F480417
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 778 | 286 | 778 | 212 |
Family's Representative Sequence
| Representative Sequence | 3300026075|Ga0207708_10166145|Ga0207708_101661453 |
| Length | 244 |
| Sequence | MGSRFTNRLLPVLLAWGGIAMAIPGMAQTDSFAEERRRMVEEQIRHRGIDDPAVLAALTRVPRHLFVPEESRAVAYADTPLPIGHRQTISQPYIVALMSSLLELKPGDKVLEIGTGSGYQTVLLSHLVAQIFTIERIPALYNLARENIARAGAKNVSMLLGDGTVGWREYSPYDAILVSAGGPTIPQPLVEQLADGGRMIVPVGGLDEQTLKLVVRRGTEVRTSDVAPVRFVPLYGTHGWEQQS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 182 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 184 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 185 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 186 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 188 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 189 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 190 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 191 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 192 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 193 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 196 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 200 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 201 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 202 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 203 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 204 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 205 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 206 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 207 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 208 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 209 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 210 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 211 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 212 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 227 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 228 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 229 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 230 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 233 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 234 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 235 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 236 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 237 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 238 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 239 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 240 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 241 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 246 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 247 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 248 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 249 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 250 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 251 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 252 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 253 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 254 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 255 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 256 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 257 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 258 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 259 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 260 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 261 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 262 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 263 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 264 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 265 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 266 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 267 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 268 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 270 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 271 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 272 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 273 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 274 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 275 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 276 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.83 |
| Rhizosphere | 96.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_634714 | 2162886007 | Bacteria | 3149 |
| 2 | MRS1b_contig_2056278 | 2162886011 | Bacteria | 1082 |
| 3 | JGI24751J29686_10000049 | 3300002459 | Bacteria | 69226 |
| 4 | JGI25406J46586_10021838 | 3300003203 | Unclassified | 2561 |
| 5 | rootL2_10255558 | 3300003322 | Bacteria | 1175 |
| 6 | Ga0065714_10064507 | 3300005288 | Bacteria | 46235 |
| 7 | Ga0065704_10071515 | 3300005289 | Bacteria | 10836 |
| 8 | Ga0065712_10000138 | 3300005290 | Bacteria | 62583 |
| 9 | Ga0065712_10000296 | 3300005290 | Bacteria | 17305 |
| 10 | Ga0065712_10080959 | 3300005290 | Bacteria | 3052 |
| 11 | Ga0065712_10095370 | 3300005290 | Bacteria | 2221 |
| 12 | Ga0065712_10155384 | 3300005290 | Bacteria | 1339 |
| 13 | Ga0065712_10242962 | 3300005290 | Bacteria | 972 |
| 14 | Ga0065715_10004340 | 3300005293 | Bacteria | 8226 |
| 15 | Ga0065715_10005901 | 3300005293 | Bacteria | 3618 |
| 16 | Ga0065715_10022879 | 3300005293 | Bacteria | 1623 |
| 17 | Ga0065715_10033378 | 3300005293 | Unclassified | 1591 |
| 18 | Ga0065715_10109003 | 3300005293 | Bacteria | 2690 |
| 19 | Ga0065715_10341202 | 3300005293 | Unclassified | 967 |
| 20 | Ga0065707_10087245 | 3300005295 | Bacteria | 5100 |
| 21 | Ga0065707_10094864 | 3300005295 | Bacteria | 3443 |
| 22 | Ga0065707_10158018 | 3300005295 | Bacteria | 1590 |
| 23 | Ga0070658_10002464 | 3300005327 | Bacteria | 15467 |
| 24 | Ga0070658_10005958 | 3300005327 | Bacteria | 9891 |
| 25 | Ga0070658_10157855 | 3300005327 | Bacteria | 1902 |
| 26 | Ga0070658_10180351 | 3300005327 | Bacteria | 1777 |
| 27 | Ga0070676_10025393 | 3300005328 | Bacteria | 3349 |
| 28 | Ga0070676_10057386 | 3300005328 | Viruses | 2304 |
| 29 | Ga0070683_100026660 | 3300005329 | Bacteria | 5207 |
| 30 | Ga0070683_100048690 | 3300005329 | Bacteria | 3918 |
| 31 | Ga0070683_100053305 | 3300005329 | Bacteria | 3748 |
| 32 | Ga0070683_100568855 | 3300005329 | Bacteria | 1084 |
| 33 | Ga0070690_100005770 | 3300005330 | Bacteria | 6977 |
| 34 | Ga0070670_100022889 | 3300005331 | Bacteria | 5376 |
| 35 | Ga0070670_100069882 | 3300005331 | Bacteria | 3014 |
| 36 | Ga0068869_100065048 | 3300005334 | Bacteria | 2684 |
| 37 | Ga0068869_100264201 | 3300005334 | Bacteria | 1379 |
| 38 | Ga0068869_100387138 | 3300005334 | Bacteria | 1147 |
| 39 | Ga0070666_10116685 | 3300005335 | Bacteria | 1849 |
| 40 | Ga0070680_100009370 | 3300005336 | Bacteria | 7522 |
| 41 | Ga0070680_100021413 | 3300005336 | Bacteria | 5139 |
| 42 | Ga0070680_100161341 | 3300005336 | Bacteria | 1884 |
| 43 | Ga0070682_100002890 | 3300005337 | Bacteria | 9532 |
| 44 | Ga0070682_100003390 | 3300005337 | Bacteria | 8836 |
| 45 | Ga0070682_100205057 | 3300005337 | Bacteria | 1393 |
| 46 | Ga0068868_100018852 | 3300005338 | Bacteria | 5164 |
| 47 | Ga0068868_100316346 | 3300005338 | Bacteria | 1329 |
| 48 | Ga0068868_100417884 | 3300005338 | Bacteria | 1161 |
| 49 | Ga0070660_100000988 | 3300005339 | Bacteria | 19062 |
| 50 | Ga0070660_100111873 | 3300005339 | Unclassified | 2173 |
| 51 | Ga0070689_100340771 | 3300005340 | Unclassified | 1255 |
| 52 | Ga0070689_100610916 | 3300005340 | Bacteria | 945 |
| 53 | Ga0070689_100709725 | 3300005340 | Bacteria | 879 |
| 54 | Ga0070687_100124760 | 3300005343 | Unclassified | 1478 |
| 55 | Ga0070687_100143573 | 3300005343 | Bacteria | 1393 |
| 56 | Ga0070661_100005268 | 3300005344 | Bacteria | 8907 |
| 57 | Ga0070661_100039569 | 3300005344 | Bacteria | 3436 |
| 58 | Ga0070692_10009492 | 3300005345 | Unclassified | 4390 |
| 59 | Ga0070692_10029041 | 3300005345 | Bacteria | 2754 |
| 60 | Ga0070692_10126341 | 3300005345 | Unclassified | 1432 |
| 61 | Ga0070692_10160482 | 3300005345 | Bacteria | 1288 |
| 62 | Ga0070692_10445531 | 3300005345 | Unclassified | 828 |
| 63 | Ga0070692_10523184 | 3300005345 | Unclassified | 772 |
| 64 | Ga0070668_100119168 | 3300005347 | Bacteria | 2108 |
| 65 | Ga0070669_100079505 | 3300005353 | Bacteria | 2439 |
| 66 | Ga0070669_100130023 | 3300005353 | Bacteria | 1930 |
| 67 | Ga0070669_100170970 | 3300005353 | Bacteria | 1694 |
| 68 | Ga0070675_100186512 | 3300005354 | Bacteria | 1795 |
| 69 | Ga0070675_100321704 | 3300005354 | Bacteria | 1366 |
| 70 | Ga0070675_100455687 | 3300005354 | Bacteria | 1147 |
| 71 | Ga0070671_100003695 | 3300005355 | Bacteria | 11999 |
| 72 | Ga0070671_100037834 | 3300005355 | Bacteria | 4003 |
| 73 | Ga0070671_100044712 | 3300005355 | Bacteria | 3680 |
| 74 | Ga0070671_100104686 | 3300005355 | Bacteria | 2375 |
| 75 | Ga0070674_100322385 | 3300005356 | Bacteria | 1239 |
| 76 | Ga0070673_100039820 | 3300005364 | Bacteria | 3600 |
| 77 | Ga0070673_100085054 | 3300005364 | Bacteria | 2574 |
| 78 | Ga0070673_100110467 | 3300005364 | Bacteria | 2279 |
| 79 | Ga0070673_100325616 | 3300005364 | Unclassified | 1358 |
| 80 | Ga0070673_100325774 | 3300005364 | Bacteria | 1358 |
| 81 | Ga0070673_100583942 | 3300005364 | Bacteria | 1018 |
| 82 | Ga0070688_100167768 | 3300005365 | Bacteria | 1512 |
| 83 | Ga0070659_100022165 | 3300005366 | Unclassified | 4846 |
| 84 | Ga0070659_100106891 | 3300005366 | Bacteria | 2256 |
| 85 | Ga0070659_100900908 | 3300005366 | Bacteria | 773 |
| 86 | Ga0070667_100032807 | 3300005367 | Bacteria | 4333 |
| 87 | Ga0070667_100062002 | 3300005367 | Bacteria | 3167 |
| 88 | Ga0070667_100272039 | 3300005367 | Unclassified | 1519 |
| 89 | Ga0070667_100573917 | 3300005367 | Bacteria | 1038 |
| 90 | Ga0070703_10014271 | 3300005406 | Bacteria | 2262 |
| 91 | Ga0070701_10087404 | 3300005438 | Bacteria | 1701 |
| 92 | Ga0070705_100001180 | 3300005440 | Bacteria | 14263 |
| 93 | Ga0070705_100272842 | 3300005440 | Bacteria | 1199 |
| 94 | Ga0070705_100321466 | 3300005440 | Bacteria | 1117 |
| 95 | Ga0070700_100037052 | 3300005441 | Bacteria | 2963 |
| 96 | Ga0070700_100071533 | 3300005441 | Bacteria | 2215 |
| 97 | Ga0070700_100276478 | 3300005441 | Bacteria | 1216 |
| 98 | Ga0070694_100003400 | 3300005444 | Bacteria | 9536 |
| 99 | Ga0070694_100026914 | 3300005444 | Bacteria | 3731 |
| 100 | Ga0070694_100029349 | 3300005444 | Bacteria | 3589 |
| 101 | Ga0070694_100289868 | 3300005444 | Bacteria | 1251 |
| 102 | Ga0070694_100294567 | 3300005444 | Bacteria | 1241 |
| 103 | Ga0070694_100339785 | 3300005444 | Unclassified | 1160 |
| 104 | Ga0070708_100000147 | 3300005445 | Bacteria | 48675 |
| 105 | Ga0070708_100275416 | 3300005445 | Bacteria | 1583 |
| 106 | Ga0070663_100275423 | 3300005455 | Bacteria | 1339 |
| 107 | Ga0070678_100021052 | 3300005456 | Bacteria | 4292 |
| 108 | Ga0070662_100238356 | 3300005457 | Bacteria | 1458 |
| 109 | Ga0070662_100741850 | 3300005457 | Bacteria | 832 |
| 110 | Ga0070662_100758662 | 3300005457 | Unclassified | 823 |
| 111 | Ga0070681_10000110 | 3300005458 | Bacteria | 61542 |
| 112 | Ga0070681_10003413 | 3300005458 | Bacteria | 14879 |
| 113 | Ga0070681_10003933 | 3300005458 | Bacteria | 14010 |
| 114 | Ga0070681_10007686 | 3300005458 | Bacteria | 10540 |
| 115 | Ga0070681_10083531 | 3300005458 | Bacteria | 3147 |
| 116 | Ga0070681_10104289 | 3300005458 | Bacteria | 2778 |
| 117 | Ga0068867_100017771 | 3300005459 | Bacteria | 5049 |
| 118 | Ga0068867_100031255 | 3300005459 | Bacteria | 3843 |
| 119 | Ga0068867_100656091 | 3300005459 | Bacteria | 921 |
| 120 | Ga0070685_10219607 | 3300005466 | Bacteria | 1245 |
| 121 | Ga0070706_100030111 | 3300005467 | Bacteria | 4999 |
| 122 | Ga0070706_100043041 | 3300005467 | Bacteria | 4172 |
| 123 | Ga0070706_100144467 | 3300005467 | Bacteria | 2222 |
| 124 | Ga0070707_100141374 | 3300005468 | Bacteria | 2342 |
| 125 | Ga0070698_100002024 | 3300005471 | Bacteria | 22538 |
| 126 | Ga0070698_100005990 | 3300005471 | Bacteria | 13256 |
| 127 | Ga0070698_100008639 | 3300005471 | Bacteria | 10977 |
| 128 | Ga0070698_100035160 | 3300005471 | Bacteria | 5181 |
| 129 | Ga0070698_100897029 | 3300005471 | Bacteria | 832 |
| 130 | Ga0070699_100008648 | 3300005518 | Bacteria | 8825 |
| 131 | Ga0070699_100012911 | 3300005518 | Bacteria | 7200 |
| 132 | Ga0070699_100022438 | 3300005518 | Bacteria | 5439 |
| 133 | Ga0070699_100126214 | 3300005518 | Bacteria | 2253 |
| 134 | Ga0070699_100438989 | 3300005518 | Bacteria | 1183 |
| 135 | Ga0070699_100592213 | 3300005518 | Bacteria | 1011 |
| 136 | Ga0070679_100000060 | 3300005530 | Bacteria | 81237 |
| 137 | Ga0070679_100001326 | 3300005530 | Bacteria | 21807 |
| 138 | Ga0070679_100108349 | 3300005530 | Bacteria | 2764 |
| 139 | Ga0070679_100129400 | 3300005530 | Bacteria | 2506 |
| 140 | Ga0070679_100432040 | 3300005530 | Bacteria | 1262 |
| 141 | Ga0070684_100039618 | 3300005535 | Bacteria | 4054 |
| 142 | Ga0070684_100204778 | 3300005535 | Bacteria | 1798 |
| 143 | Ga0070684_100658288 | 3300005535 | Bacteria | 975 |
| 144 | Ga0070697_100000366 | 3300005536 | Bacteria | 35335 |
| 145 | Ga0070697_100001795 | 3300005536 | Bacteria | 16382 |
| 146 | Ga0070697_100040260 | 3300005536 | Bacteria | 3780 |
| 147 | Ga0070697_100057838 | 3300005536 | Bacteria | 3154 |
| 148 | Ga0070697_100153538 | 3300005536 | Bacteria | 1942 |
| 149 | Ga0070697_100268567 | 3300005536 | Bacteria | 1462 |
| 150 | Ga0068853_100015189 | 3300005539 | Bacteria | 6331 |
| 151 | Ga0068853_100015348 | 3300005539 | Bacteria | 6295 |
| 152 | Ga0068853_100632113 | 3300005539 | Bacteria | 1018 |
| 153 | Ga0068853_100873477 | 3300005539 | Unclassified | 863 |
| 154 | Ga0070672_100064549 | 3300005543 | Bacteria | 2893 |
| 155 | Ga0070672_100072178 | 3300005543 | Bacteria | 2748 |
| 156 | Ga0070672_100164230 | 3300005543 | Bacteria | 1844 |
| 157 | Ga0070672_100233819 | 3300005543 | Bacteria | 1545 |
| 158 | Ga0070686_100071842 | 3300005544 | Unclassified | 2267 |
| 159 | Ga0070686_100269166 | 3300005544 | Bacteria | 1252 |
| 160 | Ga0070695_100045162 | 3300005545 | Bacteria | 2807 |
| 161 | Ga0070695_100334669 | 3300005545 | Unclassified | 1129 |
| 162 | Ga0070695_100467101 | 3300005545 | Bacteria | 970 |
| 163 | Ga0070696_100046031 | 3300005546 | Bacteria | 3024 |
| 164 | Ga0070696_100060769 | 3300005546 | Bacteria | 2643 |
| 165 | Ga0070696_100101732 | 3300005546 | Bacteria | 2060 |
| 166 | Ga0070696_100135175 | 3300005546 | Bacteria | 1797 |
| 167 | Ga0070696_100166170 | 3300005546 | Bacteria | 1628 |
| 168 | Ga0070696_100281073 | 3300005546 | Bacteria | 1269 |
| 169 | Ga0070696_100412671 | 3300005546 | Unclassified | 1058 |
| 170 | Ga0070696_100835093 | 3300005546 | Unclassified | 760 |
| 171 | Ga0070693_100005900 | 3300005547 | Bacteria | 5921 |
| 172 | Ga0070693_100010936 | 3300005547 | Bacteria | 4559 |
| 173 | Ga0070693_100152941 | 3300005547 | Bacteria | 1463 |
| 174 | Ga0070704_100010265 | 3300005549 | Bacteria | 5694 |
| 175 | Ga0070704_100051780 | 3300005549 | Bacteria | 2893 |
| 176 | Ga0070704_100362035 | 3300005549 | Unclassified | 1227 |
| 177 | Ga0068855_100254946 | 3300005563 | Unclassified | 1956 |
| 178 | Ga0070664_100001504 | 3300005564 | Bacteria | 18579 |
| 179 | Ga0070664_100031842 | 3300005564 | Bacteria | 4409 |
| 180 | Ga0070664_100276485 | 3300005564 | Bacteria | 1514 |
| 181 | Ga0070664_100452038 | 3300005564 | Bacteria | 1179 |
| 182 | Ga0068857_100001572 | 3300005577 | Bacteria | 18294 |
| 183 | Ga0068857_100086416 | 3300005577 | Bacteria | 2804 |
| 184 | Ga0068857_100094287 | 3300005577 | Bacteria | 2680 |
| 185 | Ga0068857_100162106 | 3300005577 | Bacteria | 2029 |
| 186 | Ga0068857_100325729 | 3300005577 | Bacteria | 1419 |
| 187 | Ga0068854_100061524 | 3300005578 | Bacteria | 2720 |
| 188 | Ga0068854_100156605 | 3300005578 | Bacteria | 1761 |
| 189 | Ga0068854_100221745 | 3300005578 | Unclassified | 1496 |
| 190 | Ga0068854_100284021 | 3300005578 | Bacteria | 1334 |
| 191 | Ga0070702_100001575 | 3300005615 | Bacteria | 9405 |
| 192 | Ga0070702_100141267 | 3300005615 | Bacteria | 1534 |
| 193 | Ga0068852_100042394 | 3300005616 | Bacteria | 3853 |
| 194 | Ga0068852_100649020 | 3300005616 | Bacteria | 1063 |
| 195 | Ga0068852_101144401 | 3300005616 | Unclassified | 799 |
| 196 | Ga0068859_100048141 | 3300005617 | Bacteria | 4283 |
| 197 | Ga0068859_100048664 | 3300005617 | Bacteria | 4258 |
| 198 | Ga0068859_100100661 | 3300005617 | Bacteria | 2946 |
| 199 | Ga0068859_100115041 | 3300005617 | Bacteria | 2754 |
| 200 | Ga0068859_100126752 | 3300005617 | Unclassified | 2622 |
| 201 | Ga0068859_100167174 | 3300005617 | Bacteria | 2279 |
| 202 | Ga0068859_100175496 | 3300005617 | Bacteria | 2225 |
| 203 | Ga0068859_100351788 | 3300005617 | Bacteria | 1568 |
| 204 | Ga0068859_100356719 | 3300005617 | Bacteria | 1557 |
| 205 | Ga0068859_100381597 | 3300005617 | Bacteria | 1505 |
| 206 | Ga0068859_100473851 | 3300005617 | Bacteria | 1347 |
| 207 | Ga0068859_100596716 | 3300005617 | Bacteria | 1197 |
| 208 | Ga0068859_100840320 | 3300005617 | Bacteria | 1004 |
| 209 | Ga0068864_100017822 | 3300005618 | Bacteria | 5923 |
| 210 | Ga0068864_100127786 | 3300005618 | Bacteria | 2279 |
| 211 | Ga0068864_100175271 | 3300005618 | Bacteria | 1957 |
| 212 | Ga0068864_100201523 | 3300005618 | Unclassified | 1828 |
| 213 | Ga0068864_100398103 | 3300005618 | Bacteria | 1308 |
| 214 | Ga0068864_100597542 | 3300005618 | Bacteria | 1070 |
| 215 | Ga0068864_100890942 | 3300005618 | Unclassified | 878 |
| 216 | Ga0068866_10031205 | 3300005718 | Bacteria | 2564 |
| 217 | Ga0068866_10157304 | 3300005718 | Bacteria | 1322 |
| 218 | Ga0068861_100011968 | 3300005719 | Bacteria | 6042 |
| 219 | Ga0068861_100055926 | 3300005719 | Bacteria | 3010 |
| 220 | Ga0068861_100070334 | 3300005719 | Bacteria | 2709 |
| 221 | Ga0068851_10002245 | 3300005834 | Bacteria | 8494 |
| 222 | Ga0068870_10069572 | 3300005840 | Bacteria | 1915 |
| 223 | Ga0068870_10186425 | 3300005840 | Bacteria | 1249 |
| 224 | Ga0068870_10275118 | 3300005840 | Bacteria | 1053 |
| 225 | Ga0068870_10357233 | 3300005840 | Bacteria | 939 |
| 226 | Ga0068863_100074503 | 3300005841 | Bacteria | 3211 |
| 227 | Ga0068863_100077484 | 3300005841 | Bacteria | 3146 |
| 228 | Ga0068863_100133463 | 3300005841 | Bacteria | 2371 |
| 229 | Ga0068863_100331813 | 3300005841 | Bacteria | 1479 |
| 230 | Ga0068863_100401584 | 3300005841 | Bacteria | 1340 |
| 231 | Ga0068863_100836050 | 3300005841 | Unclassified | 919 |
| 232 | Ga0068858_100053043 | 3300005842 | Bacteria | 3752 |
| 233 | Ga0068858_100119330 | 3300005842 | Bacteria | 2466 |
| 234 | Ga0068858_100131784 | 3300005842 | Bacteria | 2344 |
| 235 | Ga0068858_100212660 | 3300005842 | Bacteria | 1830 |
| 236 | Ga0068858_100280650 | 3300005842 | Bacteria | 1586 |
| 237 | Ga0068858_100402384 | 3300005842 | Bacteria | 1315 |
| 238 | Ga0068858_100654960 | 3300005842 | Unclassified | 1020 |
| 239 | Ga0068860_100016852 | 3300005843 | Bacteria | 7123 |
| 240 | Ga0068860_100053151 | 3300005843 | Unclassified | 3852 |
| 241 | Ga0068860_100123760 | 3300005843 | Bacteria | 2478 |
| 242 | Ga0068860_100262864 | 3300005843 | Bacteria | 1682 |
| 243 | Ga0068860_100423238 | 3300005843 | Bacteria | 1320 |
| 244 | Ga0068862_100024723 | 3300005844 | Bacteria | 5040 |
| 245 | Ga0068862_100114154 | 3300005844 | Bacteria | 2374 |
| 246 | Ga0068862_100832375 | 3300005844 | Bacteria | 903 |
| 247 | Ga0081539_10000490 | 3300005985 | Bacteria | 83577 |
| 248 | Ga0081539_10001185 | 3300005985 | Bacteria | 47102 |
| 249 | Ga0081539_10143468 | 3300005985 | Bacteria | 1157 |
| 250 | Ga0070716_100170952 | 3300006173 | Bacteria | 1418 |
| 251 | Ga0097621_100003740 | 3300006237 | Bacteria | 10543 |
| 252 | Ga0097621_100005158 | 3300006237 | Bacteria | 9178 |
| 253 | Ga0097621_100052841 | 3300006237 | Bacteria | 3311 |
| 254 | Ga0068871_100041044 | 3300006358 | Bacteria | 3709 |
| 255 | Ga0068871_100125202 | 3300006358 | Bacteria | 2175 |
| 256 | Ga0068871_100178993 | 3300006358 | Bacteria | 1821 |
| 257 | Ga0075428_100119813 | 3300006844 | Unclassified | 2865 |
| 258 | Ga0075428_100159158 | 3300006844 | Bacteria | 2451 |
| 259 | Ga0075428_100845779 | 3300006844 | Bacteria | 972 |
| 260 | Ga0075428_100962892 | 3300006844 | Bacteria | 904 |
| 261 | Ga0075430_100113481 | 3300006846 | Bacteria | 2258 |
| 262 | Ga0075430_100205083 | 3300006846 | Unclassified | 1636 |
| 263 | Ga0075431_100010525 | 3300006847 | Bacteria | 9299 |
| 264 | Ga0075431_100097359 | 3300006847 | Bacteria | 3038 |
| 265 | Ga0075433_10030871 | 3300006852 | Bacteria | 4575 |
| 266 | Ga0075433_10115905 | 3300006852 | Bacteria | 2377 |
| 267 | Ga0075434_100088077 | 3300006871 | Unclassified | 3105 |
| 268 | Ga0075434_100169474 | 3300006871 | Bacteria | 2203 |
| 269 | Ga0075429_100025872 | 3300006880 | Bacteria | 5095 |
| 270 | Ga0075429_100165114 | 3300006880 | Unclassified | 1940 |
| 271 | Ga0068865_100101415 | 3300006881 | Bacteria | 2108 |
| 272 | Ga0068865_100139443 | 3300006881 | Bacteria | 1827 |
| 273 | Ga0075436_100011949 | 3300006914 | Bacteria | 5954 |
| 274 | Ga0097620_100048144 | 3300006931 | Bacteria | 4283 |
| 275 | Ga0097620_100048664 | 3300006931 | Bacteria | 4258 |
| 276 | Ga0097620_100100663 | 3300006931 | Bacteria | 2946 |
| 277 | Ga0097620_100115030 | 3300006931 | Bacteria | 2754 |
| 278 | Ga0097620_100126737 | 3300006931 | Unclassified | 2622 |
| 279 | Ga0097620_100150365 | 3300006931 | Bacteria | 2404 |
| 280 | Ga0097620_100167159 | 3300006931 | Bacteria | 2279 |
| 281 | Ga0097620_100175505 | 3300006931 | Bacteria | 2225 |
| 282 | Ga0097620_100351791 | 3300006931 | Bacteria | 1568 |
| 283 | Ga0097620_100356677 | 3300006931 | Bacteria | 1557 |
| 284 | Ga0097620_100381602 | 3300006931 | Bacteria | 1505 |
| 285 | Ga0097620_100473834 | 3300006931 | Bacteria | 1347 |
| 286 | Ga0097620_100596737 | 3300006931 | Bacteria | 1197 |
| 287 | Ga0097620_100840301 | 3300006931 | Bacteria | 1004 |
| 288 | Ga0075435_100638599 | 3300007076 | Bacteria | 924 |
| 289 | Ga0105240_10016665 | 3300009093 | Bacteria | 9940 |
| 290 | Ga0105240_10271544 | 3300009093 | Unclassified | 1952 |
| 291 | Ga0105240_11096713 | 3300009093 | Unclassified | 847 |
| 292 | Ga0111539_10000363 | 3300009094 | Bacteria | 55793 |
| 293 | Ga0111539_10007694 | 3300009094 | Bacteria | 13758 |
| 294 | Ga0111539_10028853 | 3300009094 | Bacteria | 6767 |
| 295 | Ga0111539_10084943 | 3300009094 | Bacteria | 3721 |
| 296 | Ga0111539_10115883 | 3300009094 | Bacteria | 3142 |
| 297 | Ga0111539_10262265 | 3300009094 | Bacteria | 2011 |
| 298 | Ga0111539_10366872 | 3300009094 | Bacteria | 1676 |
| 299 | Ga0105245_10021239 | 3300009098 | Bacteria | 5692 |
| 300 | Ga0105245_10161055 | 3300009098 | Bacteria | 2129 |
| 301 | Ga0105245_11001648 | 3300009098 | Unclassified | 880 |
| 302 | Ga0105247_10008100 | 3300009101 | Bacteria | 6421 |
| 303 | Ga0105247_10043304 | 3300009101 | Bacteria | 2758 |
| 304 | Ga0105247_10078632 | 3300009101 | Bacteria | 2075 |
| 305 | Ga0105247_10383634 | 3300009101 | Bacteria | 997 |
| 306 | Ga0114129_10020608 | 3300009147 | Bacteria | 9373 |
| 307 | Ga0114129_10089786 | 3300009147 | Bacteria | 4259 |
| 308 | Ga0114129_10164080 | 3300009147 | Bacteria | 3033 |
| 309 | Ga0114129_10175898 | 3300009147 | Bacteria | 2915 |
| 310 | Ga0114129_10236812 | 3300009147 | Bacteria | 2455 |
| 311 | Ga0114129_10338280 | 3300009147 | Unclassified | 1997 |
| 312 | Ga0114129_10504730 | 3300009147 | Bacteria | 1579 |
| 313 | Ga0114129_10668957 | 3300009147 | Bacteria | 1338 |
| 314 | Ga0114129_10881370 | 3300009147 | Bacteria | 1135 |
| 315 | Ga0114129_11001971 | 3300009147 | Unclassified | 1052 |
| 316 | Ga0114129_11753732 | 3300009147 | Bacteria | 756 |
| 317 | Ga0105243_10008351 | 3300009148 | Bacteria | 7950 |
| 318 | Ga0105243_10008920 | 3300009148 | Bacteria | 7666 |
| 319 | Ga0105243_10296930 | 3300009148 | Bacteria | 1462 |
| 320 | Ga0105243_11026818 | 3300009148 | Unclassified | 829 |
| 321 | Ga0105241_10060700 | 3300009174 | Unclassified | 2909 |
| 322 | Ga0105241_10151207 | 3300009174 | Unclassified | 1899 |
| 323 | Ga0105241_10277076 | 3300009174 | Bacteria | 1431 |
| 324 | Ga0105241_10278029 | 3300009174 | Bacteria | 1429 |
| 325 | Ga0105241_10320905 | 3300009174 | Bacteria | 1335 |
| 326 | Ga0105241_10442778 | 3300009174 | Bacteria | 1148 |
| 327 | Ga0105241_10622173 | 3300009174 | Bacteria | 978 |
| 328 | Ga0105242_10009899 | 3300009176 | Bacteria | 7302 |
| 329 | Ga0105242_10113975 | 3300009176 | Bacteria | 2309 |
| 330 | Ga0105242_10320683 | 3300009176 | Bacteria | 1421 |
| 331 | Ga0105242_10516622 | 3300009176 | Unclassified | 1139 |
| 332 | Ga0105242_11711254 | 3300009176 | Bacteria | 665 |
| 333 | Ga0105248_10026948 | 3300009177 | Bacteria | 6391 |
| 334 | Ga0105248_10088379 | 3300009177 | Bacteria | 3488 |
| 335 | Ga0105248_10124698 | 3300009177 | Bacteria | 2905 |
| 336 | Ga0105248_10156840 | 3300009177 | Unclassified | 2568 |
| 337 | Ga0105248_10263195 | 3300009177 | Unclassified | 1941 |
| 338 | Ga0105248_10346833 | 3300009177 | Bacteria | 1672 |
| 339 | Ga0105248_10353466 | 3300009177 | Unclassified | 1654 |
| 340 | Ga0105248_10471100 | 3300009177 | Unclassified | 1416 |
| 341 | Ga0105248_10685799 | 3300009177 | Bacteria | 1156 |
| 342 | Ga0105248_10898012 | 3300009177 | Bacteria | 1000 |
| 343 | Ga0105248_10973668 | 3300009177 | Bacteria | 958 |
| 344 | Ga0105237_10000527 | 3300009545 | Bacteria | 53805 |
| 345 | Ga0105237_10674748 | 3300009545 | Bacteria | 1040 |
| 346 | Ga0105238_10001996 | 3300009551 | Bacteria | 20559 |
| 347 | Ga0105249_10001430 | 3300009553 | Bacteria | 20929 |
| 348 | Ga0105249_10083701 | 3300009553 | Bacteria | 2970 |
| 349 | Ga0105249_10152210 | 3300009553 | Bacteria | 2228 |
| 350 | Ga0105249_10174470 | 3300009553 | Bacteria | 2087 |
| 351 | Ga0105249_10272944 | 3300009553 | Bacteria | 1685 |
| 352 | Ga0105249_10880886 | 3300009553 | Unclassified | 962 |
| 353 | Ga0105239_10196467 | 3300010375 | Bacteria | 2259 |
| 354 | Ga0105239_10476447 | 3300010375 | Bacteria | 1418 |
| 355 | Ga0105246_10080107 | 3300011119 | Bacteria | 2324 |
| 356 | Ga0105246_10706698 | 3300011119 | Unclassified | 884 |
| 357 | Ga0157373_10002322 | 3300013100 | Bacteria | 14422 |
| 358 | Ga0157373_10011153 | 3300013100 | Bacteria | 6614 |
| 359 | Ga0157373_10112898 | 3300013100 | Bacteria | 1910 |
| 360 | Ga0157371_10015820 | 3300013102 | Bacteria | 5644 |
| 361 | Ga0157371_10032315 | 3300013102 | Bacteria | 3767 |
| 362 | Ga0157371_10035193 | 3300013102 | Bacteria | 3589 |
| 363 | Ga0157371_10501976 | 3300013102 | Unclassified | 896 |
| 364 | Ga0157371_10616830 | 3300013102 | Bacteria | 808 |
| 365 | Ga0157370_10003071 | 3300013104 | Bacteria | 19790 |
| 366 | Ga0157369_10004455 | 3300013105 | Bacteria | 16501 |
| 367 | Ga0157369_10029579 | 3300013105 | Bacteria | 6052 |
| 368 | Ga0157369_10577148 | 3300013105 | Bacteria | 1161 |
| 369 | Ga0157374_10281930 | 3300013296 | Unclassified | 1641 |
| 370 | Ga0157378_10059181 | 3300013297 | Bacteria | 3418 |
| 371 | Ga0157378_10119307 | 3300013297 | Bacteria | 2429 |
| 372 | Ga0157378_10319762 | 3300013297 | Bacteria | 1507 |
| 373 | Ga0157378_10460256 | 3300013297 | Unclassified | 1264 |
| 374 | Ga0163162_10000027 | 3300013306 | Bacteria | 178451 |
| 375 | Ga0163162_10003480 | 3300013306 | Bacteria | 15046 |
| 376 | Ga0163162_10003901 | 3300013306 | Bacteria | 14319 |
| 377 | Ga0163162_10004987 | 3300013306 | Bacteria | 12791 |
| 378 | Ga0163162_10023609 | 3300013306 | Bacteria | 6072 |
| 379 | Ga0163162_10173782 | 3300013306 | Bacteria | 2279 |
| 380 | Ga0163162_10207754 | 3300013306 | Bacteria | 2087 |
| 381 | Ga0163162_10369966 | 3300013306 | Bacteria | 1566 |
| 382 | Ga0163162_11499426 | 3300013306 | Bacteria | 768 |
| 383 | Ga0157372_10001740 | 3300013307 | Bacteria | 23617 |
| 384 | Ga0157372_10020733 | 3300013307 | Bacteria | 7096 |
| 385 | Ga0157372_10074735 | 3300013307 | Bacteria | 3822 |
| 386 | Ga0157372_10082372 | 3300013307 | Bacteria | 3642 |
| 387 | Ga0157372_10085626 | 3300013307 | Bacteria | 3575 |
| 388 | Ga0157372_10235864 | 3300013307 | Bacteria | 2122 |
| 389 | Ga0157372_10381665 | 3300013307 | Bacteria | 1642 |
| 390 | Ga0157372_10543067 | 3300013307 | Bacteria | 1355 |
| 391 | Ga0157372_10634281 | 3300013307 | Bacteria | 1245 |
| 392 | Ga0157372_10697949 | 3300013307 | Bacteria | 1181 |
| 393 | Ga0157375_10011832 | 3300013308 | Bacteria | 7715 |
| 394 | Ga0157375_10046224 | 3300013308 | Bacteria | 4242 |
| 395 | Ga0157375_10122762 | 3300013308 | Bacteria | 2709 |
| 396 | Ga0157375_10312236 | 3300013308 | Unclassified | 1736 |
| 397 | Ga0157375_10331166 | 3300013308 | Bacteria | 1687 |
| 398 | Ga0157375_10364736 | 3300013308 | Unclassified | 1611 |
| 399 | Ga0157375_10763537 | 3300013308 | Bacteria | 1117 |
| 400 | Ga0163163_10000109 | 3300014325 | Bacteria | 87294 |
| 401 | Ga0163163_10001737 | 3300014325 | Bacteria | 18359 |
| 402 | Ga0163163_10021610 | 3300014325 | Bacteria | 6076 |
| 403 | Ga0163163_10036125 | 3300014325 | Bacteria | 4797 |
| 404 | Ga0163163_10066690 | 3300014325 | Bacteria | 3575 |
| 405 | Ga0163163_10170504 | 3300014325 | Bacteria | 2223 |
| 406 | Ga0163163_10348322 | 3300014325 | Bacteria | 1537 |
| 407 | Ga0163163_10714784 | 3300014325 | Bacteria | 1065 |
| 408 | Ga0157380_10100489 | 3300014326 | Bacteria | 2408 |
| 409 | Ga0157380_10146483 | 3300014326 | Unclassified | 2036 |
| 410 | Ga0157380_10201187 | 3300014326 | Bacteria | 1767 |
| 411 | Ga0157380_10414745 | 3300014326 | Unclassified | 1282 |
| 412 | Ga0182008_10247148 | 3300014497 | Unclassified | 919 |
| 413 | Ga0157377_10006813 | 3300014745 | Bacteria | 5473 |
| 414 | Ga0157377_10021040 | 3300014745 | Unclassified | 3426 |
| 415 | Ga0157377_10109144 | 3300014745 | Bacteria | 1661 |
| 416 | Ga0157377_10336110 | 3300014745 | Bacteria | 1009 |
| 417 | Ga0157379_10025524 | 3300014968 | Bacteria | 5250 |
| 418 | Ga0157379_10117480 | 3300014968 | Bacteria | 2392 |
| 419 | Ga0157379_11096170 | 3300014968 | Bacteria | 762 |
| 420 | Ga0157376_10283737 | 3300014969 | Bacteria | 1560 |
| 421 | Ga0182007_10159703 | 3300015262 | Bacteria | 770 |
| 422 | Ga0182005_1042338 | 3300015265 | Bacteria | 1238 |
| 423 | Ga0163161_10299900 | 3300017792 | Bacteria | 1265 |
| 424 | Ga0207656_10007353 | 3300025321 | Bacteria | 4005 |
| 425 | Ga0207653_10008043 | 3300025885 | Bacteria | 3287 |
| 426 | Ga0207642_10053657 | 3300025899 | Bacteria | 1835 |
| 427 | Ga0207710_10000832 | 3300025900 | Bacteria | 16664 |
| 428 | Ga0207710_10073668 | 3300025900 | Bacteria | 1570 |
| 429 | Ga0207680_10197115 | 3300025903 | Bacteria | 1370 |
| 430 | Ga0207647_10017531 | 3300025904 | Bacteria | 4866 |
| 431 | Ga0207645_10057662 | 3300025907 | Bacteria | 2480 |
| 432 | Ga0207645_10187835 | 3300025907 | Bacteria | 1357 |
| 433 | Ga0207643_10048397 | 3300025908 | Bacteria | 2408 |
| 434 | Ga0207643_10057588 | 3300025908 | Bacteria | 2213 |
| 435 | Ga0207643_10115455 | 3300025908 | Bacteria | 1585 |
| 436 | Ga0207643_10293395 | 3300025908 | Bacteria | 1011 |
| 437 | Ga0207643_10298161 | 3300025908 | Bacteria | 1003 |
| 438 | Ga0207705_10003006 | 3300025909 | Bacteria | 12869 |
| 439 | Ga0207705_10003715 | 3300025909 | Bacteria | 11617 |
| 440 | Ga0207705_10077432 | 3300025909 | Bacteria | 2419 |
| 441 | Ga0207705_10108520 | 3300025909 | Bacteria | 2049 |
| 442 | Ga0207705_10194609 | 3300025909 | Bacteria | 1534 |
| 443 | Ga0207684_10068699 | 3300025910 | Unclassified | 3011 |
| 444 | Ga0207684_10145844 | 3300025910 | Bacteria | 2036 |
| 445 | Ga0207684_10199837 | 3300025910 | Bacteria | 1724 |
| 446 | Ga0207684_10258309 | 3300025910 | Bacteria | 1503 |
| 447 | Ga0207684_10638051 | 3300025910 | Bacteria | 908 |
| 448 | Ga0207654_10044982 | 3300025911 | Bacteria | 2510 |
| 449 | Ga0207654_10144411 | 3300025911 | Unclassified | 1521 |
| 450 | Ga0207707_10000015 | 3300025912 | Bacteria | 259670 |
| 451 | Ga0207707_10011095 | 3300025912 | Bacteria | 7835 |
| 452 | Ga0207707_10019734 | 3300025912 | Bacteria | 5884 |
| 453 | Ga0207707_10027639 | 3300025912 | Bacteria | 4960 |
| 454 | Ga0207707_10084084 | 3300025912 | Bacteria | 2779 |
| 455 | Ga0207671_10003690 | 3300025914 | Bacteria | 15096 |
| 456 | Ga0207660_10005726 | 3300025917 | Bacteria | 8063 |
| 457 | Ga0207660_10006252 | 3300025917 | Bacteria | 7731 |
| 458 | Ga0207660_10130565 | 3300025917 | Bacteria | 1912 |
| 459 | Ga0207660_10149062 | 3300025917 | Bacteria | 1796 |
| 460 | Ga0207660_10256267 | 3300025917 | Unclassified | 1382 |
| 461 | Ga0207660_10386906 | 3300025917 | Bacteria | 1125 |
| 462 | Ga0207660_10460245 | 3300025917 | Unclassified | 1029 |
| 463 | Ga0207662_10006504 | 3300025918 | Bacteria | 6313 |
| 464 | Ga0207662_10124583 | 3300025918 | Bacteria | 1619 |
| 465 | Ga0207662_10190607 | 3300025918 | Bacteria | 1323 |
| 466 | Ga0207657_10000432 | 3300025919 | Bacteria | 44554 |
| 467 | Ga0207657_10038770 | 3300025919 | Bacteria | 4238 |
| 468 | Ga0207657_10120733 | 3300025919 | Unclassified | 2156 |
| 469 | Ga0207657_10205880 | 3300025919 | Bacteria | 1581 |
| 470 | Ga0207649_10004830 | 3300025920 | Bacteria | 7286 |
| 471 | Ga0207652_10000253 | 3300025921 | Bacteria | 55673 |
| 472 | Ga0207652_10004232 | 3300025921 | Bacteria | 11708 |
| 473 | Ga0207652_10064735 | 3300025921 | Bacteria | 3164 |
| 474 | Ga0207652_10377260 | 3300025921 | Bacteria | 1280 |
| 475 | Ga0207646_10095640 | 3300025922 | Bacteria | 2661 |
| 476 | Ga0207681_10074652 | 3300025923 | Bacteria | 2376 |
| 477 | Ga0207681_10185204 | 3300025923 | Bacteria | 1589 |
| 478 | Ga0207681_10474388 | 3300025923 | Unclassified | 1021 |
| 479 | Ga0207681_10529716 | 3300025923 | Bacteria | 968 |
| 480 | Ga0207694_10010396 | 3300025924 | Bacteria | 7016 |
| 481 | Ga0207650_10000009 | 3300025925 | Bacteria | 483583 |
| 482 | Ga0207650_10016789 | 3300025925 | Bacteria | 5120 |
| 483 | Ga0207650_10169457 | 3300025925 | Bacteria | 1735 |
| 484 | Ga0207650_10388568 | 3300025925 | Bacteria | 1153 |
| 485 | Ga0207659_10052425 | 3300025926 | Bacteria | 2906 |
| 486 | Ga0207659_10081703 | 3300025926 | Bacteria | 2390 |
| 487 | Ga0207687_10347377 | 3300025927 | Bacteria | 1208 |
| 488 | Ga0207644_10010878 | 3300025931 | Bacteria | 6008 |
| 489 | Ga0207644_10138283 | 3300025931 | Bacteria | 1873 |
| 490 | Ga0207690_10056520 | 3300025932 | Bacteria | 2648 |
| 491 | Ga0207690_10093513 | 3300025932 | Bacteria | 2131 |
| 492 | Ga0207690_10098229 | 3300025932 | Bacteria | 2085 |
| 493 | Ga0207690_10530787 | 3300025932 | Bacteria | 955 |
| 494 | Ga0207706_10405129 | 3300025933 | Bacteria | 1182 |
| 495 | Ga0207706_10406094 | 3300025933 | Bacteria | 1181 |
| 496 | Ga0207706_10632018 | 3300025933 | Bacteria | 918 |
| 497 | Ga0207686_10121632 | 3300025934 | Bacteria | 1778 |
| 498 | Ga0207686_10183059 | 3300025934 | Bacteria | 1487 |
| 499 | Ga0207709_10004095 | 3300025935 | Bacteria | 8486 |
| 500 | Ga0207709_10164676 | 3300025935 | Unclassified | 1550 |
| 501 | Ga0207670_10769264 | 3300025936 | Unclassified | 801 |
| 502 | Ga0207669_10151976 | 3300025937 | Bacteria | 1623 |
| 503 | Ga0207669_10203669 | 3300025937 | Unclassified | 1439 |
| 504 | Ga0207665_10237666 | 3300025939 | Bacteria | 1341 |
| 505 | Ga0207691_10005460 | 3300025940 | Bacteria | 12275 |
| 506 | Ga0207691_10007594 | 3300025940 | Bacteria | 10436 |
| 507 | Ga0207691_10058935 | 3300025940 | Bacteria | 3492 |
| 508 | Ga0207691_10081342 | 3300025940 | Bacteria | 2912 |
| 509 | Ga0207691_10196613 | 3300025940 | Unclassified | 1756 |
| 510 | Ga0207691_10296562 | 3300025940 | Bacteria | 1390 |
| 511 | Ga0207711_10010970 | 3300025941 | Bacteria | 7527 |
| 512 | Ga0207711_10015475 | 3300025941 | Bacteria | 6331 |
| 513 | Ga0207711_10279676 | 3300025941 | Bacteria | 1537 |
| 514 | Ga0207711_10411937 | 3300025941 | Bacteria | 1256 |
| 515 | Ga0207711_10539155 | 3300025941 | Bacteria | 1088 |
| 516 | Ga0207711_10818216 | 3300025941 | Bacteria | 867 |
| 517 | Ga0207689_10125951 | 3300025942 | Bacteria | 2107 |
| 518 | Ga0207689_10171397 | 3300025942 | Bacteria | 1789 |
| 519 | Ga0207689_10239571 | 3300025942 | Bacteria | 1500 |
| 520 | Ga0207689_10687052 | 3300025942 | Bacteria | 863 |
| 521 | Ga0207661_10028646 | 3300025944 | Bacteria | 4268 |
| 522 | Ga0207661_10149295 | 3300025944 | Bacteria | 2019 |
| 523 | Ga0207661_10189464 | 3300025944 | Bacteria | 1802 |
| 524 | Ga0207661_10194740 | 3300025944 | Bacteria | 1779 |
| 525 | Ga0207679_10036288 | 3300025945 | Bacteria | 3495 |
| 526 | Ga0207679_10063737 | 3300025945 | Unclassified | 2752 |
| 527 | Ga0207679_10067526 | 3300025945 | Bacteria | 2682 |
| 528 | Ga0207679_10695276 | 3300025945 | Bacteria | 922 |
| 529 | Ga0207679_10776776 | 3300025945 | Unclassified | 872 |
| 530 | Ga0207679_10810794 | 3300025945 | Bacteria | 854 |
| 531 | Ga0207667_10119119 | 3300025949 | Bacteria | 2721 |
| 532 | Ga0207651_10121381 | 3300025960 | Bacteria | 1982 |
| 533 | Ga0207651_10287771 | 3300025960 | Bacteria | 1361 |
| 534 | Ga0207651_10497533 | 3300025960 | Unclassified | 1053 |
| 535 | Ga0207712_10015539 | 3300025961 | Bacteria | 4914 |
| 536 | Ga0207712_10037657 | 3300025961 | Bacteria | 3302 |
| 537 | Ga0207712_10184263 | 3300025961 | Bacteria | 1642 |
| 538 | Ga0207668_10264231 | 3300025972 | Bacteria | 1404 |
| 539 | Ga0207668_10973734 | 3300025972 | Unclassified | 757 |
| 540 | Ga0207640_10030812 | 3300025981 | Bacteria | 3308 |
| 541 | Ga0207640_10216695 | 3300025981 | Bacteria | 1463 |
| 542 | Ga0207640_10308458 | 3300025981 | Bacteria | 1255 |
| 543 | Ga0207658_10169722 | 3300025986 | Bacteria | 1796 |
| 544 | Ga0207658_10258637 | 3300025986 | Unclassified | 1483 |
| 545 | Ga0207677_10086540 | 3300026023 | Bacteria | 2265 |
| 546 | Ga0207677_10310025 | 3300026023 | Viruses | 1307 |
| 547 | Ga0207703_10101203 | 3300026035 | Bacteria | 2443 |
| 548 | Ga0207703_10357415 | 3300026035 | Bacteria | 1346 |
| 549 | Ga0207639_10170263 | 3300026041 | Unclassified | 1844 |
| 550 | Ga0207639_10793951 | 3300026041 | Bacteria | 882 |
| 551 | Ga0207678_10322868 | 3300026067 | Bacteria | 1328 |
| 552 | Ga0207678_10356505 | 3300026067 | Bacteria | 1262 |
| 553 | Ga0207708_10032899 | 3300026075 | Bacteria | 3937 |
| 554 | Ga0207708_10035821 | 3300026075 | Bacteria | 3776 |
| 555 | Ga0207708_10133653 | 3300026075 | Bacteria | 1941 |
| 556 | Ga0207708_10166145 | 3300026075 | Bacteria | 1745 |
| 557 | Ga0207708_10201623 | 3300026075 | Bacteria | 1587 |
| 558 | Ga0207708_10279779 | 3300026075 | Bacteria | 1352 |
| 559 | Ga0207641_10053459 | 3300026088 | Bacteria | 3424 |
| 560 | Ga0207641_10110759 | 3300026088 | Bacteria | 2433 |
| 561 | Ga0207641_10123284 | 3300026088 | Bacteria | 2316 |
| 562 | Ga0207641_10131881 | 3300026088 | Bacteria | 2245 |
| 563 | Ga0207641_10708856 | 3300026088 | Bacteria | 991 |
| 564 | Ga0207641_11328018 | 3300026088 | Bacteria | 720 |
| 565 | Ga0207648_10045328 | 3300026089 | Bacteria | 3857 |
| 566 | Ga0207648_10046880 | 3300026089 | Bacteria | 3789 |
| 567 | Ga0207648_10122000 | 3300026089 | Bacteria | 2292 |
| 568 | Ga0207648_10122034 | 3300026089 | Bacteria | 2291 |
| 569 | Ga0207648_10170744 | 3300026089 | Bacteria | 1922 |
| 570 | Ga0207676_10010544 | 3300026095 | Bacteria | 6584 |
| 571 | Ga0207676_10015954 | 3300026095 | Bacteria | 5434 |
| 572 | Ga0207676_10088803 | 3300026095 | Unclassified | 2531 |
| 573 | Ga0207676_10088868 | 3300026095 | Bacteria | 2530 |
| 574 | Ga0207676_10207204 | 3300026095 | Bacteria | 1737 |
| 575 | Ga0207676_10834994 | 3300026095 | Unclassified | 900 |
| 576 | Ga0207674_10000036 | 3300026116 | Bacteria | 135434 |
| 577 | Ga0207674_10080019 | 3300026116 | Bacteria | 3271 |
| 578 | Ga0207674_10088804 | 3300026116 | Bacteria | 3083 |
| 579 | Ga0207674_10228298 | 3300026116 | Bacteria | 1810 |
| 580 | Ga0207675_100004763 | 3300026118 | Bacteria | 13073 |
| 581 | Ga0207675_100021047 | 3300026118 | Bacteria | 6080 |
| 582 | Ga0207675_100349776 | 3300026118 | Bacteria | 1448 |
| 583 | Ga0207675_100384023 | 3300026118 | Unclassified | 1381 |
| 584 | Ga0207683_10060668 | 3300026121 | Bacteria | 3325 |
| 585 | Ga0207698_10022351 | 3300026142 | Bacteria | 4393 |
| 586 | Ga0207698_10118214 | 3300026142 | Bacteria | 2238 |
| 587 | Ga0207428_10008435 | 3300027907 | Bacteria | 9303 |
| 588 | Ga0268265_10021396 | 3300028380 | Bacteria | 4530 |
| 589 | Ga0268265_10029798 | 3300028380 | Bacteria | 3924 |
| 590 | Ga0268265_10232457 | 3300028380 | Bacteria | 1621 |
| 591 | Ga0268265_10526912 | 3300028380 | Unclassified | 1118 |
| 592 | Ga0268265_10536249 | 3300028380 | Bacteria | 1109 |
| 593 | Ga0268264_10062557 | 3300028381 | Bacteria | 3125 |
| 594 | Ga0268264_10121248 | 3300028381 | Bacteria | 2304 |
| 595 | Ga0268264_10167421 | 3300028381 | Bacteria | 1985 |
| 596 | Ga0268264_10289706 | 3300028381 | Bacteria | 1537 |
| 597 | Ga0268264_10371909 | 3300028381 | Bacteria | 1366 |
| 598 | Ga0268264_10507550 | 3300028381 | Bacteria | 1177 |
| 599 | Ga0268264_10542848 | 3300028381 | Unclassified | 1139 |
| 600 | Ga0307408_100001243 | 3300031548 | Bacteria | 19119 |
| 601 | Ga0307408_100092047 | 3300031548 | Bacteria | 2291 |
| 602 | Ga0307408_100463348 | 3300031548 | Bacteria | 1102 |
| 603 | Ga0307405_10081512 | 3300031731 | Unclassified | 2115 |
| 604 | Ga0307410_10023943 | 3300031852 | Bacteria | 3807 |
| 605 | Ga0307410_10090006 | 3300031852 | Bacteria | 2176 |
| 606 | Ga0307406_10001021 | 3300031901 | Bacteria | 15570 |
| 607 | Ga0307406_10414832 | 3300031901 | Unclassified | 1071 |
| 608 | Ga0307407_10282757 | 3300031903 | Bacteria | 1150 |
| 609 | Ga0307412_10025475 | 3300031911 | Bacteria | 3665 |
| 610 | Ga0307412_10045820 | 3300031911 | Bacteria | 2861 |
| 611 | Ga0307412_10194818 | 3300031911 | Bacteria | 1535 |
| 612 | Ga0307409_100028349 | 3300031995 | Bacteria | 3988 |
| 613 | Ga0307409_100165559 | 3300031995 | Bacteria | 1940 |
| 614 | Ga0307409_100178926 | 3300031995 | Bacteria | 1875 |
| 615 | Ga0307416_100079110 | 3300032002 | Unclassified | 2769 |
| 616 | Ga0307416_100115235 | 3300032002 | Bacteria | 2379 |
| 617 | Ga0307414_10000585 | 3300032004 | Bacteria | 18889 |
| 618 | Ga0307411_10136405 | 3300032005 | Unclassified | 1802 |
| 619 | Ga0307411_10187652 | 3300032005 | Bacteria | 1575 |
| 620 | Ga0307415_100000479 | 3300032126 | Bacteria | 17301 |
| 621 | Ga0307415_100311952 | 3300032126 | Bacteria | 1307 |
| 622 | Ga0373938_0067568 | 3300034957 | Bacteria | 848 |
| 623 | Ga0373951_0002340 | 3300035091 | Unclassified | 4808 |
| 624 | Ga0373951_0058889 | 3300035091 | Bacteria | 958 |
| 625 | Ga0373941_0013172 | 3300035115 | Bacteria | 2180 |
| 626 | Ga0373943_0275980 | 3300035170 | Unclassified | 949 |
| 627 | Ga0373942_0002199 | 3300035207 | Bacteria | 4798 |
| 628 | Ga0373931_0061976 | 3300035691 | Bacteria | 2018 |
| 629 | Ga0373925_0216663 | 3300037068 | Unclassified | 1527 |
| 630 | Ga0395900_0361786 | 3300037418 | Bacteria | 1422 |
| 631 | Ga0395898_0030070 | 3300037466 | Bacteria | 5439 |
| 632 | Ga0395898_0109812 | 3300037466 | Bacteria | 2644 |
| 633 | Ga0395901_0134830 | 3300038443 | Bacteria | 2595 |
| 634 | Ga0242422_00508 | 3300038699 | Bacteria | 2488 |
| 635 | Ga0436365_0753735 | 3300039437 | Bacteria | 2838 |
| 636 | Ga0436365_1183350 | 3300039437 | Bacteria | 785 |
| 637 | Ga0436362_1219580 | 3300039453 | Bacteria | 1485 |
| 638 | Ga0439455_0140664 | 3300042012 | Unclassified | 684 |
| 639 | Ga0450896_010607 | 3300042133 | Bacteria | 1293 |
| 640 | Ga0439458_0002105 | 3300042157 | Bacteria | 4938 |
| 641 | Ga0439459_0080726 | 3300042438 | Unclassified | 767 |
| 642 | Ga0451577_0013815 | 3300042876 | Bacteria | 7543 |
| 643 | Ga0451577_0154276 | 3300042876 | Unclassified | 2066 |
| 644 | Ga0453684_0051872 | 3300044712 | Bacteria | 5370 |
| 645 | Ga0453684_0702917 | 3300044712 | Bacteria | 1098 |
| 646 | Ga0453684_0713846 | 3300044712 | Bacteria | 1088 |
| 647 | Ga0451576_0183871 | 3300045051 | Unclassified | 2182 |
| 648 | Ga0451576_0329975 | 3300045051 | Bacteria | 1597 |
| 649 | Ga0495629_0087031 | 3300046459 | Unclassified | 2180 |
| 650 | Ga0495580_0171946 | 3300046472 | Unclassified | 1498 |
| 651 | Ga0495582_0027136 | 3300046473 | Bacteria | 3138 |
| 652 | Ga0495639_0114754 | 3300046475 | Bacteria | 1281 |
| 653 | Ga0495662_0226911 | 3300046476 | Bacteria | 921 |
| 654 | Ga0495587_0061577 | 3300046536 | Bacteria | 2199 |
| 655 | Ga0495656_0267389 | 3300046615 | Bacteria | 868 |
| 656 | Ga0495623_0116620 | 3300046679 | Bacteria | 1613 |
| 657 | Ga0495658_0023747 | 3300046683 | Bacteria | 3258 |
| 658 | Ga0495613_0051972 | 3300046689 | Bacteria | 3019 |
| 659 | Ga0495581_0071443 | 3300047315 | Bacteria | 2008 |
| 660 | Ga0495636_0106621 | 3300047318 | Bacteria | 1230 |
| 661 | Ga0495680_0293183 | 3300047322 | Bacteria | 1144 |
| 662 | Ga0496100_0140208 | 3300048903 | Bacteria | 1713 |
| 663 | Ga0496102_0737962 | 3300048905 | Bacteria | 908 |
| 664 | Ga0496104_0026445 | 3300048907 | Bacteria | 5359 |
| 665 | Ga0496104_0351339 | 3300048907 | Bacteria | 1387 |
| 666 | Ga0496106_0064473 | 3300048909 | Bacteria | 2787 |
| 667 | Ga0496106_0337722 | 3300048909 | Bacteria | 1210 |
| 668 | Ga0496107_0390484 | 3300048910 | Unclassified | 1035 |
| 669 | Ga0496108_0214327 | 3300048911 | Bacteria | 1672 |
| 670 | Ga0496109_0155608 | 3300048912 | Bacteria | 2141 |
| 671 | Ga0496110_0165894 | 3300048913 | Bacteria | 2003 |
| 672 | Ga0496110_0460589 | 3300048913 | Unclassified | 1159 |
| 673 | Ga0496111_0232941 | 3300048914 | Bacteria | 1368 |
| 674 | Ga0496112_0003628 | 3300048915 | Bacteria | 12857 |
| 675 | Ga0496112_0105263 | 3300048915 | Bacteria | 2791 |
| 676 | Ga0496112_0148038 | 3300048915 | Bacteria | 2316 |
| 677 | Ga0496112_0223885 | 3300048915 | Unclassified | 1837 |
| 678 | Ga0496112_0262779 | 3300048915 | Unclassified | 1675 |
| 679 | Ga0496112_0714713 | 3300048915 | Unclassified | 929 |
| 680 | Ga0496112_0818765 | 3300048915 | Bacteria | 855 |
| 681 | Ga0496113_0071600 | 3300048916 | Bacteria | 2637 |
| 682 | Ga0496113_0076095 | 3300048916 | Bacteria | 2563 |
| 683 | Ga0496115_0061873 | 3300048918 | Bacteria | 3019 |
| 684 | Ga0501292_025620 | 3300049515 | Unclassified | 972 |
| 685 | Ga0501296_001846 | 3300049519 | Bacteria | 2158 |
| 686 | Ga0501296_011344 | 3300049519 | Unclassified | 1066 |
| 687 | Ga0501298_005326 | 3300049521 | Bacteria | 2059 |
| 688 | Ga0501298_020745 | 3300049521 | Unclassified | 1227 |
| 689 | Ga0501299_001169 | 3300049522 | Bacteria | 3297 |
| 690 | Ga0501299_003968 | 3300049522 | Bacteria | 2177 |
| 691 | Ga0501038_0007917 | 3300049574 | Bacteria | 9799 |
| 692 | Ga0501039_0350717 | 3300049575 | Bacteria | 1160 |
| 693 | Ga0501047_0017450 | 3300049581 | Bacteria | 6875 |
| 694 | Ga0501070_0078070 | 3300049586 | Bacteria | 2740 |
| 695 | Ga0501198_004307 | 3300049649 | Bacteria | 1972 |
| 696 | Ga0501198_004796 | 3300049649 | Unclassified | 1888 |
| 697 | Ga0501201_003184 | 3300049651 | Bacteria | 1505 |
| 698 | Ga0501202_000726 | 3300049652 | Bacteria | 4919 |
| 699 | Ga0501207_003365 | 3300049654 | Unclassified | 2127 |
| 700 | Ga0501208_020754 | 3300049655 | Bacteria | 1072 |
| 701 | Ga0501216_000404 | 3300049660 | Bacteria | 5053 |
| 702 | Ga0501217_000501 | 3300049661 | Bacteria | 6476 |
| 703 | Ga0501217_001421 | 3300049661 | Bacteria | 4483 |
| 704 | Ga0501223_001838 | 3300049663 | Bacteria | 4801 |
| 705 | Ga0501223_016291 | 3300049663 | Bacteria | 1469 |
| 706 | Ga0501223_062810 | 3300049663 | Bacteria | 727 |
| 707 | Ga0501224_001054 | 3300049664 | Unclassified | 3592 |
| 708 | Ga0501224_006907 | 3300049664 | Bacteria | 1651 |
| 709 | Ga0501224_018057 | 3300049664 | Unclassified | 1051 |
| 710 | Ga0501227_018590 | 3300049665 | Unclassified | 1578 |
| 711 | Ga0501230_052488 | 3300049667 | Unclassified | 812 |
| 712 | Ga0501233_008080 | 3300049668 | Bacteria | 2020 |
| 713 | Ga0501233_023161 | 3300049668 | Unclassified | 1347 |
| 714 | Ga0501233_132883 | 3300049668 | Unclassified | 681 |
| 715 | Ga0501235_081883 | 3300049669 | Bacteria | 772 |
| 716 | Ga0501236_009647 | 3300049670 | Unclassified | 1249 |
| 717 | Ga0501239_021443 | 3300049672 | Bacteria | 795 |
| 718 | Ga0501247_036223 | 3300049677 | Bacteria | 691 |
| 719 | Ga0501249_015470 | 3300049679 | Bacteria | 1632 |
| 720 | Ga0501249_071115 | 3300049679 | Bacteria | 813 |
| 721 | Ga0501257_009411 | 3300049686 | Bacteria | 2207 |
| 722 | Ga0501257_022771 | 3300049686 | Unclassified | 1483 |
| 723 | Ga0501259_010695 | 3300049688 | Unclassified | 1503 |
| 724 | Ga0501259_021923 | 3300049688 | Bacteria | 1144 |
| 725 | Ga0501259_026097 | 3300049688 | Bacteria | 1074 |
| 726 | Ga0501221_013909 | 3300049704 | Bacteria | 1488 |
| 727 | Ga0501221_030679 | 3300049704 | Unclassified | 1119 |
| 728 | Ga0501225_0000268 | 3300049705 | Bacteria | 16456 |
| 729 | Ga0501225_0016736 | 3300049705 | Bacteria | 2037 |
| 730 | Ga0501225_0021865 | 3300049705 | Bacteria | 1765 |
| 731 | Ga0501225_0104743 | 3300049705 | Bacteria | 829 |
| 732 | Ga0501229_002612 | 3300049706 | Unclassified | 2126 |
| 733 | Ga0501245_010927 | 3300049708 | Unclassified | 1316 |
| 734 | Ga0501080_0572881 | 3300049742 | Bacteria | 1004 |
| 735 | Ga0501262_025378 | 3300049759 | Bacteria | 832 |
| 736 | Ga0501268_022068 | 3300049765 | Bacteria | 1096 |
| 737 | Ga0501273_017449 | 3300049770 | Unclassified | 948 |
| 738 | Ga0501274_003906 | 3300049771 | Bacteria | 1215 |
| 739 | Ga0501279_016223 | 3300049775 | Bacteria | 1036 |
| 740 | Ga0501212_012785 | 3300049851 | Unclassified | 1225 |
| 741 | Ga0501226_011791 | 3300049853 | Bacteria | 968 |
| 742 | nmdc:mga05p37_154084_c1 | 3300050507 | Bacteria | 2809 |
| 743 | nmdc:mga05p37_196792_c1 | 3300050507 | Bacteria | 2444 |
| 744 | nmdc:mga05p37_250717_c1 | 3300050507 | Bacteria | 2123 |
| 745 | nmdc:mga05p37_571766_c1 | 3300050507 | Unclassified | 1282 |
| 746 | nmdc:mga05p37_72456_c1 | 3300050507 | Unclassified | 4239 |
| 747 | nmdc:mga05p37_867590_c1 | 3300050507 | Bacteria | 978 |
| 748 | nmdc:mga09592_227502_c1 | 3300050508 | Unclassified | 1616 |
| 749 | nmdc:mga09592_40904_c1 | 3300050508 | Bacteria | 3895 |
| 750 | nmdc:mga0qj67_291008_c1 | 3300050509 | Unclassified | 1324 |
| 751 | nmdc:mga0qj67_29879_c1 | 3300050509 | Bacteria | 4236 |
| 752 | nmdc:mga0qj67_5159_c1 | 3300050509 | Bacteria | 9523 |
| 753 | nmdc:mga06r32_25661_c1 | 3300050510 | Bacteria | 5485 |
| 754 | nmdc:mga06r32_299140_c1 | 3300050510 | Bacteria | 1595 |
| 755 | nmdc:mga06r32_46784_c1 | 3300050510 | Unclassified | 4129 |
| 756 | nmdc:mga08y16_187755_c1 | 3300050511 | Bacteria | 2144 |
| 757 | nmdc:mga08y16_228505_c1 | 3300050511 | Bacteria | 1925 |
| 758 | nmdc:mga08y16_34486_c1 | 3300050511 | Bacteria | 5316 |
| 759 | nmdc:mga08y16_358652_c1 | 3300050511 | Unclassified | 1497 |
| 760 | nmdc:mga08y16_605681_c1 | 3300050511 | Unclassified | 1104 |
| 761 | nmdc:mga08y16_720465_c1 | 3300050511 | Bacteria | 996 |
| 762 | nmdc:mga08y16_73811_c1 | 3300050511 | Bacteria | 3554 |
| 763 | nmdc:mga0n895_1020706_c1 | 3300050512 | Bacteria | 807 |
| 764 | nmdc:mga0n895_160092_c1 | 3300050512 | Bacteria | 2283 |
| 765 | nmdc:mga0n895_236378_c1 | 3300050512 | Unclassified | 1854 |
| 766 | nmdc:mga0n895_82408_c1 | 3300050512 | Bacteria | 3207 |
| 767 | nmdc:mga0rr50_116270_c1 | 3300050513 | Bacteria | 2123 |
| 768 | nmdc:mga0rr50_190895_c1 | 3300050513 | Unclassified | 1679 |
| 769 | nmdc:mga0rr50_356114_c1 | 3300050513 | Bacteria | 1231 |
| 770 | nmdc:mga0rr50_650647_c1 | 3300050513 | Bacteria | 899 |
| 771 | nmdc:mga08x19_8914_c1 | 3300050514 | Bacteria | 5985 |
| 772 | nmdc:mga0a205_12578_c1 | 3300050515 | Bacteria | 7831 |
| 773 | nmdc:mga0a205_175881_c1 | 3300050515 | Bacteria | 2036 |
| 774 | nmdc:mga0a205_19133_c1 | 3300050515 | Bacteria | 6454 |
| 775 | nmdc:mga0a205_63313_c1 | 3300050515 | Bacteria | 3573 |
| 776 | nmdc:mga0a205_641779_c1 | 3300050515 | Bacteria | 913 |
| 777 | Ga0501084_0510789 | 3300054114 | Bacteria | 1016 |
| 778 | Ga0530510_0313794 | 3300061734 | Bacteria | 1174 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025939 | Ga0207665_10237666 | Ga0207665_102376662 | 189 |
| 2 | 3300009147 | Ga0114129_10338280 | Ga0114129_103382801 | 195 |
| 3 | 3300050513 | nmdc:mga0rr50_356114_c1 | nmdc:mga0rr50_356114_c1_237_932 | 195 |
| 4 | 3300009093 | Ga0105240_10271544 | Ga0105240_102715442 | 196 |
| 5 | 3300009094 | Ga0111539_10028853 | Ga0111539_100288537 | 196 |
| 6 | 3300009147 | Ga0114129_10668957 | Ga0114129_106689572 | 196 |
| 7 | 3300009177 | Ga0105248_10353466 | Ga0105248_103534662 | 196 |
| 8 | 3300011119 | Ga0105246_10706698 | Ga0105246_107066982 | 196 |
| 9 | 3300013102 | Ga0157371_10032315 | Ga0157371_100323151 | 196 |
| 10 | 3300013297 | Ga0157378_10460256 | Ga0157378_104602562 | 196 |
| 11 | 3300013306 | Ga0163162_10004987 | Ga0163162_100049875 | 196 |
| 12 | 3300013307 | Ga0157372_10082372 | Ga0157372_100823722 | 196 |
| 13 | 3300013308 | Ga0157375_10312236 | Ga0157375_103122362 | 196 |
| 14 | 3300014326 | Ga0157380_10146483 | Ga0157380_101464832 | 196 |
| 15 | 3300014968 | Ga0157379_10025524 | Ga0157379_100255247 | 196 |
| 16 | 3300035170 | Ga0373943_0275980 | Ga0373943_0275980_208_798 | 196 |
| 17 | 3300037068 | Ga0373925_0216663 | Ga0373925_0216663_719_1309 | 196 |
| 18 | 3300042012 | Ga0439455_0140664 | Ga0439455_0140664_14_604 | 196 |
| 19 | 3300045051 | Ga0451576_0183871 | Ga0451576_0183871_382_972 | 196 |
| 20 | 3300046459 | Ga0495629_0087031 | Ga0495629_0087031_166_756 | 196 |
| 21 | 3300046472 | Ga0495580_0171946 | Ga0495580_0171946_138_728 | 196 |
| 22 | 3300046473 | Ga0495582_0027136 | Ga0495582_0027136_261_851 | 196 |
| 23 | 3300046683 | Ga0495658_0023747 | Ga0495658_0023747_542_1132 | 196 |
| 24 | 3300050507 | nmdc:mga05p37_867590_c1 | nmdc:mga05p37_867590_c1_142_732 | 196 |
| 25 | 3300050511 | nmdc:mga08y16_73811_c1 | nmdc:mga08y16_73811_c1_1056_1646 | 196 |
| 26 | 3300050512 | nmdc:mga0n895_82408_c1 | nmdc:mga0n895_82408_c1_890_1480 | 196 |
| 27 | 3300050513 | nmdc:mga0rr50_116270_c1 | nmdc:mga0rr50_116270_c1_773_1363 | 196 |
| 28 | 3300050515 | nmdc:mga0a205_19133_c1 | nmdc:mga0a205_19133_c1_292_882 | 196 |
| 29 | 3300005345 | Ga0070692_10523184 | Ga0070692_105231841 | 201 |
| 30 | 3300005546 | Ga0070696_100835093 | Ga0070696_1008350931 | 201 |
| 31 | 3300009553 | Ga0105249_10272944 | Ga0105249_102729441 | 201 |
| 32 | 3300025917 | Ga0207660_10460245 | Ga0207660_104602451 | 201 |
| 33 | 3300028380 | Ga0268265_10536249 | Ga0268265_105362492 | 201 |
| 34 | 3300042876 | Ga0451577_0013815 | Ga0451577_0013815_5231_5872 | 201 |
| 35 | 3300042876 | Ga0451577_0154276 | Ga0451577_0154276_715_1356 | 201 |
| 36 | 3300044712 | Ga0453684_0051872 | Ga0453684_0051872_3012_3653 | 201 |
| 37 | 3300044712 | Ga0453684_0713846 | Ga0453684_0713846_296_937 | 201 |
| 38 | 3300009094 | Ga0111539_10262265 | Ga0111539_102622653 | 202 |
| 39 | 3300009176 | Ga0105242_10516622 | Ga0105242_105166222 | 202 |
| 40 | 3300009177 | Ga0105248_10471100 | Ga0105248_104711002 | 202 |
| 41 | 3300009177 | Ga0105248_10898012 | Ga0105248_108980121 | 202 |
| 42 | 3300014325 | Ga0163163_10021610 | Ga0163163_100216104 | 202 |
| 43 | 3300015265 | Ga0182005_1042338 | Ga0182005_10423382 | 202 |
| 44 | 3300042133 | Ga0450896_010607 | Ga0450896_010607_569_1177 | 202 |
| 45 | 3300050509 | nmdc:mga0qj67_5159_c1 | nmdc:mga0qj67_5159_c1_7473_8081 | 202 |
| 46 | 3300050511 | nmdc:mga08y16_228505_c1 | nmdc:mga08y16_228505_c1_17_625 | 202 |
| 47 | 3300005354 | Ga0070675_100186512 | Ga0070675_1001865122 | 203 |
| 48 | 3300005364 | Ga0070673_100325774 | Ga0070673_1003257742 | 203 |
| 49 | 3300013104 | Ga0157370_10003071 | Ga0157370_100030719 | 203 |
| 50 | 3300013308 | Ga0157375_10331166 | Ga0157375_103311662 | 203 |
| 51 | 3300014325 | Ga0163163_10170504 | Ga0163163_101705045 | 203 |
| 52 | 3300025925 | Ga0207650_10016789 | Ga0207650_100167895 | 203 |
| 53 | 3300025933 | Ga0207706_10405129 | Ga0207706_104051291 | 203 |
| 54 | 3300025942 | Ga0207689_10239571 | Ga0207689_102395712 | 203 |
| 55 | 3300039437 | Ga0436365_0753735 | Ga0436365_0753735_834_1496 | 203 |
| 56 | 3300039453 | Ga0436362_1219580 | Ga0436362_1219580_192_854 | 203 |
| 57 | 3300046475 | Ga0495639_0114754 | Ga0495639_0114754_262_894 | 203 |
| 58 | 3300046476 | Ga0495662_0226911 | Ga0495662_0226911_78_710 | 203 |
| 59 | 3300046536 | Ga0495587_0061577 | Ga0495587_0061577_1252_1884 | 203 |
| 60 | 3300046689 | Ga0495613_0051972 | Ga0495613_0051972_638_1270 | 203 |
| 61 | 3300047315 | Ga0495581_0071443 | Ga0495581_0071443_1227_1859 | 203 |
| 62 | 3300047322 | Ga0495680_0293183 | Ga0495680_0293183_251_883 | 203 |
| 63 | 3300048915 | Ga0496112_0818765 | Ga0496112_0818765_227_841 | 203 |
| 64 | 3300048918 | Ga0496115_0061873 | Ga0496115_0061873_2016_2648 | 203 |
| 65 | 3300049742 | Ga0501080_0572881 | Ga0501080_0572881_52_684 | 203 |
| 66 | 3300050510 | nmdc:mga06r32_299140_c1 | nmdc:mga06r32_299140_c1_92_703 | 203 |
| 67 | 2162886011 | MRS1b_contig_2056278 | MRS1b_0831.00002370 | 204 |
| 68 | 3300005290 | Ga0065712_10155384 | Ga0065712_101553841 | 204 |
| 69 | 3300005327 | Ga0070658_10002464 | Ga0070658_100024642 | 204 |
| 70 | 3300005327 | Ga0070658_10005958 | Ga0070658_100059588 | 204 |
| 71 | 3300005327 | Ga0070658_10157855 | Ga0070658_101578552 | 204 |
| 72 | 3300005327 | Ga0070658_10180351 | Ga0070658_101803513 | 204 |
| 73 | 3300005328 | Ga0070676_10025393 | Ga0070676_100253934 | 204 |
| 74 | 3300005329 | Ga0070683_100026660 | Ga0070683_1000266604 | 204 |
| 75 | 3300005329 | Ga0070683_100048690 | Ga0070683_1000486907 | 204 |
| 76 | 3300005329 | Ga0070683_100053305 | Ga0070683_1000533053 | 204 |
| 77 | 3300005329 | Ga0070683_100568855 | Ga0070683_1005688552 | 204 |
| 78 | 3300005336 | Ga0070680_100161341 | Ga0070680_1001613412 | 204 |
| 79 | 3300005338 | Ga0068868_100018852 | Ga0068868_1000188521 | 204 |
| 80 | 3300005338 | Ga0068868_100316346 | Ga0068868_1003163462 | 204 |
| 81 | 3300005339 | Ga0070660_100000988 | Ga0070660_1000009889 | 204 |
| 82 | 3300005340 | Ga0070689_100709725 | Ga0070689_1007097252 | 204 |
| 83 | 3300005343 | Ga0070687_100143573 | Ga0070687_1001435733 | 204 |
| 84 | 3300005344 | Ga0070661_100039569 | Ga0070661_1000395694 | 204 |
| 85 | 3300005347 | Ga0070668_100119168 | Ga0070668_1001191684 | 204 |
| 86 | 3300005353 | Ga0070669_100130023 | Ga0070669_1001300233 | 204 |
| 87 | 3300005353 | Ga0070669_100170970 | Ga0070669_1001709701 | 204 |
| 88 | 3300005354 | Ga0070675_100321704 | Ga0070675_1003217043 | 204 |
| 89 | 3300005354 | Ga0070675_100455687 | Ga0070675_1004556871 | 204 |
| 90 | 3300005355 | Ga0070671_100037834 | Ga0070671_1000378345 | 204 |
| 91 | 3300005364 | Ga0070673_100110467 | Ga0070673_1001104673 | 204 |
| 92 | 3300005366 | Ga0070659_100106891 | Ga0070659_1001068912 | 204 |
| 93 | 3300005366 | Ga0070659_100900908 | Ga0070659_1009009081 | 204 |
| 94 | 3300005367 | Ga0070667_100062002 | Ga0070667_1000620024 | 204 |
| 95 | 3300005367 | Ga0070667_100573917 | Ga0070667_1005739172 | 204 |
| 96 | 3300005457 | Ga0070662_100238356 | Ga0070662_1002383562 | 204 |
| 97 | 3300005458 | Ga0070681_10007686 | Ga0070681_1000768610 | 204 |
| 98 | 3300005471 | Ga0070698_100897029 | Ga0070698_1008970291 | 204 |
| 99 | 3300005530 | Ga0070679_100001326 | Ga0070679_1000013268 | 204 |
| 100 | 3300005530 | Ga0070679_100108349 | Ga0070679_1001083493 | 204 |
| 101 | 3300005530 | Ga0070679_100432040 | Ga0070679_1004320401 | 204 |
| 102 | 3300005535 | Ga0070684_100039618 | Ga0070684_1000396183 | 204 |
| 103 | 3300005535 | Ga0070684_100204778 | Ga0070684_1002047783 | 204 |
| 104 | 3300005535 | Ga0070684_100658288 | Ga0070684_1006582881 | 204 |
| 105 | 3300005539 | Ga0068853_100015189 | Ga0068853_1000151894 | 204 |
| 106 | 3300005543 | Ga0070672_100064549 | Ga0070672_1000645494 | 204 |
| 107 | 3300005543 | Ga0070672_100072178 | Ga0070672_1000721781 | 204 |
| 108 | 3300005543 | Ga0070672_100164230 | Ga0070672_1001642303 | 204 |
| 109 | 3300005544 | Ga0070686_100269166 | Ga0070686_1002691662 | 204 |
| 110 | 3300005564 | Ga0070664_100452038 | Ga0070664_1004520382 | 204 |
| 111 | 3300005577 | Ga0068857_100325729 | Ga0068857_1003257292 | 204 |
| 112 | 3300005616 | Ga0068852_100042394 | Ga0068852_1000423943 | 204 |
| 113 | 3300005617 | Ga0068859_100048664 | Ga0068859_1000486642 | 204 |
| 114 | 3300005617 | Ga0068859_100100661 | Ga0068859_1001006614 | 204 |
| 115 | 3300005618 | Ga0068864_100201523 | Ga0068864_1002015232 | 204 |
| 116 | 3300005618 | Ga0068864_100398103 | Ga0068864_1003981032 | 204 |
| 117 | 3300005841 | Ga0068863_100836050 | Ga0068863_1008360502 | 204 |
| 118 | 3300005842 | Ga0068858_100280650 | Ga0068858_1002806503 | 204 |
| 119 | 3300005843 | Ga0068860_100123760 | Ga0068860_1001237604 | 204 |
| 120 | 3300005843 | Ga0068860_100423238 | Ga0068860_1004232383 | 204 |
| 121 | 3300005844 | Ga0068862_100114154 | Ga0068862_1001141543 | 204 |
| 122 | 3300006881 | Ga0068865_100101415 | Ga0068865_1001014153 | 204 |
| 123 | 3300006931 | Ga0097620_100048664 | Ga0097620_1000486646 | 204 |
| 124 | 3300006931 | Ga0097620_100100663 | Ga0097620_1001006634 | 204 |
| 125 | 3300007076 | Ga0075435_100638599 | Ga0075435_1006385992 | 204 |
| 126 | 3300009094 | Ga0111539_10115883 | Ga0111539_101158833 | 204 |
| 127 | 3300009176 | Ga0105242_10320683 | Ga0105242_103206832 | 204 |
| 128 | 3300009177 | Ga0105248_10124698 | Ga0105248_101246982 | 204 |
| 129 | 3300009177 | Ga0105248_10346833 | Ga0105248_103468332 | 204 |
| 130 | 3300009177 | Ga0105248_10973668 | Ga0105248_109736682 | 204 |
| 131 | 3300013100 | Ga0157373_10011153 | Ga0157373_100111537 | 204 |
| 132 | 3300013102 | Ga0157371_10015820 | Ga0157371_100158202 | 204 |
| 133 | 3300013102 | Ga0157371_10035193 | Ga0157371_100351933 | 204 |
| 134 | 3300013102 | Ga0157371_10501976 | Ga0157371_105019762 | 204 |
| 135 | 3300013102 | Ga0157371_10616830 | Ga0157371_106168301 | 204 |
| 136 | 3300013105 | Ga0157369_10004455 | Ga0157369_1000445516 | 204 |
| 137 | 3300013105 | Ga0157369_10029579 | Ga0157369_100295794 | 204 |
| 138 | 3300013105 | Ga0157369_10577148 | Ga0157369_105771482 | 204 |
| 139 | 3300013306 | Ga0163162_10173782 | Ga0163162_101737824 | 204 |
| 140 | 3300013307 | Ga0157372_10001740 | Ga0157372_100017405 | 204 |
| 141 | 3300013307 | Ga0157372_10020733 | Ga0157372_100207338 | 204 |
| 142 | 3300013307 | Ga0157372_10074735 | Ga0157372_100747352 | 204 |
| 143 | 3300013307 | Ga0157372_10085626 | Ga0157372_100856263 | 204 |
| 144 | 3300013307 | Ga0157372_10235864 | Ga0157372_102358644 | 204 |
| 145 | 3300013307 | Ga0157372_10381665 | Ga0157372_103816651 | 204 |
| 146 | 3300013308 | Ga0157375_10046224 | Ga0157375_100462244 | 204 |
| 147 | 3300013308 | Ga0157375_10763537 | Ga0157375_107635372 | 204 |
| 148 | 3300015262 | Ga0182007_10159703 | Ga0182007_101597031 | 204 |
| 149 | 3300025907 | Ga0207645_10057662 | Ga0207645_100576624 | 204 |
| 150 | 3300025909 | Ga0207705_10003006 | Ga0207705_1000300610 | 204 |
| 151 | 3300025909 | Ga0207705_10003715 | Ga0207705_100037155 | 204 |
| 152 | 3300025909 | Ga0207705_10077432 | Ga0207705_100774323 | 204 |
| 153 | 3300025909 | Ga0207705_10108520 | Ga0207705_101085203 | 204 |
| 154 | 3300025909 | Ga0207705_10194609 | Ga0207705_101946092 | 204 |
| 155 | 3300025910 | Ga0207684_10638051 | Ga0207684_106380512 | 204 |
| 156 | 3300025912 | Ga0207707_10011095 | Ga0207707_100110958 | 204 |
| 157 | 3300025917 | Ga0207660_10130565 | Ga0207660_101305652 | 204 |
| 158 | 3300025917 | Ga0207660_10386906 | Ga0207660_103869062 | 204 |
| 159 | 3300025919 | Ga0207657_10000432 | Ga0207657_1000043215 | 204 |
| 160 | 3300025919 | Ga0207657_10038770 | Ga0207657_100387706 | 204 |
| 161 | 3300025919 | Ga0207657_10205880 | Ga0207657_102058803 | 204 |
| 162 | 3300025921 | Ga0207652_10004232 | Ga0207652_100042325 | 204 |
| 163 | 3300025921 | Ga0207652_10064735 | Ga0207652_100647354 | 204 |
| 164 | 3300025921 | Ga0207652_10377260 | Ga0207652_103772602 | 204 |
| 165 | 3300025923 | Ga0207681_10074652 | Ga0207681_100746522 | 204 |
| 166 | 3300025923 | Ga0207681_10185204 | Ga0207681_101852042 | 204 |
| 167 | 3300025923 | Ga0207681_10529716 | Ga0207681_105297161 | 204 |
| 168 | 3300025925 | Ga0207650_10388568 | Ga0207650_103885682 | 204 |
| 169 | 3300025926 | Ga0207659_10081703 | Ga0207659_100817032 | 204 |
| 170 | 3300025927 | Ga0207687_10347377 | Ga0207687_103473772 | 204 |
| 171 | 3300025932 | Ga0207690_10093513 | Ga0207690_100935132 | 204 |
| 172 | 3300025932 | Ga0207690_10098229 | Ga0207690_100982292 | 204 |
| 173 | 3300025932 | Ga0207690_10530787 | Ga0207690_105307872 | 204 |
| 174 | 3300025933 | Ga0207706_10632018 | Ga0207706_106320182 | 204 |
| 175 | 3300025937 | Ga0207669_10203669 | Ga0207669_102036692 | 204 |
| 176 | 3300025940 | Ga0207691_10007594 | Ga0207691_100075943 | 204 |
| 177 | 3300025940 | Ga0207691_10058935 | Ga0207691_100589355 | 204 |
| 178 | 3300025940 | Ga0207691_10081342 | Ga0207691_100813422 | 204 |
| 179 | 3300025940 | Ga0207691_10296562 | Ga0207691_102965623 | 204 |
| 180 | 3300025941 | Ga0207711_10539155 | Ga0207711_105391552 | 204 |
| 181 | 3300025941 | Ga0207711_10818216 | Ga0207711_108182161 | 204 |
| 182 | 3300025944 | Ga0207661_10028646 | Ga0207661_100286464 | 204 |
| 183 | 3300025944 | Ga0207661_10149295 | Ga0207661_101492953 | 204 |
| 184 | 3300025944 | Ga0207661_10189464 | Ga0207661_101894643 | 204 |
| 185 | 3300025944 | Ga0207661_10194740 | Ga0207661_101947402 | 204 |
| 186 | 3300025945 | Ga0207679_10036288 | Ga0207679_100362883 | 204 |
| 187 | 3300025945 | Ga0207679_10067526 | Ga0207679_100675263 | 204 |
| 188 | 3300025945 | Ga0207679_10695276 | Ga0207679_106952761 | 204 |
| 189 | 3300025945 | Ga0207679_10776776 | Ga0207679_107767762 | 204 |
| 190 | 3300025960 | Ga0207651_10121381 | Ga0207651_101213812 | 204 |
| 191 | 3300025972 | Ga0207668_10264231 | Ga0207668_102642313 | 204 |
| 192 | 3300025972 | Ga0207668_10973734 | Ga0207668_109737341 | 204 |
| 193 | 3300025981 | Ga0207640_10216695 | Ga0207640_102166952 | 204 |
| 194 | 3300025986 | Ga0207658_10169722 | Ga0207658_101697222 | 204 |
| 195 | 3300026023 | Ga0207677_10086540 | Ga0207677_100865403 | 204 |
| 196 | 3300026067 | Ga0207678_10356505 | Ga0207678_103565052 | 204 |
| 197 | 3300026075 | Ga0207708_10166145 | Ga0207708_101661453 | 204 |
| 198 | 3300026089 | Ga0207648_10046880 | Ga0207648_100468803 | 204 |
| 199 | 3300026095 | Ga0207676_10015954 | Ga0207676_100159544 | 204 |
| 200 | 3300026095 | Ga0207676_10207204 | Ga0207676_102072043 | 204 |
| 201 | 3300026116 | Ga0207674_10080019 | Ga0207674_100800194 | 204 |
| 202 | 3300026118 | Ga0207675_100384023 | Ga0207675_1003840232 | 204 |
| 203 | 3300026142 | Ga0207698_10022351 | Ga0207698_100223512 | 204 |
| 204 | 3300028380 | Ga0268265_10232457 | Ga0268265_102324572 | 204 |
| 205 | 3300028381 | Ga0268264_10507550 | Ga0268264_105075503 | 204 |
| 206 | 3300039437 | Ga0436365_1183350 | Ga0436365_1183350_100_738 | 204 |
| 207 | 3300044712 | Ga0453684_0702917 | Ga0453684_0702917_235_933 | 204 |
| 208 | 3300046615 | Ga0495656_0267389 | Ga0495656_0267389_105_770 | 204 |
| 209 | 3300046679 | Ga0495623_0116620 | Ga0495623_0116620_728_1366 | 204 |
| 210 | 3300047318 | Ga0495636_0106621 | Ga0495636_0106621_228_863 | 204 |
| 211 | 3300048903 | Ga0496100_0140208 | Ga0496100_0140208_987_1625 | 204 |
| 212 | 3300048907 | Ga0496104_0026445 | Ga0496104_0026445_333_1019 | 204 |
| 213 | 3300048909 | Ga0496106_0337722 | Ga0496106_0337722_181_819 | 204 |
| 214 | 3300048911 | Ga0496108_0214327 | Ga0496108_0214327_833_1519 | 204 |
| 215 | 3300048912 | Ga0496109_0155608 | Ga0496109_0155608_250_936 | 204 |
| 216 | 3300048913 | Ga0496110_0460589 | Ga0496110_0460589_14_652 | 204 |
| 217 | 3300048915 | Ga0496112_0003628 | Ga0496112_0003628_10803_11489 | 204 |
| 218 | 3300048916 | Ga0496113_0071600 | Ga0496113_0071600_271_957 | 204 |
| 219 | 3300048916 | Ga0496113_0076095 | Ga0496113_0076095_574_1212 | 204 |
| 220 | 3300049575 | Ga0501039_0350717 | Ga0501039_0350717_106_741 | 204 |
| 221 | 3300049581 | Ga0501047_0017450 | Ga0501047_0017450_756_1391 | 204 |
| 222 | 3300049586 | Ga0501070_0078070 | Ga0501070_0078070_1327_1962 | 204 |
| 223 | 3300050511 | nmdc:mga08y16_187755_c1 | nmdc:mga08y16_187755_c1_523_1161 | 204 |
| 224 | 3300050513 | nmdc:mga0rr50_650647_c1 | nmdc:mga0rr50_650647_c1_80_766 | 204 |
| 225 | 3300005440 | Ga0070705_100321466 | Ga0070705_1003214661 | 205 |
| 226 | 3300005445 | Ga0070708_100275416 | Ga0070708_1002754162 | 205 |
| 227 | 3300005467 | Ga0070706_100030111 | Ga0070706_1000301112 | 205 |
| 228 | 3300005518 | Ga0070699_100022438 | Ga0070699_1000224381 | 205 |
| 229 | 3300005518 | Ga0070699_100592213 | Ga0070699_1005922132 | 205 |
| 230 | 3300005536 | Ga0070697_100000366 | Ga0070697_1000003667 | 205 |
| 231 | 3300005536 | Ga0070697_100057838 | Ga0070697_1000578384 | 205 |
| 232 | 3300005536 | Ga0070697_100153538 | Ga0070697_1001535382 | 205 |
| 233 | 3300005536 | Ga0070697_100268567 | Ga0070697_1002685672 | 205 |
| 234 | 3300005546 | Ga0070696_100060769 | Ga0070696_1000607694 | 205 |
| 235 | 3300005549 | Ga0070704_100051780 | Ga0070704_1000517803 | 205 |
| 236 | 3300005719 | Ga0068861_100055926 | Ga0068861_1000559264 | 205 |
| 237 | 3300006844 | Ga0075428_100845779 | Ga0075428_1008457791 | 205 |
| 238 | 3300006880 | Ga0075429_100025872 | Ga0075429_1000258724 | 205 |
| 239 | 3300006931 | Ga0097620_100150365 | Ga0097620_1001503652 | 205 |
| 240 | 3300009147 | Ga0114129_10175898 | Ga0114129_101758982 | 205 |
| 241 | 3300009147 | Ga0114129_10504730 | Ga0114129_105047302 | 205 |
| 242 | 3300009147 | Ga0114129_11753732 | Ga0114129_117537321 | 205 |
| 243 | 3300009553 | Ga0105249_10001430 | Ga0105249_100014305 | 205 |
| 244 | 3300013297 | Ga0157378_10059181 | Ga0157378_100591814 | 205 |
| 245 | 3300013306 | Ga0163162_10000027 | Ga0163162_10000027121 | 205 |
| 246 | 3300025910 | Ga0207684_10199837 | Ga0207684_101998371 | 205 |
| 247 | 2162886007 | SwRhRL2b_contig_634714 | SwRhRL2b_0817.00003990 | 206 |
| 248 | 3300002459 | JGI24751J29686_10000049 | JGI24751J29686_1000004947 | 206 |
| 249 | 3300003203 | JGI25406J46586_10021838 | JGI25406J46586_100218383 | 206 |
| 250 | 3300003322 | rootL2_10255558 | rootL2_102555582 | 206 |
| 251 | 3300005288 | Ga0065714_10064507 | Ga0065714_1006450714 | 206 |
| 252 | 3300005289 | Ga0065704_10071515 | Ga0065704_100715157 | 206 |
| 253 | 3300005290 | Ga0065712_10000138 | Ga0065712_1000013834 | 206 |
| 254 | 3300005290 | Ga0065712_10000296 | Ga0065712_100002964 | 206 |
| 255 | 3300005290 | Ga0065712_10080959 | Ga0065712_100809594 | 206 |
| 256 | 3300005290 | Ga0065712_10095370 | Ga0065712_100953702 | 206 |
| 257 | 3300005290 | Ga0065712_10242962 | Ga0065712_102429621 | 206 |
| 258 | 3300005293 | Ga0065715_10004340 | Ga0065715_100043408 | 206 |
| 259 | 3300005293 | Ga0065715_10005901 | Ga0065715_100059014 | 206 |
| 260 | 3300005293 | Ga0065715_10022879 | Ga0065715_100228792 | 206 |
| 261 | 3300005293 | Ga0065715_10033378 | Ga0065715_100333781 | 206 |
| 262 | 3300005293 | Ga0065715_10109003 | Ga0065715_101090033 | 206 |
| 263 | 3300005293 | Ga0065715_10341202 | Ga0065715_103412021 | 206 |
| 264 | 3300005295 | Ga0065707_10087245 | Ga0065707_100872454 | 206 |
| 265 | 3300005295 | Ga0065707_10094864 | Ga0065707_100948643 | 206 |
| 266 | 3300005295 | Ga0065707_10158018 | Ga0065707_101580182 | 206 |
| 267 | 3300005328 | Ga0070676_10057386 | Ga0070676_100573862 | 206 |
| 268 | 3300005330 | Ga0070690_100005770 | Ga0070690_1000057705 | 206 |
| 269 | 3300005331 | Ga0070670_100022889 | Ga0070670_1000228898 | 206 |
| 270 | 3300005331 | Ga0070670_100069882 | Ga0070670_1000698824 | 206 |
| 271 | 3300005334 | Ga0068869_100065048 | Ga0068869_1000650482 | 206 |
| 272 | 3300005334 | Ga0068869_100264201 | Ga0068869_1002642012 | 206 |
| 273 | 3300005334 | Ga0068869_100387138 | Ga0068869_1003871382 | 206 |
| 274 | 3300005335 | Ga0070666_10116685 | Ga0070666_101166852 | 206 |
| 275 | 3300005336 | Ga0070680_100009370 | Ga0070680_1000093705 | 206 |
| 276 | 3300005336 | Ga0070680_100021413 | Ga0070680_1000214133 | 206 |
| 277 | 3300005337 | Ga0070682_100002890 | Ga0070682_10000289010 | 206 |
| 278 | 3300005337 | Ga0070682_100003390 | Ga0070682_10000339012 | 206 |
| 279 | 3300005337 | Ga0070682_100205057 | Ga0070682_1002050572 | 206 |
| 280 | 3300005338 | Ga0068868_100417884 | Ga0068868_1004178842 | 206 |
| 281 | 3300005339 | Ga0070660_100111873 | Ga0070660_1001118733 | 206 |
| 282 | 3300005340 | Ga0070689_100340771 | Ga0070689_1003407712 | 206 |
| 283 | 3300005340 | Ga0070689_100610916 | Ga0070689_1006109161 | 206 |
| 284 | 3300005343 | Ga0070687_100124760 | Ga0070687_1001247601 | 206 |
| 285 | 3300005344 | Ga0070661_100005268 | Ga0070661_1000052685 | 206 |
| 286 | 3300005345 | Ga0070692_10009492 | Ga0070692_100094923 | 206 |
| 287 | 3300005345 | Ga0070692_10029041 | Ga0070692_100290413 | 206 |
| 288 | 3300005345 | Ga0070692_10126341 | Ga0070692_101263412 | 206 |
| 289 | 3300005345 | Ga0070692_10160482 | Ga0070692_101604822 | 206 |
| 290 | 3300005345 | Ga0070692_10445531 | Ga0070692_104455311 | 206 |
| 291 | 3300005353 | Ga0070669_100079505 | Ga0070669_1000795052 | 206 |
| 292 | 3300005355 | Ga0070671_100003695 | Ga0070671_1000036954 | 206 |
| 293 | 3300005355 | Ga0070671_100044712 | Ga0070671_1000447124 | 206 |
| 294 | 3300005355 | Ga0070671_100104686 | Ga0070671_1001046862 | 206 |
| 295 | 3300005356 | Ga0070674_100322385 | Ga0070674_1003223851 | 206 |
| 296 | 3300005364 | Ga0070673_100039820 | Ga0070673_1000398202 | 206 |
| 297 | 3300005364 | Ga0070673_100085054 | Ga0070673_1000850542 | 206 |
| 298 | 3300005364 | Ga0070673_100325616 | Ga0070673_1003256162 | 206 |
| 299 | 3300005364 | Ga0070673_100583942 | Ga0070673_1005839422 | 206 |
| 300 | 3300005365 | Ga0070688_100167768 | Ga0070688_1001677681 | 206 |
| 301 | 3300005366 | Ga0070659_100022165 | Ga0070659_1000221655 | 206 |
| 302 | 3300005367 | Ga0070667_100032807 | Ga0070667_1000328073 | 206 |
| 303 | 3300005367 | Ga0070667_100272039 | Ga0070667_1002720391 | 206 |
| 304 | 3300005406 | Ga0070703_10014271 | Ga0070703_100142713 | 206 |
| 305 | 3300005438 | Ga0070701_10087404 | Ga0070701_100874042 | 206 |
| 306 | 3300005440 | Ga0070705_100001180 | Ga0070705_1000011804 | 206 |
| 307 | 3300005440 | Ga0070705_100272842 | Ga0070705_1002728422 | 206 |
| 308 | 3300005441 | Ga0070700_100037052 | Ga0070700_1000370524 | 206 |
| 309 | 3300005441 | Ga0070700_100071533 | Ga0070700_1000715332 | 206 |
| 310 | 3300005441 | Ga0070700_100276478 | Ga0070700_1002764782 | 206 |
| 311 | 3300005444 | Ga0070694_100003400 | Ga0070694_1000034004 | 206 |
| 312 | 3300005444 | Ga0070694_100026914 | Ga0070694_1000269143 | 206 |
| 313 | 3300005444 | Ga0070694_100029349 | Ga0070694_1000293492 | 206 |
| 314 | 3300005444 | Ga0070694_100289868 | Ga0070694_1002898681 | 206 |
| 315 | 3300005444 | Ga0070694_100294567 | Ga0070694_1002945671 | 206 |
| 316 | 3300005444 | Ga0070694_100339785 | Ga0070694_1003397852 | 206 |
| 317 | 3300005445 | Ga0070708_100000147 | Ga0070708_10000014741 | 206 |
| 318 | 3300005455 | Ga0070663_100275423 | Ga0070663_1002754232 | 206 |
| 319 | 3300005456 | Ga0070678_100021052 | Ga0070678_1000210524 | 206 |
| 320 | 3300005457 | Ga0070662_100741850 | Ga0070662_1007418501 | 206 |
| 321 | 3300005457 | Ga0070662_100758662 | Ga0070662_1007586621 | 206 |
| 322 | 3300005458 | Ga0070681_10000110 | Ga0070681_1000011031 | 206 |
| 323 | 3300005458 | Ga0070681_10003413 | Ga0070681_1000341313 | 206 |
| 324 | 3300005458 | Ga0070681_10003933 | Ga0070681_100039334 | 206 |
| 325 | 3300005458 | Ga0070681_10083531 | Ga0070681_100835313 | 206 |
| 326 | 3300005458 | Ga0070681_10104289 | Ga0070681_101042892 | 206 |
| 327 | 3300005459 | Ga0068867_100017771 | Ga0068867_1000177715 | 206 |
| 328 | 3300005459 | Ga0068867_100031255 | Ga0068867_1000312554 | 206 |
| 329 | 3300005459 | Ga0068867_100656091 | Ga0068867_1006560912 | 206 |
| 330 | 3300005466 | Ga0070685_10219607 | Ga0070685_102196072 | 206 |
| 331 | 3300005467 | Ga0070706_100043041 | Ga0070706_1000430414 | 206 |
| 332 | 3300005467 | Ga0070706_100144467 | Ga0070706_1001444674 | 206 |
| 333 | 3300005468 | Ga0070707_100141374 | Ga0070707_1001413742 | 206 |
| 334 | 3300005471 | Ga0070698_100002024 | Ga0070698_10000202411 | 206 |
| 335 | 3300005471 | Ga0070698_100005990 | Ga0070698_10000599010 | 206 |
| 336 | 3300005471 | Ga0070698_100008639 | Ga0070698_1000086393 | 206 |
| 337 | 3300005471 | Ga0070698_100035160 | Ga0070698_1000351602 | 206 |
| 338 | 3300005518 | Ga0070699_100008648 | Ga0070699_1000086485 | 206 |
| 339 | 3300005518 | Ga0070699_100012911 | Ga0070699_1000129117 | 206 |
| 340 | 3300005518 | Ga0070699_100126214 | Ga0070699_1001262142 | 206 |
| 341 | 3300005518 | Ga0070699_100438989 | Ga0070699_1004389891 | 206 |
| 342 | 3300005530 | Ga0070679_100000060 | Ga0070679_10000006034 | 206 |
| 343 | 3300005530 | Ga0070679_100129400 | Ga0070679_1001294003 | 206 |
| 344 | 3300005536 | Ga0070697_100001795 | Ga0070697_1000017953 | 206 |
| 345 | 3300005536 | Ga0070697_100040260 | Ga0070697_1000402605 | 206 |
| 346 | 3300005539 | Ga0068853_100015348 | Ga0068853_1000153484 | 206 |
| 347 | 3300005539 | Ga0068853_100632113 | Ga0068853_1006321132 | 206 |
| 348 | 3300005539 | Ga0068853_100873477 | Ga0068853_1008734771 | 206 |
| 349 | 3300005543 | Ga0070672_100233819 | Ga0070672_1002338192 | 206 |
| 350 | 3300005544 | Ga0070686_100071842 | Ga0070686_1000718422 | 206 |
| 351 | 3300005545 | Ga0070695_100045162 | Ga0070695_1000451623 | 206 |
| 352 | 3300005545 | Ga0070695_100334669 | Ga0070695_1003346692 | 206 |
| 353 | 3300005545 | Ga0070695_100467101 | Ga0070695_1004671012 | 206 |
| 354 | 3300005546 | Ga0070696_100046031 | Ga0070696_1000460313 | 206 |
| 355 | 3300005546 | Ga0070696_100101732 | Ga0070696_1001017322 | 206 |
| 356 | 3300005546 | Ga0070696_100135175 | Ga0070696_1001351752 | 206 |
| 357 | 3300005546 | Ga0070696_100166170 | Ga0070696_1001661702 | 206 |
| 358 | 3300005546 | Ga0070696_100281073 | Ga0070696_1002810732 | 206 |
| 359 | 3300005546 | Ga0070696_100412671 | Ga0070696_1004126712 | 206 |
| 360 | 3300005547 | Ga0070693_100005900 | Ga0070693_1000059004 | 206 |
| 361 | 3300005547 | Ga0070693_100010936 | Ga0070693_1000109363 | 206 |
| 362 | 3300005547 | Ga0070693_100152941 | Ga0070693_1001529412 | 206 |
| 363 | 3300005549 | Ga0070704_100010265 | Ga0070704_1000102654 | 206 |
| 364 | 3300005549 | Ga0070704_100362035 | Ga0070704_1003620352 | 206 |
| 365 | 3300005563 | Ga0068855_100254946 | Ga0068855_1002549462 | 206 |
| 366 | 3300005564 | Ga0070664_100001504 | Ga0070664_10000150417 | 206 |
| 367 | 3300005564 | Ga0070664_100031842 | Ga0070664_1000318423 | 206 |
| 368 | 3300005564 | Ga0070664_100276485 | Ga0070664_1002764852 | 206 |
| 369 | 3300005577 | Ga0068857_100001572 | Ga0068857_10000157211 | 206 |
| 370 | 3300005577 | Ga0068857_100086416 | Ga0068857_1000864162 | 206 |
| 371 | 3300005577 | Ga0068857_100094287 | Ga0068857_1000942874 | 206 |
| 372 | 3300005577 | Ga0068857_100162106 | Ga0068857_1001621062 | 206 |
| 373 | 3300005578 | Ga0068854_100061524 | Ga0068854_1000615242 | 206 |
| 374 | 3300005578 | Ga0068854_100156605 | Ga0068854_1001566052 | 206 |
| 375 | 3300005578 | Ga0068854_100221745 | Ga0068854_1002217451 | 206 |
| 376 | 3300005578 | Ga0068854_100284021 | Ga0068854_1002840212 | 206 |
| 377 | 3300005615 | Ga0070702_100001575 | Ga0070702_1000015754 | 206 |
| 378 | 3300005615 | Ga0070702_100141267 | Ga0070702_1001412671 | 206 |
| 379 | 3300005616 | Ga0068852_100649020 | Ga0068852_1006490202 | 206 |
| 380 | 3300005616 | Ga0068852_101144401 | Ga0068852_1011444012 | 206 |
| 381 | 3300005617 | Ga0068859_100048141 | Ga0068859_1000481416 | 206 |
| 382 | 3300005617 | Ga0068859_100115041 | Ga0068859_1001150413 | 206 |
| 383 | 3300005617 | Ga0068859_100126752 | Ga0068859_1001267524 | 206 |
| 384 | 3300005617 | Ga0068859_100167174 | Ga0068859_1001671743 | 206 |
| 385 | 3300005617 | Ga0068859_100175496 | Ga0068859_1001754963 | 206 |
| 386 | 3300005617 | Ga0068859_100351788 | Ga0068859_1003517882 | 206 |
| 387 | 3300005617 | Ga0068859_100356719 | Ga0068859_1003567192 | 206 |
| 388 | 3300005617 | Ga0068859_100381597 | Ga0068859_1003815972 | 206 |
| 389 | 3300005617 | Ga0068859_100473851 | Ga0068859_1004738512 | 206 |
| 390 | 3300005617 | Ga0068859_100596716 | Ga0068859_1005967162 | 206 |
| 391 | 3300005617 | Ga0068859_100840320 | Ga0068859_1008403202 | 206 |
| 392 | 3300005618 | Ga0068864_100017822 | Ga0068864_1000178223 | 206 |
| 393 | 3300005618 | Ga0068864_100127786 | Ga0068864_1001277862 | 206 |
| 394 | 3300005618 | Ga0068864_100175271 | Ga0068864_1001752712 | 206 |
| 395 | 3300005618 | Ga0068864_100597542 | Ga0068864_1005975422 | 206 |
| 396 | 3300005618 | Ga0068864_100890942 | Ga0068864_1008909421 | 206 |
| 397 | 3300005718 | Ga0068866_10031205 | Ga0068866_100312052 | 206 |
| 398 | 3300005718 | Ga0068866_10157304 | Ga0068866_101573042 | 206 |
| 399 | 3300005719 | Ga0068861_100011968 | Ga0068861_1000119687 | 206 |
| 400 | 3300005719 | Ga0068861_100070334 | Ga0068861_1000703343 | 206 |
| 401 | 3300005834 | Ga0068851_10002245 | Ga0068851_100022454 | 206 |
| 402 | 3300005840 | Ga0068870_10069572 | Ga0068870_100695723 | 206 |
| 403 | 3300005840 | Ga0068870_10186425 | Ga0068870_101864251 | 206 |
| 404 | 3300005840 | Ga0068870_10275118 | Ga0068870_102751182 | 206 |
| 405 | 3300005840 | Ga0068870_10357233 | Ga0068870_103572332 | 206 |
| 406 | 3300005841 | Ga0068863_100074503 | Ga0068863_1000745034 | 206 |
| 407 | 3300005841 | Ga0068863_100077484 | Ga0068863_1000774844 | 206 |
| 408 | 3300005841 | Ga0068863_100133463 | Ga0068863_1001334632 | 206 |
| 409 | 3300005841 | Ga0068863_100331813 | Ga0068863_1003318132 | 206 |
| 410 | 3300005841 | Ga0068863_100401584 | Ga0068863_1004015841 | 206 |
| 411 | 3300005842 | Ga0068858_100053043 | Ga0068858_1000530433 | 206 |
| 412 | 3300005842 | Ga0068858_100119330 | Ga0068858_1001193302 | 206 |
| 413 | 3300005842 | Ga0068858_100131784 | Ga0068858_1001317843 | 206 |
| 414 | 3300005842 | Ga0068858_100212660 | Ga0068858_1002126603 | 206 |
| 415 | 3300005842 | Ga0068858_100402384 | Ga0068858_1004023841 | 206 |
| 416 | 3300005842 | Ga0068858_100654960 | Ga0068858_1006549602 | 206 |
| 417 | 3300005843 | Ga0068860_100016852 | Ga0068860_1000168524 | 206 |
| 418 | 3300005843 | Ga0068860_100053151 | Ga0068860_1000531513 | 206 |
| 419 | 3300005843 | Ga0068860_100262864 | Ga0068860_1002628642 | 206 |
| 420 | 3300005844 | Ga0068862_100024723 | Ga0068862_1000247234 | 206 |
| 421 | 3300005844 | Ga0068862_100832375 | Ga0068862_1008323751 | 206 |
| 422 | 3300005985 | Ga0081539_10000490 | Ga0081539_1000049012 | 206 |
| 423 | 3300005985 | Ga0081539_10001185 | Ga0081539_1000118534 | 206 |
| 424 | 3300005985 | Ga0081539_10143468 | Ga0081539_101434682 | 206 |
| 425 | 3300006173 | Ga0070716_100170952 | Ga0070716_1001709522 | 206 |
| 426 | 3300006237 | Ga0097621_100003740 | Ga0097621_10000374015 | 206 |
| 427 | 3300006237 | Ga0097621_100005158 | Ga0097621_1000051588 | 206 |
| 428 | 3300006237 | Ga0097621_100052841 | Ga0097621_1000528412 | 206 |
| 429 | 3300006358 | Ga0068871_100041044 | Ga0068871_1000410442 | 206 |
| 430 | 3300006358 | Ga0068871_100125202 | Ga0068871_1001252022 | 206 |
| 431 | 3300006358 | Ga0068871_100178993 | Ga0068871_1001789931 | 206 |
| 432 | 3300006844 | Ga0075428_100119813 | Ga0075428_1001198134 | 206 |
| 433 | 3300006844 | Ga0075428_100159158 | Ga0075428_1001591583 | 206 |
| 434 | 3300006844 | Ga0075428_100962892 | Ga0075428_1009628922 | 206 |
| 435 | 3300006846 | Ga0075430_100113481 | Ga0075430_1001134813 | 206 |
| 436 | 3300006846 | Ga0075430_100205083 | Ga0075430_1002050832 | 206 |
| 437 | 3300006847 | Ga0075431_100010525 | Ga0075431_1000105254 | 206 |
| 438 | 3300006847 | Ga0075431_100097359 | Ga0075431_1000973594 | 206 |
| 439 | 3300006852 | Ga0075433_10030871 | Ga0075433_100308713 | 206 |
| 440 | 3300006852 | Ga0075433_10115905 | Ga0075433_101159052 | 206 |
| 441 | 3300006871 | Ga0075434_100088077 | Ga0075434_1000880773 | 206 |
| 442 | 3300006871 | Ga0075434_100169474 | Ga0075434_1001694742 | 206 |
| 443 | 3300006880 | Ga0075429_100165114 | Ga0075429_1001651142 | 206 |
| 444 | 3300006881 | Ga0068865_100139443 | Ga0068865_1001394432 | 206 |
| 445 | 3300006914 | Ga0075436_100011949 | Ga0075436_1000119496 | 206 |
| 446 | 3300006931 | Ga0097620_100048144 | Ga0097620_1000481446 | 206 |
| 447 | 3300006931 | Ga0097620_100115030 | Ga0097620_1001150303 | 206 |
| 448 | 3300006931 | Ga0097620_100126737 | Ga0097620_1001267372 | 206 |
| 449 | 3300006931 | Ga0097620_100167159 | Ga0097620_1001671593 | 206 |
| 450 | 3300006931 | Ga0097620_100175505 | Ga0097620_1001755053 | 206 |
| 451 | 3300006931 | Ga0097620_100351791 | Ga0097620_1003517912 | 206 |
| 452 | 3300006931 | Ga0097620_100356677 | Ga0097620_1003566772 | 206 |
| 453 | 3300006931 | Ga0097620_100381602 | Ga0097620_1003816022 | 206 |
| 454 | 3300006931 | Ga0097620_100473834 | Ga0097620_1004738342 | 206 |
| 455 | 3300006931 | Ga0097620_100596737 | Ga0097620_1005967372 | 206 |
| 456 | 3300006931 | Ga0097620_100840301 | Ga0097620_1008403011 | 206 |
| 457 | 3300009093 | Ga0105240_10016665 | Ga0105240_100166655 | 206 |
| 458 | 3300009093 | Ga0105240_11096713 | Ga0105240_110967132 | 206 |
| 459 | 3300009094 | Ga0111539_10000363 | Ga0111539_1000036322 | 206 |
| 460 | 3300009094 | Ga0111539_10007694 | Ga0111539_1000769410 | 206 |
| 461 | 3300009094 | Ga0111539_10084943 | Ga0111539_100849434 | 206 |
| 462 | 3300009094 | Ga0111539_10366872 | Ga0111539_103668722 | 206 |
| 463 | 3300009098 | Ga0105245_10021239 | Ga0105245_100212392 | 206 |
| 464 | 3300009098 | Ga0105245_10161055 | Ga0105245_101610553 | 206 |
| 465 | 3300009098 | Ga0105245_11001648 | Ga0105245_110016482 | 206 |
| 466 | 3300009101 | Ga0105247_10008100 | Ga0105247_100081005 | 206 |
| 467 | 3300009101 | Ga0105247_10043304 | Ga0105247_100433042 | 206 |
| 468 | 3300009101 | Ga0105247_10078632 | Ga0105247_100786322 | 206 |
| 469 | 3300009101 | Ga0105247_10383634 | Ga0105247_103836342 | 206 |
| 470 | 3300009147 | Ga0114129_10020608 | Ga0114129_100206088 | 206 |
| 471 | 3300009147 | Ga0114129_10089786 | Ga0114129_100897864 | 206 |
| 472 | 3300009147 | Ga0114129_10164080 | Ga0114129_101640804 | 206 |
| 473 | 3300009147 | Ga0114129_10236812 | Ga0114129_102368123 | 206 |
| 474 | 3300009147 | Ga0114129_10881370 | Ga0114129_108813702 | 206 |
| 475 | 3300009147 | Ga0114129_11001971 | Ga0114129_110019712 | 206 |
| 476 | 3300009148 | Ga0105243_10008351 | Ga0105243_100083512 | 206 |
| 477 | 3300009148 | Ga0105243_10008920 | Ga0105243_100089209 | 206 |
| 478 | 3300009148 | Ga0105243_10296930 | Ga0105243_102969302 | 206 |
| 479 | 3300009148 | Ga0105243_11026818 | Ga0105243_110268182 | 206 |
| 480 | 3300009174 | Ga0105241_10060700 | Ga0105241_100607002 | 206 |
| 481 | 3300009174 | Ga0105241_10151207 | Ga0105241_101512072 | 206 |
| 482 | 3300009174 | Ga0105241_10277076 | Ga0105241_102770762 | 206 |
| 483 | 3300009174 | Ga0105241_10278029 | Ga0105241_102780292 | 206 |
| 484 | 3300009174 | Ga0105241_10320905 | Ga0105241_103209052 | 206 |
| 485 | 3300009174 | Ga0105241_10442778 | Ga0105241_104427782 | 206 |
| 486 | 3300009174 | Ga0105241_10622173 | Ga0105241_106221731 | 206 |
| 487 | 3300009176 | Ga0105242_10009899 | Ga0105242_100098997 | 206 |
| 488 | 3300009176 | Ga0105242_10113975 | Ga0105242_101139754 | 206 |
| 489 | 3300009176 | Ga0105242_11711254 | Ga0105242_117112541 | 206 |
| 490 | 3300009177 | Ga0105248_10026948 | Ga0105248_100269484 | 206 |
| 491 | 3300009177 | Ga0105248_10088379 | Ga0105248_100883791 | 206 |
| 492 | 3300009177 | Ga0105248_10156840 | Ga0105248_101568402 | 206 |
| 493 | 3300009177 | Ga0105248_10263195 | Ga0105248_102631952 | 206 |
| 494 | 3300009177 | Ga0105248_10685799 | Ga0105248_106857991 | 206 |
| 495 | 3300009545 | Ga0105237_10000527 | Ga0105237_1000052737 | 206 |
| 496 | 3300009545 | Ga0105237_10674748 | Ga0105237_106747482 | 206 |
| 497 | 3300009551 | Ga0105238_10001996 | Ga0105238_1000199614 | 206 |
| 498 | 3300009553 | Ga0105249_10083701 | Ga0105249_100837011 | 206 |
| 499 | 3300009553 | Ga0105249_10152210 | Ga0105249_101522102 | 206 |
| 500 | 3300009553 | Ga0105249_10174470 | Ga0105249_101744701 | 206 |
| 501 | 3300009553 | Ga0105249_10880886 | Ga0105249_108808861 | 206 |
| 502 | 3300010375 | Ga0105239_10196467 | Ga0105239_101964671 | 206 |
| 503 | 3300010375 | Ga0105239_10476447 | Ga0105239_104764472 | 206 |
| 504 | 3300011119 | Ga0105246_10080107 | Ga0105246_100801072 | 206 |
| 505 | 3300013100 | Ga0157373_10002322 | Ga0157373_100023227 | 206 |
| 506 | 3300013100 | Ga0157373_10112898 | Ga0157373_101128983 | 206 |
| 507 | 3300013296 | Ga0157374_10281930 | Ga0157374_102819302 | 206 |
| 508 | 3300013297 | Ga0157378_10119307 | Ga0157378_101193071 | 206 |
| 509 | 3300013297 | Ga0157378_10319762 | Ga0157378_103197622 | 206 |
| 510 | 3300013306 | Ga0163162_10003480 | Ga0163162_100034809 | 206 |
| 511 | 3300013306 | Ga0163162_10003901 | Ga0163162_100039015 | 206 |
| 512 | 3300013306 | Ga0163162_10023609 | Ga0163162_100236095 | 206 |
| 513 | 3300013306 | Ga0163162_10207754 | Ga0163162_102077543 | 206 |
| 514 | 3300013306 | Ga0163162_10369966 | Ga0163162_103699662 | 206 |
| 515 | 3300013306 | Ga0163162_11499426 | Ga0163162_114994261 | 206 |
| 516 | 3300013307 | Ga0157372_10543067 | Ga0157372_105430671 | 206 |
| 517 | 3300013307 | Ga0157372_10634281 | Ga0157372_106342812 | 206 |
| 518 | 3300013307 | Ga0157372_10697949 | Ga0157372_106979491 | 206 |
| 519 | 3300013308 | Ga0157375_10011832 | Ga0157375_100118323 | 206 |
| 520 | 3300013308 | Ga0157375_10122762 | Ga0157375_101227622 | 206 |
| 521 | 3300013308 | Ga0157375_10364736 | Ga0157375_103647362 | 206 |
| 522 | 3300014325 | Ga0163163_10000109 | Ga0163163_1000010969 | 206 |
| 523 | 3300014325 | Ga0163163_10001737 | Ga0163163_1000173715 | 206 |
| 524 | 3300014325 | Ga0163163_10036125 | Ga0163163_100361252 | 206 |
| 525 | 3300014325 | Ga0163163_10066690 | Ga0163163_100666904 | 206 |
| 526 | 3300014325 | Ga0163163_10348322 | Ga0163163_103483222 | 206 |
| 527 | 3300014325 | Ga0163163_10714784 | Ga0163163_107147842 | 206 |
| 528 | 3300014326 | Ga0157380_10100489 | Ga0157380_101004892 | 206 |
| 529 | 3300014326 | Ga0157380_10201187 | Ga0157380_102011872 | 206 |
| 530 | 3300014326 | Ga0157380_10414745 | Ga0157380_104147452 | 206 |
| 531 | 3300014497 | Ga0182008_10247148 | Ga0182008_102471482 | 206 |
| 532 | 3300014745 | Ga0157377_10006813 | Ga0157377_100068135 | 206 |
| 533 | 3300014745 | Ga0157377_10021040 | Ga0157377_100210402 | 206 |
| 534 | 3300014745 | Ga0157377_10109144 | Ga0157377_101091442 | 206 |
| 535 | 3300014745 | Ga0157377_10336110 | Ga0157377_103361102 | 206 |
| 536 | 3300014968 | Ga0157379_10117480 | Ga0157379_101174803 | 206 |
| 537 | 3300014968 | Ga0157379_11096170 | Ga0157379_110961701 | 206 |
| 538 | 3300014969 | Ga0157376_10283737 | Ga0157376_102837371 | 206 |
| 539 | 3300017792 | Ga0163161_10299900 | Ga0163161_102999001 | 206 |
| 540 | 3300025321 | Ga0207656_10007353 | Ga0207656_100073533 | 206 |
| 541 | 3300025885 | Ga0207653_10008043 | Ga0207653_100080432 | 206 |
| 542 | 3300025899 | Ga0207642_10053657 | Ga0207642_100536572 | 206 |
| 543 | 3300025900 | Ga0207710_10000832 | Ga0207710_1000083212 | 206 |
| 544 | 3300025900 | Ga0207710_10073668 | Ga0207710_100736682 | 206 |
| 545 | 3300025903 | Ga0207680_10197115 | Ga0207680_101971152 | 206 |
| 546 | 3300025904 | Ga0207647_10017531 | Ga0207647_100175318 | 206 |
| 547 | 3300025907 | Ga0207645_10187835 | Ga0207645_101878352 | 206 |
| 548 | 3300025908 | Ga0207643_10048397 | Ga0207643_100483971 | 206 |
| 549 | 3300025908 | Ga0207643_10057588 | Ga0207643_100575882 | 206 |
| 550 | 3300025908 | Ga0207643_10115455 | Ga0207643_101154551 | 206 |
| 551 | 3300025908 | Ga0207643_10293395 | Ga0207643_102933952 | 206 |
| 552 | 3300025908 | Ga0207643_10298161 | Ga0207643_102981612 | 206 |
| 553 | 3300025910 | Ga0207684_10068699 | Ga0207684_100686992 | 206 |
| 554 | 3300025910 | Ga0207684_10145844 | Ga0207684_101458442 | 206 |
| 555 | 3300025910 | Ga0207684_10258309 | Ga0207684_102583091 | 206 |
| 556 | 3300025911 | Ga0207654_10044982 | Ga0207654_100449824 | 206 |
| 557 | 3300025911 | Ga0207654_10144411 | Ga0207654_101444112 | 206 |
| 558 | 3300025912 | Ga0207707_10000015 | Ga0207707_10000015151 | 206 |
| 559 | 3300025912 | Ga0207707_10019734 | Ga0207707_100197345 | 206 |
| 560 | 3300025912 | Ga0207707_10027639 | Ga0207707_100276395 | 206 |
| 561 | 3300025912 | Ga0207707_10084084 | Ga0207707_100840842 | 206 |
| 562 | 3300025914 | Ga0207671_10003690 | Ga0207671_100036908 | 206 |
| 563 | 3300025917 | Ga0207660_10005726 | Ga0207660_100057266 | 206 |
| 564 | 3300025917 | Ga0207660_10006252 | Ga0207660_100062525 | 206 |
| 565 | 3300025917 | Ga0207660_10149062 | Ga0207660_101490622 | 206 |
| 566 | 3300025917 | Ga0207660_10256267 | Ga0207660_102562672 | 206 |
| 567 | 3300025918 | Ga0207662_10006504 | Ga0207662_100065041 | 206 |
| 568 | 3300025918 | Ga0207662_10124583 | Ga0207662_101245832 | 206 |
| 569 | 3300025918 | Ga0207662_10190607 | Ga0207662_101906072 | 206 |
| 570 | 3300025919 | Ga0207657_10120733 | Ga0207657_101207333 | 206 |
| 571 | 3300025920 | Ga0207649_10004830 | Ga0207649_100048302 | 206 |
| 572 | 3300025921 | Ga0207652_10000253 | Ga0207652_1000025325 | 206 |
| 573 | 3300025922 | Ga0207646_10095640 | Ga0207646_100956402 | 206 |
| 574 | 3300025923 | Ga0207681_10474388 | Ga0207681_104743882 | 206 |
| 575 | 3300025924 | Ga0207694_10010396 | Ga0207694_100103964 | 206 |
| 576 | 3300025925 | Ga0207650_10000009 | Ga0207650_1000000972 | 206 |
| 577 | 3300025925 | Ga0207650_10169457 | Ga0207650_101694572 | 206 |
| 578 | 3300025926 | Ga0207659_10052425 | Ga0207659_100524252 | 206 |
| 579 | 3300025931 | Ga0207644_10010878 | Ga0207644_100108782 | 206 |
| 580 | 3300025931 | Ga0207644_10138283 | Ga0207644_101382832 | 206 |
| 581 | 3300025932 | Ga0207690_10056520 | Ga0207690_100565202 | 206 |
| 582 | 3300025933 | Ga0207706_10406094 | Ga0207706_104060942 | 206 |
| 583 | 3300025934 | Ga0207686_10121632 | Ga0207686_101216321 | 206 |
| 584 | 3300025934 | Ga0207686_10183059 | Ga0207686_101830592 | 206 |
| 585 | 3300025935 | Ga0207709_10004095 | Ga0207709_100040954 | 206 |
| 586 | 3300025935 | Ga0207709_10164676 | Ga0207709_101646762 | 206 |
| 587 | 3300025936 | Ga0207670_10769264 | Ga0207670_107692641 | 206 |
| 588 | 3300025937 | Ga0207669_10151976 | Ga0207669_101519762 | 206 |
| 589 | 3300025940 | Ga0207691_10005460 | Ga0207691_100054603 | 206 |
| 590 | 3300025940 | Ga0207691_10196613 | Ga0207691_101966132 | 206 |
| 591 | 3300025941 | Ga0207711_10010970 | Ga0207711_100109707 | 206 |
| 592 | 3300025941 | Ga0207711_10015475 | Ga0207711_100154754 | 206 |
| 593 | 3300025941 | Ga0207711_10279676 | Ga0207711_102796762 | 206 |
| 594 | 3300025941 | Ga0207711_10411937 | Ga0207711_104119372 | 206 |
| 595 | 3300025942 | Ga0207689_10125951 | Ga0207689_101259513 | 206 |
| 596 | 3300025942 | Ga0207689_10171397 | Ga0207689_101713972 | 206 |
| 597 | 3300025942 | Ga0207689_10687052 | Ga0207689_106870522 | 206 |
| 598 | 3300025945 | Ga0207679_10063737 | Ga0207679_100637373 | 206 |
| 599 | 3300025945 | Ga0207679_10810794 | Ga0207679_108107942 | 206 |
| 600 | 3300025949 | Ga0207667_10119119 | Ga0207667_101191194 | 206 |
| 601 | 3300025960 | Ga0207651_10287771 | Ga0207651_102877712 | 206 |
| 602 | 3300025960 | Ga0207651_10497533 | Ga0207651_104975331 | 206 |
| 603 | 3300025961 | Ga0207712_10015539 | Ga0207712_100155394 | 206 |
| 604 | 3300025961 | Ga0207712_10037657 | Ga0207712_100376574 | 206 |
| 605 | 3300025961 | Ga0207712_10184263 | Ga0207712_101842632 | 206 |
| 606 | 3300025981 | Ga0207640_10030812 | Ga0207640_100308122 | 206 |
| 607 | 3300025981 | Ga0207640_10308458 | Ga0207640_103084582 | 206 |
| 608 | 3300025986 | Ga0207658_10258637 | Ga0207658_102586372 | 206 |
| 609 | 3300026023 | Ga0207677_10310025 | Ga0207677_103100251 | 206 |
| 610 | 3300026035 | Ga0207703_10101203 | Ga0207703_101012032 | 206 |
| 611 | 3300026035 | Ga0207703_10357415 | Ga0207703_103574152 | 206 |
| 612 | 3300026041 | Ga0207639_10170263 | Ga0207639_101702632 | 206 |
| 613 | 3300026041 | Ga0207639_10793951 | Ga0207639_107939512 | 206 |
| 614 | 3300026067 | Ga0207678_10322868 | Ga0207678_103228682 | 206 |
| 615 | 3300026075 | Ga0207708_10032899 | Ga0207708_100328992 | 206 |
| 616 | 3300026075 | Ga0207708_10035821 | Ga0207708_100358213 | 206 |
| 617 | 3300026075 | Ga0207708_10133653 | Ga0207708_101336532 | 206 |
| 618 | 3300026075 | Ga0207708_10201623 | Ga0207708_102016232 | 206 |
| 619 | 3300026075 | Ga0207708_10279779 | Ga0207708_102797791 | 206 |
| 620 | 3300026088 | Ga0207641_10053459 | Ga0207641_100534593 | 206 |
| 621 | 3300026088 | Ga0207641_10110759 | Ga0207641_101107592 | 206 |
| 622 | 3300026088 | Ga0207641_10123284 | Ga0207641_101232844 | 206 |
| 623 | 3300026088 | Ga0207641_10131881 | Ga0207641_101318812 | 206 |
| 624 | 3300026088 | Ga0207641_10708856 | Ga0207641_107088562 | 206 |
| 625 | 3300026088 | Ga0207641_11328018 | Ga0207641_113280181 | 206 |
| 626 | 3300026089 | Ga0207648_10045328 | Ga0207648_100453282 | 206 |
| 627 | 3300026089 | Ga0207648_10122000 | Ga0207648_101220002 | 206 |
| 628 | 3300026089 | Ga0207648_10122034 | Ga0207648_101220342 | 206 |
| 629 | 3300026089 | Ga0207648_10170744 | Ga0207648_101707443 | 206 |
| 630 | 3300026095 | Ga0207676_10010544 | Ga0207676_100105442 | 206 |
| 631 | 3300026095 | Ga0207676_10088803 | Ga0207676_100888033 | 206 |
| 632 | 3300026095 | Ga0207676_10088868 | Ga0207676_100888684 | 206 |
| 633 | 3300026095 | Ga0207676_10834994 | Ga0207676_108349941 | 206 |
| 634 | 3300026116 | Ga0207674_10000036 | Ga0207674_1000003668 | 206 |
| 635 | 3300026116 | Ga0207674_10088804 | Ga0207674_100888042 | 206 |
| 636 | 3300026116 | Ga0207674_10228298 | Ga0207674_102282982 | 206 |
| 637 | 3300026118 | Ga0207675_100004763 | Ga0207675_1000047633 | 206 |
| 638 | 3300026118 | Ga0207675_100021047 | Ga0207675_1000210472 | 206 |
| 639 | 3300026118 | Ga0207675_100349776 | Ga0207675_1003497762 | 206 |
| 640 | 3300026121 | Ga0207683_10060668 | Ga0207683_100606682 | 206 |
| 641 | 3300026142 | Ga0207698_10118214 | Ga0207698_101182142 | 206 |
| 642 | 3300027907 | Ga0207428_10008435 | Ga0207428_100084356 | 206 |
| 643 | 3300028380 | Ga0268265_10021396 | Ga0268265_100213962 | 206 |
| 644 | 3300028380 | Ga0268265_10029798 | Ga0268265_100297982 | 206 |
| 645 | 3300028380 | Ga0268265_10526912 | Ga0268265_105269122 | 206 |
| 646 | 3300028381 | Ga0268264_10062557 | Ga0268264_100625572 | 206 |
| 647 | 3300028381 | Ga0268264_10121248 | Ga0268264_101212484 | 206 |
| 648 | 3300028381 | Ga0268264_10167421 | Ga0268264_101674212 | 206 |
| 649 | 3300028381 | Ga0268264_10289706 | Ga0268264_102897062 | 206 |
| 650 | 3300028381 | Ga0268264_10371909 | Ga0268264_103719091 | 206 |
| 651 | 3300028381 | Ga0268264_10542848 | Ga0268264_105428482 | 206 |
| 652 | 3300031548 | Ga0307408_100001243 | Ga0307408_1000012436 | 206 |
| 653 | 3300031548 | Ga0307408_100092047 | Ga0307408_1000920471 | 206 |
| 654 | 3300031548 | Ga0307408_100463348 | Ga0307408_1004633482 | 206 |
| 655 | 3300031731 | Ga0307405_10081512 | Ga0307405_100815122 | 206 |
| 656 | 3300031852 | Ga0307410_10023943 | Ga0307410_100239432 | 206 |
| 657 | 3300031852 | Ga0307410_10090006 | Ga0307410_100900062 | 206 |
| 658 | 3300031901 | Ga0307406_10001021 | Ga0307406_100010214 | 206 |
| 659 | 3300031901 | Ga0307406_10414832 | Ga0307406_104148322 | 206 |
| 660 | 3300031903 | Ga0307407_10282757 | Ga0307407_102827571 | 206 |
| 661 | 3300031911 | Ga0307412_10025475 | Ga0307412_100254753 | 206 |
| 662 | 3300031911 | Ga0307412_10045820 | Ga0307412_100458204 | 206 |
| 663 | 3300031911 | Ga0307412_10194818 | Ga0307412_101948182 | 206 |
| 664 | 3300031995 | Ga0307409_100028349 | Ga0307409_1000283494 | 206 |
| 665 | 3300031995 | Ga0307409_100165559 | Ga0307409_1001655592 | 206 |
| 666 | 3300031995 | Ga0307409_100178926 | Ga0307409_1001789262 | 206 |
| 667 | 3300032002 | Ga0307416_100079110 | Ga0307416_1000791102 | 206 |
| 668 | 3300032002 | Ga0307416_100115235 | Ga0307416_1001152353 | 206 |
| 669 | 3300032004 | Ga0307414_10000585 | Ga0307414_1000058514 | 206 |
| 670 | 3300032005 | Ga0307411_10136405 | Ga0307411_101364052 | 206 |
| 671 | 3300032005 | Ga0307411_10187652 | Ga0307411_101876522 | 206 |
| 672 | 3300032126 | Ga0307415_100000479 | Ga0307415_1000004794 | 206 |
| 673 | 3300032126 | Ga0307415_100311952 | Ga0307415_1003119522 | 206 |
| 674 | 3300034957 | Ga0373938_0067568 | Ga0373938_0067568_82_750 | 206 |
| 675 | 3300035091 | Ga0373951_0002340 | Ga0373951_0002340_4104_4724 | 206 |
| 676 | 3300035091 | Ga0373951_0058889 | Ga0373951_0058889_85_705 | 206 |
| 677 | 3300035115 | Ga0373941_0013172 | Ga0373941_0013172_808_1428 | 206 |
| 678 | 3300035207 | Ga0373942_0002199 | Ga0373942_0002199_1626_2246 | 206 |
| 679 | 3300035691 | Ga0373931_0061976 | Ga0373931_0061976_915_1583 | 206 |
| 680 | 3300037418 | Ga0395900_0361786 | Ga0395900_0361786_110_793 | 206 |
| 681 | 3300037466 | Ga0395898_0030070 | Ga0395898_0030070_2739_3422 | 206 |
| 682 | 3300037466 | Ga0395898_0109812 | Ga0395898_0109812_772_1458 | 206 |
| 683 | 3300038443 | Ga0395901_0134830 | Ga0395901_0134830_1802_2485 | 206 |
| 684 | 3300038699 | Ga0242422_00508 | Ga0242422_00508_1274_1894 | 206 |
| 685 | 3300042157 | Ga0439458_0002105 | Ga0439458_0002105_713_1333 | 206 |
| 686 | 3300042438 | Ga0439459_0080726 | Ga0439459_0080726_137_757 | 206 |
| 687 | 3300045051 | Ga0451576_0329975 | Ga0451576_0329975_645_1265 | 206 |
| 688 | 3300048905 | Ga0496102_0737962 | Ga0496102_0737962_95_715 | 206 |
| 689 | 3300048907 | Ga0496104_0351339 | Ga0496104_0351339_326_1009 | 206 |
| 690 | 3300048909 | Ga0496106_0064473 | Ga0496106_0064473_164_784 | 206 |
| 691 | 3300048910 | Ga0496107_0390484 | Ga0496107_0390484_217_960 | 206 |
| 692 | 3300048913 | Ga0496110_0165894 | Ga0496110_0165894_431_1051 | 206 |
| 693 | 3300048914 | Ga0496111_0232941 | Ga0496111_0232941_447_1067 | 206 |
| 694 | 3300048915 | Ga0496112_0105263 | Ga0496112_0105263_1607_2311 | 206 |
| 695 | 3300048915 | Ga0496112_0148038 | Ga0496112_0148038_1070_1690 | 206 |
| 696 | 3300048915 | Ga0496112_0223885 | Ga0496112_0223885_1006_1626 | 206 |
| 697 | 3300048915 | Ga0496112_0262779 | Ga0496112_0262779_1041_1661 | 206 |
| 698 | 3300048915 | Ga0496112_0714713 | Ga0496112_0714713_31_651 | 206 |
| 699 | 3300049515 | Ga0501292_025620 | Ga0501292_025620_149_880 | 206 |
| 700 | 3300049519 | Ga0501296_001846 | Ga0501296_001846_552_1172 | 206 |
| 701 | 3300049519 | Ga0501296_011344 | Ga0501296_011344_215_946 | 206 |
| 702 | 3300049521 | Ga0501298_005326 | Ga0501298_005326_107_793 | 206 |
| 703 | 3300049521 | Ga0501298_020745 | Ga0501298_020745_383_1114 | 206 |
| 704 | 3300049522 | Ga0501299_001169 | Ga0501299_001169_65_751 | 206 |
| 705 | 3300049522 | Ga0501299_003968 | Ga0501299_003968_600_1334 | 206 |
| 706 | 3300049574 | Ga0501038_0007917 | Ga0501038_0007917_5672_6292 | 206 |
| 707 | 3300049649 | Ga0501198_004307 | Ga0501198_004307_996_1682 | 206 |
| 708 | 3300049649 | Ga0501198_004796 | Ga0501198_004796_498_1229 | 206 |
| 709 | 3300049651 | Ga0501201_003184 | Ga0501201_003184_732_1418 | 206 |
| 710 | 3300049652 | Ga0501202_000726 | Ga0501202_000726_620_1351 | 206 |
| 711 | 3300049654 | Ga0501207_003365 | Ga0501207_003365_335_1066 | 206 |
| 712 | 3300049655 | Ga0501208_020754 | Ga0501208_020754_362_1048 | 206 |
| 713 | 3300049660 | Ga0501216_000404 | Ga0501216_000404_928_1659 | 206 |
| 714 | 3300049661 | Ga0501217_000501 | Ga0501217_000501_4543_5274 | 206 |
| 715 | 3300049661 | Ga0501217_001421 | Ga0501217_001421_2592_3278 | 206 |
| 716 | 3300049663 | Ga0501223_001838 | Ga0501223_001838_535_1266 | 206 |
| 717 | 3300049663 | Ga0501223_016291 | Ga0501223_016291_49_669 | 206 |
| 718 | 3300049663 | Ga0501223_062810 | Ga0501223_062810_14_634 | 206 |
| 719 | 3300049664 | Ga0501224_001054 | Ga0501224_001054_2569_3300 | 206 |
| 720 | 3300049664 | Ga0501224_006907 | Ga0501224_006907_90_710 | 206 |
| 721 | 3300049664 | Ga0501224_018057 | Ga0501224_018057_377_997 | 206 |
| 722 | 3300049665 | Ga0501227_018590 | Ga0501227_018590_114_845 | 206 |
| 723 | 3300049667 | Ga0501230_052488 | Ga0501230_052488_30_656 | 206 |
| 724 | 3300049668 | Ga0501233_008080 | Ga0501233_008080_124_744 | 206 |
| 725 | 3300049668 | Ga0501233_023161 | Ga0501233_023161_455_1186 | 206 |
| 726 | 3300049668 | Ga0501233_132883 | Ga0501233_132883_42_662 | 206 |
| 727 | 3300049669 | Ga0501235_081883 | Ga0501235_081883_77_697 | 206 |
| 728 | 3300049670 | Ga0501236_009647 | Ga0501236_009647_431_1162 | 206 |
| 729 | 3300049672 | Ga0501239_021443 | Ga0501239_021443_45_665 | 206 |
| 730 | 3300049677 | Ga0501247_036223 | Ga0501247_036223_56_676 | 206 |
| 731 | 3300049679 | Ga0501249_015470 | Ga0501249_015470_567_1187 | 206 |
| 732 | 3300049679 | Ga0501249_071115 | Ga0501249_071115_22_648 | 206 |
| 733 | 3300049686 | Ga0501257_009411 | Ga0501257_009411_1475_2161 | 206 |
| 734 | 3300049686 | Ga0501257_022771 | Ga0501257_022771_661_1392 | 206 |
| 735 | 3300049688 | Ga0501259_010695 | Ga0501259_010695_707_1438 | 206 |
| 736 | 3300049688 | Ga0501259_021923 | Ga0501259_021923_165_788 | 206 |
| 737 | 3300049688 | Ga0501259_026097 | Ga0501259_026097_230_916 | 206 |
| 738 | 3300049704 | Ga0501221_013909 | Ga0501221_013909_331_951 | 206 |
| 739 | 3300049704 | Ga0501221_030679 | Ga0501221_030679_54_785 | 206 |
| 740 | 3300049705 | Ga0501225_0000268 | Ga0501225_0000268_6400_7131 | 206 |
| 741 | 3300049705 | Ga0501225_0016736 | Ga0501225_0016736_764_1384 | 206 |
| 742 | 3300049705 | Ga0501225_0021865 | Ga0501225_0021865_31_651 | 206 |
| 743 | 3300049705 | Ga0501225_0104743 | Ga0501225_0104743_15_635 | 206 |
| 744 | 3300049706 | Ga0501229_002612 | Ga0501229_002612_1375_2106 | 206 |
| 745 | 3300049708 | Ga0501245_010927 | Ga0501245_010927_142_873 | 206 |
| 746 | 3300049759 | Ga0501262_025378 | Ga0501262_025378_115_735 | 206 |
| 747 | 3300049765 | Ga0501268_022068 | Ga0501268_022068_331_951 | 206 |
| 748 | 3300049770 | Ga0501273_017449 | Ga0501273_017449_53_784 | 206 |
| 749 | 3300049771 | Ga0501274_003906 | Ga0501274_003906_539_1159 | 206 |
| 750 | 3300049775 | Ga0501279_016223 | Ga0501279_016223_157_777 | 206 |
| 751 | 3300049851 | Ga0501212_012785 | Ga0501212_012785_516_1214 | 206 |
| 752 | 3300049853 | Ga0501226_011791 | Ga0501226_011791_33_653 | 206 |
| 753 | 3300050507 | nmdc:mga05p37_154084_c1 | nmdc:mga05p37_154084_c1_480_1100 | 206 |
| 754 | 3300050507 | nmdc:mga05p37_196792_c1 | nmdc:mga05p37_196792_c1_1330_1950 | 206 |
| 755 | 3300050507 | nmdc:mga05p37_250717_c1 | nmdc:mga05p37_250717_c1_109_729 | 206 |
| 756 | 3300050507 | nmdc:mga05p37_571766_c1 | nmdc:mga05p37_571766_c1_525_1193 | 206 |
| 757 | 3300050507 | nmdc:mga05p37_72456_c1 | nmdc:mga05p37_72456_c1_3282_3902 | 206 |
| 758 | 3300050508 | nmdc:mga09592_227502_c1 | nmdc:mga09592_227502_c1_591_1211 | 206 |
| 759 | 3300050508 | nmdc:mga09592_40904_c1 | nmdc:mga09592_40904_c1_1296_1916 | 206 |
| 760 | 3300050509 | nmdc:mga0qj67_291008_c1 | nmdc:mga0qj67_291008_c1_85_705 | 206 |
| 761 | 3300050509 | nmdc:mga0qj67_29879_c1 | nmdc:mga0qj67_29879_c1_819_1505 | 206 |
| 762 | 3300050510 | nmdc:mga06r32_25661_c1 | nmdc:mga06r32_25661_c1_3358_4044 | 206 |
| 763 | 3300050510 | nmdc:mga06r32_46784_c1 | nmdc:mga06r32_46784_c1_1789_2409 | 206 |
| 764 | 3300050511 | nmdc:mga08y16_34486_c1 | nmdc:mga08y16_34486_c1_3177_3797 | 206 |
| 765 | 3300050511 | nmdc:mga08y16_358652_c1 | nmdc:mga08y16_358652_c1_557_1177 | 206 |
| 766 | 3300050511 | nmdc:mga08y16_605681_c1 | nmdc:mga08y16_605681_c1_333_1001 | 206 |
| 767 | 3300050511 | nmdc:mga08y16_720465_c1 | nmdc:mga08y16_720465_c1_150_770 | 206 |
| 768 | 3300050512 | nmdc:mga0n895_1020706_c1 | nmdc:mga0n895_1020706_c1_114_734 | 206 |
| 769 | 3300050512 | nmdc:mga0n895_160092_c1 | nmdc:mga0n895_160092_c1_1613_2233 | 206 |
| 770 | 3300050512 | nmdc:mga0n895_236378_c1 | nmdc:mga0n895_236378_c1_61_681 | 206 |
| 771 | 3300050513 | nmdc:mga0rr50_190895_c1 | nmdc:mga0rr50_190895_c1_208_828 | 206 |
| 772 | 3300050514 | nmdc:mga08x19_8914_c1 | nmdc:mga08x19_8914_c1_4709_5413 | 206 |
| 773 | 3300050515 | nmdc:mga0a205_12578_c1 | nmdc:mga0a205_12578_c1_1775_2395 | 206 |
| 774 | 3300050515 | nmdc:mga0a205_175881_c1 | nmdc:mga0a205_175881_c1_943_1563 | 206 |
| 775 | 3300050515 | nmdc:mga0a205_63313_c1 | nmdc:mga0a205_63313_c1_2371_2991 | 206 |
| 776 | 3300050515 | nmdc:mga0a205_641779_c1 | nmdc:mga0a205_641779_c1_204_824 | 206 |
| 777 | 3300054114 | Ga0501084_0510789 | Ga0501084_0510789_360_980 | 206 |
| 778 | 3300061734 | Ga0530510_0313794 | Ga0530510_0313794_274_894 | 206 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1jg3-assembly1.cif.gz_A | crystal structure of l-isoaspartyl (d-aspartyl) o-methyltransferase with adenosine & vyp(isp)ha substrate | 0.9725 | 2 | 204 |
| 4o29-assembly1.cif.gz_A | protein-l-isoaspartate o-methyltransferase from pyrobaculum aerophilum in complex with s-adenosyl-l-homocysteine | 0.9671 | 2 | 198 |
| 2yxe-assembly1.cif.gz_B | crystal structure of l-isoaspartyl protein carboxyl methyltranferase | 0.9621 | 2 | 204 |
| 3lbf-assembly4.cif.gz_D | crystal structure of protein l-isoaspartyl methyltransferase from escherichia coli | 0.9593 | 2 | 203 |
| 4l7v-assembly1.cif.gz_A | crystal structure of protein l-isoaspartyl-o-methyltransferase of vibrio cholerae | 0.9547 | 2 | 203 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1jg3A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9725 | 2 | 204 | 3.40.50.150 |
| 4o29A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9671 | 2 | 198 | 3.40.50.150 |
| 4l7vA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9547 | 2 | 203 | 3.40.50.150 |
| 1jg3A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.954 | 2 | 204 | 3.40.50.150 |
| af_A0A1D6EFY7_537_616_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9507 | 66 | 123 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9C9T6-F1-model_v4 | Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) | 1 | 1 | 104 |
GO:0004719
GO:0005737 GO:0032259 GO:0036211 |
| AF-A0A2V8QNU0-F1-model_v4 | Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) | 0.9959 | 49 | 206 |
GO:0004719
GO:0005737 GO:0030091 GO:0032259 GO:0036211 |
| AF-A0A536YMJ3-F1-model_v4 | Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) | 0.9926 | 13 | 107 |
GO:0004719
GO:0005737 GO:0032259 GO:0036211 |
| AF-A0A7V9C9T6-F1-model_v4 | Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) | 0.9905 | 1 | 104 |
GO:0004719
GO:0005737 GO:0032259 GO:0036211 |
| AF-A0A531KNU9-F1-model_v4 | Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) | 0.9903 | 13 | 135 |
GO:0004719
GO:0005737 GO:0032259 GO:0036211 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar