163161_10332084
1173 Ga0163161_10607547
1174 Ga0207666_1000621
1175 Ga0207673_1004119
1176 Ga0207697_10007413
1177 Ga0207697_10013718
1178 Ga0207697_10017641
1179 Ga0207656_10004803
1180 Ga0207656_10006766
1181 Ga0207656_10072875
1182 Ga0207656_10182260
1183 Ga0207656_10308176
1184 Ga0207713_1238909
1185 Ga0207653_10121641
1186 Ga0207682_10000731
1187 Ga0207682_10001222
1188 Ga0207682_10164761
1189 Ga0207642_10034543
1190 Ga0207642_10070216
1191 Ga0207642_11028871
1192 Ga0207710_10459065
1193 Ga0207688_10005395
1194 Ga0207688_10134775
1195 Ga0207688_10292030
1196 Ga0207688_10408283
1197 Ga0207680_10026583
1198 Ga0207680_10196791
1199 Ga0207680_10265174
1200 Ga0207680_10632500
1201 Ga0207645_10000077
1202 Ga0207645_10003858
1203 Ga0207645_10031496
1204 Ga0207645_10086857
1205 Ga0207645_10112486
1206 Ga0207643_10000267
1207 Ga0207643_10009075
1208 Ga0207643_10197608
1209 Ga0207643_10251539
1210 Ga0207705_10102076
1211 Ga0207705_10164440
1212 Ga0207705_11328132
1213 Ga0207705_11345050
1214 Ga0207684_10910169
1215 Ga0207684_11293719
1216 Ga0207654_10078915
1217 Ga0207695_10030233
1218 Ga0207671_10262845
1219 Ga0207663_10362553
1220 Ga0207660_10241528
1221 Ga0207662_10006514
1222 Ga0207662_10454652
1223 Ga0207657_10000995
1224 Ga0207657_10012006
1225 Ga0207657_10023022
1226 Ga0207657_11216459
1227 Ga0207649_10001599
1228 Ga0207649_10010084
1229 Ga0207649_10332081
1230 Ga0207649_10438155
1231 Ga0207652_10096692
1232 Ga0207646_10739072
1233 Ga0207681_10016081
1234 Ga0207681_10045524
1235 Ga0207681_10140279
1236 Ga0207681_10236080
1237 Ga0207681_10549388
1238 Ga0207681_10880908
1239 Ga0207694_10006116
1240 Ga0207650_10001468
1241 Ga0207650_10002076
1242 Ga0207650_10018406
1243 Ga0207650_10050188
1244 Ga0207650_10192049
1245 Ga0207650_10256187
1246 Ga0207650_10876201
1247 Ga0207659_10015519
1248 Ga0207659_10019297
1249 Ga0207659_10024323
1250 Ga0207659_10116057
1251 Ga0207659_10228355
1252 Ga0207659_10447171
1253 Ga0207659_10668894
1254 Ga0207659_10827963
1255 Ga0207687_10241733
1256 Ga0207687_10264097
1257 Ga0207664_10004425
1258 Ga0207644_10003838
1259 Ga0207644_10045114
1260 Ga0207644_10051893
1261 Ga0207644_10196207
1262 Ga0207644_11369743
1263 Ga0207690_10002015
1264 Ga0207690_10002295
1265 Ga0207690_10542396
1266 Ga0207706_10000351
1267 Ga0207706_10000644
1268 Ga0207706_10195577
1269 Ga0207706_10580662
1270 Ga0207686_10011883
1271 Ga0207686_10208009
1272 Ga0207686_10895893
1273 Ga0207709_10197535
1274 Ga0207709_11038912
1275 Ga0207670_10577658
1276 Ga0207670_10816565
1277 Ga0207669_10000673
1278 Ga0207669_10001618
1279 Ga0207669_10093030
1280 Ga0207669_10681769
1281 Ga0207704_10079745
1282 Ga0207704_10258726
1283 Ga0207704_10331098
1284 Ga0207704_10626159
1285 Ga0207691_10000499
1286 Ga0207691_10007167
1287 Ga0207691_10057572
1288 Ga0207691_10112859
1289 Ga0207691_10117738
1290 Ga0207691_10282445
1291 Ga0207691_10961484
1292 Ga0207691_11071093
1293 Ga0207691_11071907
1294 Ga0207691_11330143
1295 Ga0207711_10028179
1296 Ga0207711_10065246
1297 Ga0207689_10001154
1298 Ga0207689_10049737
1299 Ga0207689_10212191
1300 Ga0207689_10742948
1301 Ga0207661_10020377
1302 Ga0207661_10474595
1303 Ga0207661_10635210
1304 Ga0207679_10006231
1305 Ga0207679_10014817
1306 Ga0207679_10018627
1307 Ga0207679_10118655
1308 Ga0207679_10801880
1309 Ga0207679_11569957
1310 Ga0207667_10001918
1311 Ga0207667_10009543
1312 Ga0207667_10296162
1313 Ga0207667_11071085
1314 Ga0207651_10020462
1315 Ga0207651_10033189
1316 Ga0207651_10062789
1317 Ga0207651_10346528
1318 Ga0207651_10478610
1319 Ga0207651_10582587
1320 Ga0207712_10087166
1321 Ga0207668_10022978
1322 Ga0207668_10029010
1323 Ga0207668_10106152
1324 Ga0207668_10134880
1325 Ga0207668_10196695
1326 Ga0207668_10405630
1327 Ga0207668_10545310
1328 Ga0207640_10022374
1329 Ga0207640_10167130
1330 Ga0207658_10002918
1331 Ga0207658_10080416
1332 Ga0207658_10148288
1333 Ga0207658_10382099
1334 Ga0207658_10673874
1335 Ga0207658_10914442
1336 Ga0207677_10014097
1337 Ga0207677_10074342
1338 Ga0207677_10130185
1339 Ga0207677_10615527
1340 Ga0207703_10006351
1341 Ga0207703_10029206
1342 Ga0207703_10227974
1343 Ga0207703_10294263
1344 Ga0207703_10432352
1345 Ga0207703_10947339
1346 Ga0207639_10012950
1347 Ga0207639_10043737
1348 Ga0207639_10068759
1349 Ga0207639_10265685
1350 Ga0207639_11250933
1351 Ga0207678_10002008
1352 Ga0207678_10008115
1353 Ga0207678_10131754
1354 Ga0207678_10211775
1355 Ga0207678_10557235
1356 Ga0207708_10013301
1357 Ga0207708_10496630
1358 Ga0207708_10677684
1359 Ga0207708_11618776
1360 Ga0207702_10001905
1361 Ga0207702_10002122
1362 Ga0207702_10127510
1363 Ga0207641_10009454
1364 Ga0207641_10143293
1365 Ga0207641_10505166
1366 Ga0207641_10806140
1367 Ga0207648_10000589
1368 Ga0207648_10007227
1369 Ga0207648_10043114
1370 Ga0207648_10612301
1371 Ga0207648_10632523
1372 Ga0207676_10011120
1373 Ga0207676_10022772
1374 Ga0207676_10032647
1375 Ga0207676_10044387
1376 Ga0207676_10612502
1377 Ga0207676_11539202
1378 Ga0207674_10000369
1379 Ga0207674_10003357
1380 Ga0207674_10062151
1381 Ga0207675_100003777
1382 Ga0207675_100179829
1383 Ga0207675_100487653
1384 Ga0207675_100823092
1385 Ga0207675_101976035
1386 Ga0207683_10000280
1387 Ga0207683_10008777
1388 Ga0207683_10163908
1389 Ga0207683_10298674
1390 Ga0207683_10391339
1391 Ga0207683_12030082
1392 Ga0207698_10002438
1393 Ga0207698_10007795
1394 Ga0207698_10012550
1395 Ga0207698_10483629
1396 Ga0207698_10499894
1397 Ga0207698_10695561
1398 Ga0207698_10767394
1399 Ga0209969_1012137
1400 Ga0209981_1020177
1401 Ga0209982_1023254
1402 Ga0210002_1003266
1403 Ga0209983_1034032
1404 Ga0209974_10012607
1405 Ga0268266_10010702
1406 Ga0268266_10061589
1407 Ga0268266_10081640
1408 Ga0268266_10118388
1409 Ga0268266_10485486
1410 Ga0268266_10525897
1411 Ga0268265_10002348
1412 Ga0268265_10193807
1413 Ga0268265_10271622
1414 Ga0268265_10291964
1415 Ga0268265_11263326
1416 Ga0268265_12235683
1417 Ga0268264_10053919
1418 Ga0268264_10132723
1419 Ga0268264_10323419
1420 Ga0268264_10633718
1421 Ga0268264_10685940
1422 Ga0268264_11203575
1423 Ga0307408_100004193
1424 Ga0307408_100025686
1425 Ga0307408_100214262
1426 Ga0307408_101558061
1427 Ga0307408_101964382
1428 Ga0307405_10009760
1429 Ga0307405_10017861
1430 Ga0307413_10003113
1431 Ga0307413_10426152
1432 Ga0307413_10934435
1433 Ga0307410_10000921
1434 Ga0307410_10004177
1435 Ga0307410_10019754
1436 Ga0307406_10006332
1437 Ga0307406_10010231
1438 Ga0307406_10022446
1439 Ga0307407_10221143
1440 Ga0307407_10364164
1441 Ga0307412_10014385
1442 Ga0307412_10056819
1443 Ga0307412_10374120
1444 Ga0307409_100014278
1445 Ga0307409_100041375
1446 Ga0307409_100293166
1447 Ga0307409_100431529
1448 Ga0307409_100998311
1449 Ga0307409_101370316
1450 Ga0307416_100008070
1451 Ga0307416_100011450
1452 Ga0307416_100161589
1453 Ga0307416_100723920
1454 Ga0307414_10038539
1455 Ga0307411_10026945
1456 Ga0307411_10034405
1457 Ga0307411_10304856
1458 Ga0307411_10433224
1459 Ga0307415_100008244
1460 Ga0307415_100057098
1461 Ga0307415_100459567
1462 Ga0373928_0126764
1463 Ga0373934_0262230
1464 Ga0373939_0011443
1465 Ga0373939_0268991
1466 Ga0373960_0092328
1467 Ga0373943_0134767
1468 Ga0373943_0193549
1469 Ga0373931_0199995
1470 Ga0373931_0338925
1471 Ga0373931_0417201
1472 Ga0373931_0487697
1473 Ga0373933_0226619
1474 Ga0373937_0130248
1475 Ga0373937_1404752
1476 Ga0373925_1106113
1477 Ga0436365_1105890
1478 Ga0451793_0975526
1479 Ga0451849_1474642
1480 Ga0450889_046187
1481 Ga0439435_0053313
1482 Ga0466963_0400401
1483 Ga0453684_0751244
1484 Ga0451576_0189580
1485 Ga0451576_0282070
1486 Ga0495584_0460235
1487 Ga0495620_0237679
1488 Ga0495642_0036626
1489 Ga0495642_0200515
1490 Ga0495598_0021341
1491 Ga0495621_0035684
1492 Ga0495621_0039462
1493 Ga0495669_0516472
1494 Ga0496100_0046877
1495 Ga0496100_0256183
1496 Ga0496101_0009002
1497 Ga0496101_0020149
1498 Ga0496101_0758263
1499 Ga0496102_0002745
1500 Ga0496104_0011927
1501 Ga0496105_0045848
1502 Ga0496105_0451466
1503 Ga0496106_0002746
1504 Ga0496106_0036069
1505 Ga0496106_0505509
1506 Ga0496107_0014219
1507 Ga0496107_0015023
1508 Ga0496108_0047549
1509 Ga0496108_0709071
1510 Ga0496108_1442396
1511 Ga0496109_0003042
1512 Ga0496109_0156168
1513 Ga0496109_0662476
1514 Ga0496110_0031041
1515 Ga0496110_0761389
1516 Ga0496110_1312691
1517 Ga0496110_1373744
1518 Ga0496111_0293967
1519 Ga0496111_0967940
1520 Ga0496112_0001624
1521 Ga0496112_1306990
1522 Ga0496113_0184766
1523 Ga0496114_0013013
1524 Ga0496114_0311744
1525 Ga0496115_0336813
1526 Ga0501299_039631
1527 Ga0501036_0159495
1528 Ga0501037_0516346
1529 Ga0501038_0510783
1530 Ga0501042_0103549
1531 Ga0501046_0276807
1532 Ga0501048_0507070
1533 Ga0501068_0187553
1534 Ga0501069_0247972
1535 Ga0501071_0013804
1536 Ga0501072_0076776
1537 Ga0501074_0256221
1538 Ga0501075_0041836
1539 Ga0501076_0359855
1540 Ga0501199_070975
1541 Ga0501079_0742699
1542 Ga0501080_0006311
1543 nmdc:mga05p37_224_c1
1544 nmdc:mga09592_4452_c1
1545 nmdc:mga0qj67_885756_c1
1546 nmdc:mga06r32_39490_c1
1547 nmdc:mga06r32_575548_c1
1548 nmdc:mga0n895_148965_c1
1549 nmdc:mga0rr50_381258_c1
1550 nmdc:mga0rr50_811685_c1
1551 nmdc:mga08x19_281_c1
1552 nmdc:mga08x19_480139_c1
1553 nmdc:mga0a205_137424_c1
1554 nmdc:mga0a205_832073_c1
1555 Ga0501084_0239283
1556 Ga0501082_0174480

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02699

YajC

Preprotein translocase subunit

20

96

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rm3-assembly1.cif.gz_SE0 evolutionary compaction and adaptation visualized by the structure of the dormant microsporidian ribosome 0.9022 55 96
6tjv-assembly1.cif.gz_S structure of the ndh-1ms complex from thermosynechococcus elongatus 0.875 55 96
3c4s-assembly2.cif.gz_B crystal structure of the ssl0352 protein from synechocystis sp. northeast structural genomics consortium target sgr42 0.8649 55 101
6wau-assembly1.cif.gz_A complex structure of phf19 0.8623 55 97
2e5q-assembly1.cif.gz_A solution structure of the tudor domain of phd finger protein 19, isoform b [homo sapiens] 0.8619 54 96
ID Description Score Start End Superfamily
af_A4I326_463_511_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9099 55 95 2.30.30.30
af_A0A1D6JMV5_458_522_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8965 55 97 2.30.30.30
af_P9WL75_5_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8855 22 98 2.40.50.140
af_Q5ALX3_519_567_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8813 58 98 2.30.30.30
af_Q2FXT7_4_82_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8762 22 98 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A3C1VTE0-F1-model_v4 Sec translocon accessory complex subunit YajC 0.9994 44 108 GO:0005886
GO:0015031
AF-A0A3G7TX04-F1-model_v4 Sec translocon accessory complex subunit YajC 0.9947 39 108 GO:0005886
GO:0015031
AF-A0A7W0S0T5-F1-model_v4 Preprotein translocase subunit YajC 0.9779 34 101 GO:0005886
GO:0015031
AF-A0A3C1VTE0-F1-model_v4 Sec translocon accessory complex subunit YajC 0.9696 44 108 GO:0005886
GO:0015031
AF-A0A3A4U2I3-F1-model_v4 Preprotein translocase subunit YajC 0.9677 36 101 GO:0005886
GO:0015031

Map