F480417

General Info

Members Datasets Scaffolds Average Seq Length
778 286 778 212

Family's Representative Sequence

Representative Sequence 3300026075|Ga0207708_10166145|Ga0207708_101661453
Length 244
Sequence MGSRFTNRLLPVLLAWGGIAMAIPGMAQTDSFAEERRRMVEEQIRHRGIDDPAVLAALTRVPRHLFVPEESRAVAYADTPLPIGHRQTISQPYIVALMSSLLELKPGDKVLEIGTGSGYQTVLLSHLVAQIFTIERIPALYNLARENIARAGAKNVSMLLGDGTVGWREYSPYDAILVSAGGPTIPQPLVEQLADGGRMIVPVGGLDEQTLKLVVRRGTEVRTSDVAPVRFVPLYGTHGWEQQS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
121 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
193 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
194 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
195 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
196 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
205 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
206 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
207 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
208 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
209 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
210 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
215 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
216 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
222 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
223 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
224 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
225 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
237 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
238 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
239 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
240 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
246 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
247 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
248 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
249 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
250 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
251 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
252 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
253 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
254 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
255 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
256 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
257 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
258 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
259 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
260 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
261 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
262 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
263 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
264 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
265 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
266 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
267 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
270 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
271 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
272 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
273 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
274 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
275 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
279 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
285 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
286 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.83
Rhizosphere 96.79
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_634714 2162886007 Bacteria 3149
2 MRS1b_contig_2056278 2162886011 Bacteria 1082
3 JGI24751J29686_10000049 3300002459 Bacteria 69226
4 JGI25406J46586_10021838 3300003203 Unclassified 2561
5 rootL2_10255558 3300003322 Bacteria 1175
6 Ga0065714_10064507 3300005288 Bacteria 46235
7 Ga0065704_10071515 3300005289 Bacteria 10836
8 Ga0065712_10000138 3300005290 Bacteria 62583
9 Ga0065712_10000296 3300005290 Bacteria 17305
10 Ga0065712_10080959 3300005290 Bacteria 3052
11 Ga0065712_10095370 3300005290 Bacteria 2221
12 Ga0065712_10155384 3300005290 Bacteria 1339
13 Ga0065712_10242962 3300005290 Bacteria 972
14 Ga0065715_10004340 3300005293 Bacteria 8226
15 Ga0065715_10005901 3300005293 Bacteria 3618
16 Ga0065715_10022879 3300005293 Bacteria 1623
17 Ga0065715_10033378 3300005293 Unclassified 1591
18 Ga0065715_10109003 3300005293 Bacteria 2690
19 Ga0065715_10341202 3300005293 Unclassified 967
20 Ga0065707_10087245 3300005295 Bacteria 5100
21 Ga0065707_10094864 3300005295 Bacteria 3443
22 Ga0065707_10158018 3300005295 Bacteria 1590
23 Ga0070658_10002464 3300005327 Bacteria 15467
24 Ga0070658_10005958 3300005327 Bacteria 9891
25 Ga0070658_10157855 3300005327 Bacteria 1902
26 Ga0070658_10180351 3300005327 Bacteria 1777
27 Ga0070676_10025393 3300005328 Bacteria 3349
28 Ga0070676_10057386 3300005328 Viruses 2304
29 Ga0070683_100026660 3300005329 Bacteria 5207
30 Ga0070683_100048690 3300005329 Bacteria 3918
31 Ga0070683_100053305 3300005329 Bacteria 3748
32 Ga0070683_100568855 3300005329 Bacteria 1084
33 Ga0070690_100005770 3300005330 Bacteria 6977
34 Ga0070670_100022889 3300005331 Bacteria 5376
35 Ga0070670_100069882 3300005331 Bacteria 3014
36 Ga0068869_100065048 3300005334 Bacteria 2684
37 Ga0068869_100264201 3300005334 Bacteria 1379
38 Ga0068869_100387138 3300005334 Bacteria 1147
39 Ga0070666_10116685 3300005335 Bacteria 1849
40 Ga0070680_100009370 3300005336 Bacteria 7522
41 Ga0070680_100021413 3300005336 Bacteria 5139
42 Ga0070680_100161341 3300005336 Bacteria 1884
43 Ga0070682_100002890 3300005337 Bacteria 9532
44 Ga0070682_100003390 3300005337 Bacteria 8836
45 Ga0070682_100205057 3300005337 Bacteria 1393
46 Ga0068868_100018852 3300005338 Bacteria 5164
47 Ga0068868_100316346 3300005338 Bacteria 1329
48 Ga0068868_100417884 3300005338 Bacteria 1161
49 Ga0070660_100000988 3300005339 Bacteria 19062
50 Ga0070660_100111873 3300005339 Unclassified 2173
51 Ga0070689_100340771 3300005340 Unclassified 1255
52 Ga0070689_100610916 3300005340 Bacteria 945
53 Ga0070689_100709725 3300005340 Bacteria 879
54 Ga0070687_100124760 3300005343 Unclassified 1478
55 Ga0070687_100143573 3300005343 Bacteria 1393
56 Ga0070661_100005268 3300005344 Bacteria 8907
57 Ga0070661_100039569 3300005344 Bacteria 3436
58 Ga0070692_10009492 3300005345 Unclassified 4390
59 Ga0070692_10029041 3300005345 Bacteria 2754
60 Ga0070692_10126341 3300005345 Unclassified 1432
61 Ga0070692_10160482 3300005345 Bacteria 1288
62 Ga0070692_10445531 3300005345 Unclassified 828
63 Ga0070692_10523184 3300005345 Unclassified 772
64 Ga0070668_100119168 3300005347 Bacteria 2108
65 Ga0070669_100079505 3300005353 Bacteria 2439
66 Ga0070669_100130023 3300005353 Bacteria 1930
67 Ga0070669_100170970 3300005353 Bacteria 1694
68 Ga0070675_100186512 3300005354 Bacteria 1795
69 Ga0070675_100321704 3300005354 Bacteria 1366
70 Ga0070675_100455687 3300005354 Bacteria 1147
71 Ga0070671_100003695 3300005355 Bacteria 11999
72 Ga0070671_100037834 3300005355 Bacteria 4003
73 Ga0070671_100044712 3300005355 Bacteria 3680
74 Ga0070671_100104686 3300005355 Bacteria 2375
75 Ga0070674_100322385 3300005356 Bacteria 1239
76 Ga0070673_100039820 3300005364 Bacteria 3600
77 Ga0070673_100085054 3300005364 Bacteria 2574
78 Ga0070673_100110467 3300005364 Bacteria 2279
79 Ga0070673_100325616 3300005364 Unclassified 1358
80 Ga0070673_100325774 3300005364 Bacteria 1358
81 Ga0070673_100583942 3300005364 Bacteria 1018
82 Ga0070688_100167768 3300005365 Bacteria 1512
83 Ga0070659_100022165 3300005366 Unclassified 4846
84 Ga0070659_100106891 3300005366 Bacteria 2256
85 Ga0070659_100900908 3300005366 Bacteria 773
86 Ga0070667_100032807 3300005367 Bacteria 4333
87 Ga0070667_100062002 3300005367 Bacteria 3167
88 Ga0070667_100272039 3300005367 Unclassified 1519
89 Ga0070667_100573917 3300005367 Bacteria 1038
90 Ga0070703_10014271 3300005406 Bacteria 2262
91 Ga0070701_10087404 3300005438 Bacteria 1701
92 Ga0070705_100001180 3300005440 Bacteria 14263
93 Ga0070705_100272842 3300005440 Bacteria 1199
94 Ga0070705_100321466 3300005440 Bacteria 1117
95 Ga0070700_100037052 3300005441 Bacteria 2963
96 Ga0070700_100071533 3300005441 Bacteria 2215
97 Ga0070700_100276478 3300005441 Bacteria 1216
98 Ga0070694_100003400 3300005444 Bacteria 9536
99 Ga0070694_100026914 3300005444 Bacteria 3731
100 Ga0070694_100029349 3300005444 Bacteria 3589
101 Ga0070694_100289868 3300005444 Bacteria 1251
102 Ga0070694_100294567 3300005444 Bacteria 1241
103 Ga0070694_100339785 3300005444 Unclassified 1160
104 Ga0070708_100000147 3300005445 Bacteria 48675
105 Ga0070708_100275416 3300005445 Bacteria 1583
106 Ga0070663_100275423 3300005455 Bacteria 1339
107 Ga0070678_100021052 3300005456 Bacteria 4292
108 Ga0070662_100238356 3300005457 Bacteria 1458
109 Ga0070662_100741850 3300005457 Bacteria 832
110 Ga0070662_100758662 3300005457 Unclassified 823
111 Ga0070681_10000110 3300005458 Bacteria 61542
112 Ga0070681_10003413 3300005458 Bacteria 14879
113 Ga0070681_10003933 3300005458 Bacteria 14010
114 Ga0070681_10007686 3300005458 Bacteria 10540
115 Ga0070681_10083531 3300005458 Bacteria 3147
116 Ga0070681_10104289 3300005458 Bacteria 2778
117 Ga0068867_100017771 3300005459 Bacteria 5049
118 Ga0068867_100031255 3300005459 Bacteria 3843
119 Ga0068867_100656091 3300005459 Bacteria 921
120 Ga0070685_10219607 3300005466 Bacteria 1245
121 Ga0070706_100030111 3300005467 Bacteria 4999
122 Ga0070706_100043041 3300005467 Bacteria 4172
123 Ga0070706_100144467 3300005467 Bacteria 2222
124 Ga0070707_100141374 3300005468 Bacteria 2342
125 Ga0070698_100002024 3300005471 Bacteria 22538
126 Ga0070698_100005990 3300005471 Bacteria 13256
127 Ga0070698_100008639 3300005471 Bacteria 10977
128 Ga0070698_100035160 3300005471 Bacteria 5181
129 Ga0070698_100897029 3300005471 Bacteria 832
130 Ga0070699_100008648 3300005518 Bacteria 8825
131 Ga0070699_100012911 3300005518 Bacteria 7200
132 Ga0070699_100022438 3300005518 Bacteria 5439
133 Ga0070699_100126214 3300005518 Bacteria 2253
134 Ga0070699_100438989 3300005518 Bacteria 1183
135 Ga0070699_100592213 3300005518 Bacteria 1011
136 Ga0070679_100000060 3300005530 Bacteria 81237
137 Ga0070679_100001326 3300005530 Bacteria 21807
138 Ga0070679_100108349 3300005530 Bacteria 2764
139 Ga0070679_100129400 3300005530 Bacteria 2506
140 Ga0070679_100432040 3300005530 Bacteria 1262
141 Ga0070684_100039618 3300005535 Bacteria 4054
142 Ga0070684_100204778 3300005535 Bacteria 1798
143 Ga0070684_100658288 3300005535 Bacteria 975
144 Ga0070697_100000366 3300005536 Bacteria 35335
145 Ga0070697_100001795 3300005536 Bacteria 16382
146 Ga0070697_100040260 3300005536 Bacteria 3780
147 Ga0070697_100057838 3300005536 Bacteria 3154
148 Ga0070697_100153538 3300005536 Bacteria 1942
149 Ga0070697_100268567 3300005536 Bacteria 1462
150 Ga0068853_100015189 3300005539 Bacteria 6331
151 Ga0068853_100015348 3300005539 Bacteria 6295
152 Ga0068853_100632113 3300005539 Bacteria 1018
153 Ga0068853_100873477 3300005539 Unclassified 863
154 Ga0070672_100064549 3300005543 Bacteria 2893
155 Ga0070672_100072178 3300005543 Bacteria 2748
156 Ga0070672_100164230 3300005543 Bacteria 1844
157 Ga0070672_100233819 3300005543 Bacteria 1545
158 Ga0070686_100071842 3300005544 Unclassified 2267
159 Ga0070686_100269166 3300005544 Bacteria 1252
160 Ga0070695_100045162 3300005545 Bacteria 2807
161 Ga0070695_100334669 3300005545 Unclassified 1129
162 Ga0070695_100467101 3300005545 Bacteria 970
163 Ga0070696_100046031 3300005546 Bacteria 3024
164 Ga0070696_100060769 3300005546 Bacteria 2643
165 Ga0070696_100101732 3300005546 Bacteria 2060
166 Ga0070696_100135175 3300005546 Bacteria 1797
167 Ga0070696_100166170 3300005546 Bacteria 1628
168 Ga0070696_100281073 3300005546 Bacteria 1269
169 Ga0070696_100412671 3300005546 Unclassified 1058
170 Ga0070696_100835093 3300005546 Unclassified 760
171 Ga0070693_100005900 3300005547 Bacteria 5921
172 Ga0070693_100010936 3300005547 Bacteria 4559
173 Ga0070693_100152941 3300005547 Bacteria 1463
174 Ga0070704_100010265 3300005549 Bacteria 5694
175 Ga0070704_100051780 3300005549 Bacteria 2893
176 Ga0070704_100362035 3300005549 Unclassified 1227
177 Ga0068855_100254946 3300005563 Unclassified 1956
178 Ga0070664_100001504 3300005564 Bacteria 18579
179 Ga0070664_100031842 3300005564 Bacteria 4409
180 Ga0070664_100276485 3300005564 Bacteria 1514
181 Ga0070664_100452038 3300005564 Bacteria 1179
182 Ga0068857_100001572 3300005577 Bacteria 18294
183 Ga0068857_100086416 3300005577 Bacteria 2804
184 Ga0068857_100094287 3300005577 Bacteria 2680
185 Ga0068857_100162106 3300005577 Bacteria 2029
186 Ga0068857_100325729 3300005577 Bacteria 1419
187 Ga0068854_100061524 3300005578 Bacteria 2720
188 Ga0068854_100156605 3300005578 Bacteria 1761
189 Ga0068854_100221745 3300005578 Unclassified 1496
190 Ga0068854_100284021 3300005578 Bacteria 1334
191 Ga0070702_100001575 3300005615 Bacteria 9405
192 Ga0070702_100141267 3300005615 Bacteria 1534
193 Ga0068852_100042394 3300005616 Bacteria 3853
194 Ga0068852_100649020 3300005616 Bacteria 1063
195 Ga0068852_101144401 3300005616 Unclassified 799
196 Ga0068859_100048141 3300005617 Bacteria 4283
197 Ga0068859_100048664 3300005617 Bacteria 4258
198 Ga0068859_100100661 3300005617 Bacteria 2946
199 Ga0068859_100115041 3300005617 Bacteria 2754
200 Ga0068859_100126752 3300005617 Unclassified 2622
201 Ga0068859_100167174 3300005617 Bacteria 2279
202 Ga0068859_100175496 3300005617 Bacteria 2225
203 Ga0068859_100351788 3300005617 Bacteria 1568
204 Ga0068859_100356719 3300005617 Bacteria 1557
205 Ga0068859_100381597 3300005617 Bacteria 1505
206 Ga0068859_100473851 3300005617 Bacteria 1347
207 Ga0068859_100596716 3300005617 Bacteria 1197
208 Ga0068859_100840320 3300005617 Bacteria 1004
209 Ga0068864_100017822 3300005618 Bacteria 5923
210 Ga0068864_100127786 3300005618 Bacteria 2279
211 Ga0068864_100175271 3300005618 Bacteria 1957
212 Ga0068864_100201523 3300005618 Unclassified 1828
213 Ga0068864_100398103 3300005618 Bacteria 1308
214 Ga0068864_100597542 3300005618 Bacteria 1070
215 Ga0068864_100890942 3300005618 Unclassified 878
216 Ga0068866_10031205 3300005718 Bacteria 2564
217 Ga0068866_10157304 3300005718 Bacteria 1322
218 Ga0068861_100011968 3300005719 Bacteria 6042
219 Ga0068861_100055926 3300005719 Bacteria 3010
220 Ga0068861_100070334 3300005719 Bacteria 2709
221 Ga0068851_10002245 3300005834 Bacteria 8494
222 Ga0068870_10069572 3300005840 Bacteria 1915
223 Ga0068870_10186425 3300005840 Bacteria 1249
224 Ga0068870_10275118 3300005840 Bacteria 1053
225 Ga0068870_10357233 3300005840 Bacteria 939
226 Ga0068863_100074503 3300005841 Bacteria 3211
227 Ga0068863_100077484 3300005841 Bacteria 3146
228 Ga0068863_100133463 3300005841 Bacteria 2371
229 Ga0068863_100331813 3300005841 Bacteria 1479
230 Ga0068863_100401584 3300005841 Bacteria 1340
231 Ga0068863_100836050 3300005841 Unclassified 919
232 Ga0068858_100053043 3300005842 Bacteria 3752
233 Ga0068858_100119330 3300005842 Bacteria 2466
234 Ga0068858_100131784 3300005842 Bacteria 2344
235 Ga0068858_100212660 3300005842 Bacteria 1830
236 Ga0068858_100280650 3300005842 Bacteria 1586
237 Ga0068858_100402384 3300005842 Bacteria 1315
238 Ga0068858_100654960 3300005842 Unclassified 1020
239 Ga0068860_100016852 3300005843 Bacteria 7123
240 Ga0068860_100053151 3300005843 Unclassified 3852
241 Ga0068860_100123760 3300005843 Bacteria 2478
242 Ga0068860_100262864 3300005843 Bacteria 1682
243 Ga0068860_100423238 3300005843 Bacteria 1320
244 Ga0068862_100024723 3300005844 Bacteria 5040
245 Ga0068862_100114154 3300005844 Bacteria 2374
246 Ga0068862_100832375 3300005844 Bacteria 903
247 Ga0081539_10000490 3300005985 Bacteria 83577
248 Ga0081539_10001185 3300005985 Bacteria 47102
249 Ga0081539_10143468 3300005985 Bacteria 1157
250 Ga0070716_100170952 3300006173 Bacteria 1418
251 Ga0097621_100003740 3300006237 Bacteria 10543
252 Ga0097621_100005158 3300006237 Bacteria 9178
253 Ga0097621_100052841 3300006237 Bacteria 3311
254 Ga0068871_100041044 3300006358 Bacteria 3709
255 Ga0068871_100125202 3300006358 Bacteria 2175
256 Ga0068871_100178993 3300006358 Bacteria 1821
257 Ga0075428_100119813 3300006844 Unclassified 2865
258 Ga0075428_100159158 3300006844 Bacteria 2451
259 Ga0075428_100845779 3300006844 Bacteria 972
260 Ga0075428_100962892 3300006844 Bacteria 904
261 Ga0075430_100113481 3300006846 Bacteria 2258
262 Ga0075430_100205083 3300006846 Unclassified 1636
263 Ga0075431_100010525 3300006847 Bacteria 9299
264 Ga0075431_100097359 3300006847 Bacteria 3038
265 Ga0075433_10030871 3300006852 Bacteria 4575
266 Ga0075433_10115905 3300006852 Bacteria 2377
267 Ga0075434_100088077 3300006871 Unclassified 3105
268 Ga0075434_100169474 3300006871 Bacteria 2203
269 Ga0075429_100025872 3300006880 Bacteria 5095
270 Ga0075429_100165114 3300006880 Unclassified 1940
271 Ga0068865_100101415 3300006881 Bacteria 2108
272 Ga0068865_100139443 3300006881 Bacteria 1827
273 Ga0075436_100011949 3300006914 Bacteria 5954
274 Ga0097620_100048144 3300006931 Bacteria 4283
275 Ga0097620_100048664 3300006931 Bacteria 4258
276 Ga0097620_100100663 3300006931 Bacteria 2946
277 Ga0097620_100115030 3300006931 Bacteria 2754
278 Ga0097620_100126737 3300006931 Unclassified 2622
279 Ga0097620_100150365 3300006931 Bacteria 2404
280 Ga0097620_100167159 3300006931 Bacteria 2279
281 Ga0097620_100175505 3300006931 Bacteria 2225
282 Ga0097620_100351791 3300006931 Bacteria 1568
283 Ga0097620_100356677 3300006931 Bacteria 1557
284 Ga0097620_100381602 3300006931 Bacteria 1505
285 Ga0097620_100473834 3300006931 Bacteria 1347
286 Ga0097620_100596737 3300006931 Bacteria 1197
287 Ga0097620_100840301 3300006931 Bacteria 1004
288 Ga0075435_100638599 3300007076 Bacteria 924
289 Ga0105240_10016665 3300009093 Bacteria 9940
290 Ga0105240_10271544 3300009093 Unclassified 1952
291 Ga0105240_11096713 3300009093 Unclassified 847
292 Ga0111539_10000363 3300009094 Bacteria 55793
293 Ga0111539_10007694 3300009094 Bacteria 13758
294 Ga0111539_10028853 3300009094 Bacteria 6767
295 Ga0111539_10084943 3300009094 Bacteria 3721
296 Ga0111539_10115883 3300009094 Bacteria 3142
297 Ga0111539_10262265 3300009094 Bacteria 2011
298 Ga0111539_10366872 3300009094 Bacteria 1676
299 Ga0105245_10021239 3300009098 Bacteria 5692
300 Ga0105245_10161055 3300009098 Bacteria 2129
301 Ga0105245_11001648 3300009098 Unclassified 880
302 Ga0105247_10008100 3300009101 Bacteria 6421
303 Ga0105247_10043304 3300009101 Bacteria 2758
304 Ga0105247_10078632 3300009101 Bacteria 2075
305 Ga0105247_10383634 3300009101 Bacteria 997
306 Ga0114129_10020608 3300009147 Bacteria 9373
307 Ga0114129_10089786 3300009147 Bacteria 4259
308 Ga0114129_10164080 3300009147 Bacteria 3033
309 Ga0114129_10175898 3300009147 Bacteria 2915
310 Ga0114129_10236812 3300009147 Bacteria 2455
311 Ga0114129_10338280 3300009147 Unclassified 1997
312 Ga0114129_10504730 3300009147 Bacteria 1579
313 Ga0114129_10668957 3300009147 Bacteria 1338
314 Ga0114129_10881370 3300009147 Bacteria 1135
315 Ga0114129_11001971 3300009147 Unclassified 1052
316 Ga0114129_11753732 3300009147 Bacteria 756
317 Ga0105243_10008351 3300009148 Bacteria 7950
318 Ga0105243_10008920 3300009148 Bacteria 7666
319 Ga0105243_10296930 3300009148 Bacteria 1462
320 Ga0105243_11026818 3300009148 Unclassified 829
321 Ga0105241_10060700 3300009174 Unclassified 2909
322 Ga0105241_10151207 3300009174 Unclassified 1899
323 Ga0105241_10277076 3300009174 Bacteria 1431
324 Ga0105241_10278029 3300009174 Bacteria 1429
325 Ga0105241_10320905 3300009174 Bacteria 1335
326 Ga0105241_10442778 3300009174 Bacteria 1148
327 Ga0105241_10622173 3300009174 Bacteria 978
328 Ga0105242_10009899 3300009176 Bacteria 7302
329 Ga0105242_10113975 3300009176 Bacteria 2309
330 Ga0105242_10320683 3300009176 Bacteria 1421
331 Ga0105242_10516622 3300009176 Unclassified 1139
332 Ga0105242_11711254 3300009176 Bacteria 665
333 Ga0105248_10026948 3300009177 Bacteria 6391
334 Ga0105248_10088379 3300009177 Bacteria 3488
335 Ga0105248_10124698 3300009177 Bacteria 2905
336 Ga0105248_10156840 3300009177 Unclassified 2568
337 Ga0105248_10263195 3300009177 Unclassified 1941
338 Ga0105248_10346833 3300009177 Bacteria 1672
339 Ga0105248_10353466 3300009177 Unclassified 1654
340 Ga0105248_10471100 3300009177 Unclassified 1416
341 Ga0105248_10685799 3300009177 Bacteria 1156
342 Ga0105248_10898012 3300009177 Bacteria 1000
343 Ga0105248_10973668 3300009177 Bacteria 958
344 Ga0105237_10000527 3300009545 Bacteria 53805
345 Ga0105237_10674748 3300009545 Bacteria 1040
346 Ga0105238_10001996 3300009551 Bacteria 20559
347 Ga0105249_10001430 3300009553 Bacteria 20929
348 Ga0105249_10083701 3300009553 Bacteria 2970
349 Ga0105249_10152210 3300009553 Bacteria 2228
350 Ga0105249_10174470 3300009553 Bacteria 2087
351 Ga0105249_10272944 3300009553 Bacteria 1685
352 Ga0105249_10880886 3300009553 Unclassified 962
353 Ga0105239_10196467 3300010375 Bacteria 2259
354 Ga0105239_10476447 3300010375 Bacteria 1418
355 Ga0105246_10080107 3300011119 Bacteria 2324
356 Ga0105246_10706698 3300011119 Unclassified 884
357 Ga0157373_10002322 3300013100 Bacteria 14422
358 Ga0157373_10011153 3300013100 Bacteria 6614
359 Ga0157373_10112898 3300013100 Bacteria 1910
360 Ga0157371_10015820 3300013102 Bacteria 5644
361 Ga0157371_10032315 3300013102 Bacteria 3767
362 Ga0157371_10035193 3300013102 Bacteria 3589
363 Ga0157371_10501976 3300013102 Unclassified 896
364 Ga0157371_10616830 3300013102 Bacteria 808
365 Ga0157370_10003071 3300013104 Bacteria 19790
366 Ga0157369_10004455 3300013105 Bacteria 16501
367 Ga0157369_10029579 3300013105 Bacteria 6052
368 Ga0157369_10577148 3300013105 Bacteria 1161
369 Ga0157374_10281930 3300013296 Unclassified 1641
370 Ga0157378_10059181 3300013297 Bacteria 3418
371 Ga0157378_10119307 3300013297 Bacteria 2429
372 Ga0157378_10319762 3300013297 Bacteria 1507
373 Ga0157378_10460256 3300013297 Unclassified 1264
374 Ga0163162_10000027 3300013306 Bacteria 178451
375 Ga0163162_10003480 3300013306 Bacteria 15046
376 Ga0163162_10003901 3300013306 Bacteria 14319
377 Ga0163162_10004987 3300013306 Bacteria 12791
378 Ga0163162_10023609 3300013306 Bacteria 6072
379 Ga0163162_10173782 3300013306 Bacteria 2279
380 Ga0163162_10207754 3300013306 Bacteria 2087
381 Ga0163162_10369966 3300013306 Bacteria 1566
382 Ga0163162_11499426 3300013306 Bacteria 768
383 Ga0157372_10001740 3300013307 Bacteria 23617
384 Ga0157372_10020733 3300013307 Bacteria 7096
385 Ga0157372_10074735 3300013307 Bacteria 3822
386 Ga0157372_10082372 3300013307 Bacteria 3642
387 Ga0157372_10085626 3300013307 Bacteria 3575
388 Ga0157372_10235864 3300013307 Bacteria 2122
389 Ga0157372_10381665 3300013307 Bacteria 1642
390 Ga0157372_10543067 3300013307 Bacteria 1355
391 Ga0157372_10634281 3300013307 Bacteria 1245
392 Ga0157372_10697949 3300013307 Bacteria 1181
393 Ga0157375_10011832 3300013308 Bacteria 7715
394 Ga0157375_10046224 3300013308 Bacteria 4242
395 Ga0157375_10122762 3300013308 Bacteria 2709
396 Ga0157375_10312236 3300013308 Unclassified 1736
397 Ga0157375_10331166 3300013308 Bacteria 1687
398 Ga0157375_10364736 3300013308 Unclassified 1611
399 Ga0157375_10763537 3300013308 Bacteria 1117
400 Ga0163163_10000109 3300014325 Bacteria 87294
401 Ga0163163_10001737 3300014325 Bacteria 18359
402 Ga0163163_10021610 3300014325 Bacteria 6076
403 Ga0163163_10036125 3300014325 Bacteria 4797
404 Ga0163163_10066690 3300014325 Bacteria 3575
405 Ga0163163_10170504 3300014325 Bacteria 2223
406 Ga0163163_10348322 3300014325 Bacteria 1537
407 Ga0163163_10714784 3300014325 Bacteria 1065
408 Ga0157380_10100489 3300014326 Bacteria 2408
409 Ga0157380_10146483 3300014326 Unclassified 2036
410 Ga0157380_10201187 3300014326 Bacteria 1767
411 Ga0157380_10414745 3300014326 Unclassified 1282
412 Ga0182008_10247148 3300014497 Unclassified 919
413 Ga0157377_10006813 3300014745 Bacteria 5473
414 Ga0157377_10021040 3300014745 Unclassified 3426
415 Ga0157377_10109144 3300014745 Bacteria 1661
416 Ga0157377_10336110 3300014745 Bacteria 1009
417 Ga0157379_10025524 3300014968 Bacteria 5250
418 Ga0157379_10117480 3300014968 Bacteria 2392
419 Ga0157379_11096170 3300014968 Bacteria 762
420 Ga0157376_10283737 3300014969 Bacteria 1560
421 Ga0182007_10159703 3300015262 Bacteria 770
422 Ga0182005_1042338 3300015265 Bacteria 1238
423 Ga0163161_10299900 3300017792 Bacteria 1265
424 Ga0207656_10007353 3300025321 Bacteria 4005
425 Ga0207653_10008043 3300025885 Bacteria 3287
426 Ga0207642_10053657 3300025899 Bacteria 1835
427 Ga0207710_10000832 3300025900 Bacteria 16664
428 Ga0207710_10073668 3300025900 Bacteria 1570
429 Ga0207680_10197115 3300025903 Bacteria 1370
430 Ga0207647_10017531 3300025904 Bacteria 4866
431 Ga0207645_10057662 3300025907 Bacteria 2480
432 Ga0207645_10187835 3300025907 Bacteria 1357
433 Ga0207643_10048397 3300025908 Bacteria 2408
434 Ga0207643_10057588 3300025908 Bacteria 2213
435 Ga0207643_10115455 3300025908 Bacteria 1585
436 Ga0207643_10293395 3300025908 Bacteria 1011
437 Ga0207643_10298161 3300025908 Bacteria 1003
438 Ga0207705_10003006 3300025909 Bacteria 12869
439 Ga0207705_10003715 3300025909 Bacteria 11617
440 Ga0207705_10077432 3300025909 Bacteria 2419
441 Ga0207705_10108520 3300025909 Bacteria 2049
442 Ga0207705_10194609 3300025909 Bacteria 1534
443 Ga0207684_10068699 3300025910 Unclassified 3011
444 Ga0207684_10145844 3300025910 Bacteria 2036
445 Ga0207684_10199837 3300025910 Bacteria 1724
446 Ga0207684_10258309 3300025910 Bacteria 1503
447 Ga0207684_10638051 3300025910 Bacteria 908
448 Ga0207654_10044982 3300025911 Bacteria 2510
449 Ga0207654_10144411 3300025911 Unclassified 1521
450 Ga0207707_10000015 3300025912 Bacteria 259670
451 Ga0207707_10011095 3300025912 Bacteria 7835
452 Ga0207707_10019734 3300025912 Bacteria 5884
453 Ga0207707_10027639 3300025912 Bacteria 4960
454 Ga0207707_10084084 3300025912 Bacteria 2779
455 Ga0207671_10003690 3300025914 Bacteria 15096
456 Ga0207660_10005726 3300025917 Bacteria 8063
457 Ga0207660_10006252 3300025917 Bacteria 7731
458 Ga0207660_10130565 3300025917 Bacteria 1912
459 Ga0207660_10149062 3300025917 Bacteria 1796
460 Ga0207660_10256267 3300025917 Unclassified 1382
461 Ga0207660_10386906 3300025917 Bacteria 1125
462 Ga0207660_10460245 3300025917 Unclassified 1029
463 Ga0207662_10006504 3300025918 Bacteria 6313
464 Ga0207662_10124583 3300025918 Bacteria 1619
465 Ga0207662_10190607 3300025918 Bacteria 1323
466 Ga0207657_10000432 3300025919 Bacteria 44554
467 Ga0207657_10038770 3300025919 Bacteria 4238
468 Ga0207657_10120733 3300025919 Unclassified 2156
469 Ga0207657_10205880 3300025919 Bacteria 1581
470 Ga0207649_10004830 3300025920 Bacteria 7286
471 Ga0207652_10000253 3300025921 Bacteria 55673
472 Ga0207652_10004232 3300025921 Bacteria 11708
473 Ga0207652_10064735 3300025921 Bacteria 3164
474 Ga0207652_10377260 3300025921 Bacteria 1280
475 Ga0207646_10095640 3300025922 Bacteria 2661
476 Ga0207681_10074652 3300025923 Bacteria 2376
477 Ga0207681_10185204 3300025923 Bacteria 1589
478 Ga0207681_10474388 3300025923 Unclassified 1021
479 Ga0207681_10529716 3300025923 Bacteria 968
480 Ga0207694_10010396 3300025924 Bacteria 7016
481 Ga0207650_10000009 3300025925 Bacteria 483583
482 Ga0207650_10016789 3300025925 Bacteria 5120
483 Ga0207650_10169457 3300025925 Bacteria 1735
484 Ga0207650_10388568 3300025925 Bacteria 1153
485 Ga0207659_10052425 3300025926 Bacteria 2906
486 Ga0207659_10081703 3300025926 Bacteria 2390
487 Ga0207687_10347377 3300025927 Bacteria 1208
488 Ga0207644_10010878 3300025931 Bacteria 6008
489 Ga0207644_10138283 3300025931 Bacteria 1873
490 Ga0207690_10056520 3300025932 Bacteria 2648
491 Ga0207690_10093513 3300025932 Bacteria 2131
492 Ga0207690_10098229 3300025932 Bacteria 2085
493 Ga0207690_10530787 3300025932 Bacteria 955
494 Ga0207706_10405129 3300025933 Bacteria 1182
495 Ga0207706_10406094 3300025933 Bacteria 1181
496 Ga0207706_10632018 3300025933 Bacteria 918
497 Ga0207686_10121632 3300025934 Bacteria 1778
498 Ga0207686_10183059 3300025934 Bacteria 1487
499 Ga0207709_10004095 3300025935 Bacteria 8486
500 Ga0207709_10164676 3300025935 Unclassified 1550
501 Ga0207670_10769264 3300025936 Unclassified 801
502 Ga0207669_10151976 3300025937 Bacteria 1623
503 Ga0207669_10203669 3300025937 Unclassified 1439
504 Ga0207665_10237666 3300025939 Bacteria 1341
505 Ga0207691_10005460 3300025940 Bacteria 12275
506 Ga0207691_10007594 3300025940 Bacteria 10436
507 Ga0207691_10058935 3300025940 Bacteria 3492
508 Ga0207691_10081342 3300025940 Bacteria 2912
509 Ga0207691_10196613 3300025940 Unclassified 1756
510 Ga0207691_10296562 3300025940 Bacteria 1390
511 Ga0207711_10010970 3300025941 Bacteria 7527
512 Ga0207711_10015475 3300025941 Bacteria 6331
513 Ga0207711_10279676 3300025941 Bacteria 1537
514 Ga0207711_10411937 3300025941 Bacteria 1256
515 Ga0207711_10539155 3300025941 Bacteria 1088
516 Ga0207711_10818216 3300025941 Bacteria 867
517 Ga0207689_10125951 3300025942 Bacteria 2107
518 Ga0207689_10171397 3300025942 Bacteria 1789
519 Ga0207689_10239571 3300025942 Bacteria 1500
520 Ga0207689_10687052 3300025942 Bacteria 863
521 Ga0207661_10028646 3300025944 Bacteria 4268
522 Ga0207661_10149295 3300025944 Bacteria 2019
523 Ga0207661_10189464 3300025944 Bacteria 1802
524 Ga0207661_10194740 3300025944 Bacteria 1779
525 Ga0207679_10036288 3300025945 Bacteria 3495
526 Ga0207679_10063737 3300025945 Unclassified 2752
527 Ga0207679_10067526 3300025945 Bacteria 2682
528 Ga0207679_10695276 3300025945 Bacteria 922
529 Ga0207679_10776776 3300025945 Unclassified 872
530 Ga0207679_10810794 3300025945 Bacteria 854
531 Ga0207667_10119119 3300025949 Bacteria 2721
532 Ga0207651_10121381 3300025960 Bacteria 1982
533 Ga0207651_10287771 3300025960 Bacteria 1361
534 Ga0207651_10497533 3300025960 Unclassified 1053
535 Ga0207712_10015539 3300025961 Bacteria 4914
536 Ga0207712_10037657 3300025961 Bacteria 3302
537 Ga0207712_10184263 3300025961 Bacteria 1642
538 Ga0207668_10264231 3300025972 Bacteria 1404
539 Ga0207668_10973734 3300025972 Unclassified 757
540 Ga0207640_10030812 3300025981 Bacteria 3308
541 Ga0207640_10216695 3300025981 Bacteria 1463
542 Ga0207640_10308458 3300025981 Bacteria 1255
543 Ga0207658_10169722 3300025986 Bacteria 1796
544 Ga0207658_10258637 3300025986 Unclassified 1483
545 Ga0207677_10086540 3300026023 Bacteria 2265
546 Ga0207677_10310025 3300026023 Viruses 1307
547 Ga0207703_10101203 3300026035 Bacteria 2443
548 Ga0207703_10357415 3300026035 Bacteria 1346
549 Ga0207639_10170263 3300026041 Unclassified 1844
550 Ga0207639_10793951 3300026041 Bacteria 882
551 Ga0207678_10322868 3300026067 Bacteria 1328
552 Ga0207678_10356505 3300026067 Bacteria 1262
553 Ga0207708_10032899 3300026075 Bacteria 3937
554 Ga0207708_10035821 3300026075 Bacteria 3776
555 Ga0207708_10133653 3300026075 Bacteria 1941
556 Ga0207708_10166145 3300026075 Bacteria 1745
557 Ga0207708_10201623 3300026075 Bacteria 1587
558 Ga0207708_10279779 3300026075 Bacteria 1352
559 Ga0207641_10053459 3300026088 Bacteria 3424
560 Ga0207641_10110759 3300026088 Bacteria 2433
561 Ga0207641_10123284 3300026088 Bacteria 2316
562 Ga0207641_10131881 3300026088 Bacteria 2245
563 Ga0207641_10708856 3300026088 Bacteria 991
564 Ga0207641_11328018 3300026088 Bacteria 720
565 Ga0207648_10045328 3300026089 Bacteria 3857
566 Ga0207648_10046880 3300026089 Bacteria 3789
567 Ga0207648_10122000 3300026089 Bacteria 2292
568 Ga0207648_10122034 3300026089 Bacteria 2291
569 Ga0207648_10170744 3300026089 Bacteria 1922
570 Ga0207676_10010544 3300026095 Bacteria 6584
571 Ga0207676_10015954 3300026095 Bacteria 5434
572 Ga0207676_10088803 3300026095 Unclassified 2531
573 Ga0207676_10088868 3300026095 Bacteria 2530
574 Ga0207676_10207204 3300026095 Bacteria 1737
575 Ga0207676_10834994 3300026095 Unclassified 900
576 Ga0207674_10000036 3300026116 Bacteria 135434
577 Ga0207674_10080019 3300026116 Bacteria 3271
578 Ga0207674_10088804 3300026116 Bacteria 3083
579 Ga0207674_10228298 3300026116 Bacteria 1810
580 Ga0207675_100004763 3300026118 Bacteria 13073
581 Ga0207675_100021047 3300026118 Bacteria 6080
582 Ga0207675_100349776 3300026118 Bacteria 1448
583 Ga0207675_100384023 3300026118 Unclassified 1381
584 Ga0207683_10060668 3300026121 Bacteria 3325
585 Ga0207698_10022351 3300026142 Bacteria 4393
586 Ga0207698_10118214 3300026142 Bacteria 2238
587 Ga0207428_10008435 3300027907 Bacteria 9303
588 Ga0268265_10021396 3300028380 Bacteria 4530
589 Ga0268265_10029798 3300028380 Bacteria 3924
590 Ga0268265_10232457 3300028380 Bacteria 1621
591 Ga0268265_10526912 3300028380 Unclassified 1118
592 Ga0268265_10536249 3300028380 Bacteria 1109
593 Ga0268264_10062557 3300028381 Bacteria 3125
594 Ga0268264_10121248 3300028381 Bacteria 2304
595 Ga0268264_10167421 3300028381 Bacteria 1985
596 Ga0268264_10289706 3300028381 Bacteria 1537
597 Ga0268264_10371909 3300028381 Bacteria 1366
598 Ga0268264_10507550 3300028381 Bacteria 1177
599 Ga0268264_10542848 3300028381 Unclassified 1139
600 Ga0307408_100001243 3300031548 Bacteria 19119
601 Ga0307408_100092047 3300031548 Bacteria 2291
602 Ga0307408_100463348 3300031548 Bacteria 1102
603 Ga0307405_10081512 3300031731 Unclassified 2115
604 Ga0307410_10023943 3300031852 Bacteria 3807
605 Ga0307410_10090006 3300031852 Bacteria 2176
606 Ga0307406_10001021 3300031901 Bacteria 15570
607 Ga0307406_10414832 3300031901 Unclassified 1071
608 Ga0307407_10282757 3300031903 Bacteria 1150
609 Ga0307412_10025475 3300031911 Bacteria 3665
610 Ga0307412_10045820 3300031911 Bacteria 2861
611 Ga0307412_10194818 3300031911 Bacteria 1535
612 Ga0307409_100028349 3300031995 Bacteria 3988
613 Ga0307409_100165559 3300031995 Bacteria 1940
614 Ga0307409_100178926 3300031995 Bacteria 1875
615 Ga0307416_100079110 3300032002 Unclassified 2769
616 Ga0307416_100115235 3300032002 Bacteria 2379
617 Ga0307414_10000585 3300032004 Bacteria 18889
618 Ga0307411_10136405 3300032005 Unclassified 1802
619 Ga0307411_10187652 3300032005 Bacteria 1575
620 Ga0307415_100000479 3300032126 Bacteria 17301
621 Ga0307415_100311952 3300032126 Bacteria 1307
622 Ga0373938_0067568 3300034957 Bacteria 848
623 Ga0373951_0002340 3300035091 Unclassified 4808
624 Ga0373951_0058889 3300035091 Bacteria 958
625 Ga0373941_0013172 3300035115 Bacteria 2180
626 Ga0373943_0275980 3300035170 Unclassified 949
627 Ga0373942_0002199 3300035207 Bacteria 4798
628 Ga0373931_0061976 3300035691 Bacteria 2018
629 Ga0373925_0216663 3300037068 Unclassified 1527
630 Ga0395900_0361786 3300037418 Bacteria 1422
631 Ga0395898_0030070 3300037466 Bacteria 5439
632 Ga0395898_0109812 3300037466 Bacteria 2644
633 Ga0395901_0134830 3300038443 Bacteria 2595
634 Ga0242422_00508 3300038699 Bacteria 2488
635 Ga0436365_0753735 3300039437 Bacteria 2838
636 Ga0436365_1183350 3300039437 Bacteria 785
637 Ga0436362_1219580 3300039453 Bacteria 1485
638 Ga0439455_0140664 3300042012 Unclassified 684
639 Ga0450896_010607 3300042133 Bacteria 1293
640 Ga0439458_0002105 3300042157 Bacteria 4938
641 Ga0439459_0080726 3300042438 Unclassified 767
642 Ga0451577_0013815 3300042876 Bacteria 7543
643 Ga0451577_0154276 3300042876 Unclassified 2066
644 Ga0453684_0051872 3300044712 Bacteria 5370
645 Ga0453684_0702917 3300044712 Bacteria 1098
646 Ga0453684_0713846 3300044712 Bacteria 1088
647 Ga0451576_0183871 3300045051 Unclassified 2182
648 Ga0451576_0329975 3300045051 Bacteria 1597
649 Ga0495629_0087031 3300046459 Unclassified 2180
650 Ga0495580_0171946 3300046472 Unclassified 1498
651 Ga0495582_0027136 3300046473 Bacteria 3138
652 Ga0495639_0114754 3300046475 Bacteria 1281
653 Ga0495662_0226911 3300046476 Bacteria 921
654 Ga0495587_0061577 3300046536 Bacteria 2199
655 Ga0495656_0267389 3300046615 Bacteria 868
656 Ga0495623_0116620 3300046679 Bacteria 1613
657 Ga0495658_0023747 3300046683 Bacteria 3258
658 Ga0495613_0051972 3300046689 Bacteria 3019
659 Ga0495581_0071443 3300047315 Bacteria 2008
660 Ga0495636_0106621 3300047318 Bacteria 1230
661 Ga0495680_0293183 3300047322 Bacteria 1144
662 Ga0496100_0140208 3300048903 Bacteria 1713
663 Ga0496102_0737962 3300048905 Bacteria 908
664 Ga0496104_0026445 3300048907 Bacteria 5359
665 Ga0496104_0351339 3300048907 Bacteria 1387
666 Ga0496106_0064473 3300048909 Bacteria 2787
667 Ga0496106_0337722 3300048909 Bacteria 1210
668 Ga0496107_0390484 3300048910 Unclassified 1035
669 Ga0496108_0214327 3300048911 Bacteria 1672
670 Ga0496109_0155608 3300048912 Bacteria 2141
671 Ga0496110_0165894 3300048913 Bacteria 2003
672 Ga0496110_0460589 3300048913 Unclassified 1159
673 Ga0496111_0232941 3300048914 Bacteria 1368
674 Ga0496112_0003628 3300048915 Bacteria 12857
675 Ga0496112_0105263 3300048915 Bacteria 2791
676 Ga0496112_0148038 3300048915 Bacteria 2316
677 Ga0496112_0223885 3300048915 Unclassified 1837
678 Ga0496112_0262779 3300048915 Unclassified 1675
679 Ga0496112_0714713 3300048915 Unclassified 929
680 Ga0496112_0818765 3300048915 Bacteria 855
681 Ga0496113_0071600 3300048916 Bacteria 2637
682 Ga0496113_0076095 3300048916 Bacteria 2563
683 Ga0496115_0061873 3300048918 Bacteria 3019
684 Ga0501292_025620 3300049515 Unclassified 972
685 Ga0501296_001846 3300049519 Bacteria 2158
686 Ga0501296_011344 3300049519 Unclassified 1066
687 Ga0501298_005326 3300049521 Bacteria 2059
688 Ga0501298_020745 3300049521 Unclassified 1227
689 Ga0501299_001169 3300049522 Bacteria 3297
690 Ga0501299_003968 3300049522 Bacteria 2177
691 Ga0501038_0007917 3300049574 Bacteria 9799
692 Ga0501039_0350717 3300049575 Bacteria 1160
693 Ga0501047_0017450 3300049581 Bacteria 6875
694 Ga0501070_0078070 3300049586 Bacteria 2740
695 Ga0501198_004307 3300049649 Bacteria 1972
696 Ga0501198_004796 3300049649 Unclassified 1888
697 Ga0501201_003184 3300049651 Bacteria 1505
698 Ga0501202_000726 3300049652 Bacteria 4919
699 Ga0501207_003365 3300049654 Unclassified 2127
700 Ga0501208_020754 3300049655 Bacteria 1072
701 Ga0501216_000404 3300049660 Bacteria 5053
702 Ga0501217_000501 3300049661 Bacteria 6476
703 Ga0501217_001421 3300049661 Bacteria 4483
704 Ga0501223_001838 3300049663 Bacteria 4801
705 Ga0501223_016291 3300049663 Bacteria 1469
706 Ga0501223_062810 3300049663 Bacteria 727
707 Ga0501224_001054 3300049664 Unclassified 3592
708 Ga0501224_006907 3300049664 Bacteria 1651
709 Ga0501224_018057 3300049664 Unclassified 1051
710 Ga0501227_018590 3300049665 Unclassified 1578
711 Ga0501230_052488 3300049667 Unclassified 812
712 Ga0501233_008080 3300049668 Bacteria 2020
713 Ga0501233_023161 3300049668 Unclassified 1347
714 Ga0501233_132883 3300049668 Unclassified 681
715 Ga0501235_081883 3300049669 Bacteria 772
716 Ga0501236_009647 3300049670 Unclassified 1249
717 Ga0501239_021443 3300049672 Bacteria 795
718 Ga0501247_036223 3300049677 Bacteria 691
719 Ga0501249_015470 3300049679 Bacteria 1632
720 Ga0501249_071115 3300049679 Bacteria 813
721 Ga0501257_009411 3300049686 Bacteria 2207
722 Ga0501257_022771 3300049686 Unclassified 1483
723 Ga0501259_010695 3300049688 Unclassified 1503
724 Ga0501259_021923 3300049688 Bacteria 1144
725 Ga0501259_026097 3300049688 Bacteria 1074
726 Ga0501221_013909 3300049704 Bacteria 1488
727 Ga0501221_030679 3300049704 Unclassified 1119
728 Ga0501225_0000268 3300049705 Bacteria 16456
729 Ga0501225_0016736 3300049705 Bacteria 2037
730 Ga0501225_0021865 3300049705 Bacteria 1765
731 Ga0501225_0104743 3300049705 Bacteria 829
732 Ga0501229_002612 3300049706 Unclassified 2126
733 Ga0501245_010927 3300049708 Unclassified 1316
734 Ga0501080_0572881 3300049742 Bacteria 1004
735 Ga0501262_025378 3300049759 Bacteria 832
736 Ga0501268_022068 3300049765 Bacteria 1096
737 Ga0501273_017449 3300049770 Unclassified 948
738 Ga0501274_003906 3300049771 Bacteria 1215
739 Ga0501279_016223 3300049775 Bacteria 1036
740 Ga0501212_012785 3300049851 Unclassified 1225
741 Ga0501226_011791 3300049853 Bacteria 968
742 nmdc:mga05p37_154084_c1 3300050507 Bacteria 2809
743 nmdc:mga05p37_196792_c1 3300050507 Bacteria 2444
744 nmdc:mga05p37_250717_c1 3300050507 Bacteria 2123
745 nmdc:mga05p37_571766_c1 3300050507 Unclassified 1282
746 nmdc:mga05p37_72456_c1 3300050507 Unclassified 4239
747 nmdc:mga05p37_867590_c1 3300050507 Bacteria 978
748 nmdc:mga09592_227502_c1 3300050508 Unclassified 1616
749 nmdc:mga09592_40904_c1 3300050508 Bacteria 3895
750 nmdc:mga0qj67_291008_c1 3300050509 Unclassified 1324
751 nmdc:mga0qj67_29879_c1 3300050509 Bacteria 4236
752 nmdc:mga0qj67_5159_c1 3300050509 Bacteria 9523
753 nmdc:mga06r32_25661_c1 3300050510 Bacteria 5485
754 nmdc:mga06r32_299140_c1 3300050510 Bacteria 1595
755 nmdc:mga06r32_46784_c1 3300050510 Unclassified 4129
756 nmdc:mga08y16_187755_c1 3300050511 Bacteria 2144
757 nmdc:mga08y16_228505_c1 3300050511 Bacteria 1925
758 nmdc:mga08y16_34486_c1 3300050511 Bacteria 5316
759 nmdc:mga08y16_358652_c1 3300050511 Unclassified 1497
760 nmdc:mga08y16_605681_c1 3300050511 Unclassified 1104
761 nmdc:mga08y16_720465_c1 3300050511 Bacteria 996
762 nmdc:mga08y16_73811_c1 3300050511 Bacteria 3554
763 nmdc:mga0n895_1020706_c1 3300050512 Bacteria 807
764 nmdc:mga0n895_160092_c1 3300050512 Bacteria 2283
765 nmdc:mga0n895_236378_c1 3300050512 Unclassified 1854
766 nmdc:mga0n895_82408_c1 3300050512 Bacteria 3207
767 nmdc:mga0rr50_116270_c1 3300050513 Bacteria 2123
768 nmdc:mga0rr50_190895_c1 3300050513 Unclassified 1679
769 nmdc:mga0rr50_356114_c1 3300050513 Bacteria 1231
770 nmdc:mga0rr50_650647_c1 3300050513 Bacteria 899
771 nmdc:mga08x19_8914_c1 3300050514 Bacteria 5985
772 nmdc:mga0a205_12578_c1 3300050515 Bacteria 7831
773 nmdc:mga0a205_175881_c1 3300050515 Bacteria 2036
774 nmdc:mga0a205_19133_c1 3300050515 Bacteria 6454
775 nmdc:mga0a205_63313_c1 3300050515 Bacteria 3573
776 nmdc:mga0a205_641779_c1 3300050515 Bacteria 913
777 Ga0501084_0510789 3300054114 Bacteria 1016
778 Ga0530510_0313794 3300061734 Bacteria 1174

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025939 Ga0207665_10237666 Ga0207665_102376662 189
2 3300009147 Ga0114129_10338280 Ga0114129_103382801 195
3 3300050513 nmdc:mga0rr50_356114_c1 nmdc:mga0rr50_356114_c1_237_932 195
4 3300009093 Ga0105240_10271544 Ga0105240_102715442 196
5 3300009094 Ga0111539_10028853 Ga0111539_100288537 196
6 3300009147 Ga0114129_10668957 Ga0114129_106689572 196
7 3300009177 Ga0105248_10353466 Ga0105248_103534662 196
8 3300011119 Ga0105246_10706698 Ga0105246_107066982 196
9 3300013102 Ga0157371_10032315 Ga0157371_100323151 196
10 3300013297 Ga0157378_10460256 Ga0157378_104602562 196
11 3300013306 Ga0163162_10004987 Ga0163162_100049875 196
12 3300013307 Ga0157372_10082372 Ga0157372_100823722 196
13 3300013308 Ga0157375_10312236 Ga0157375_103122362 196
14 3300014326 Ga0157380_10146483 Ga0157380_101464832 196
15 3300014968 Ga0157379_10025524 Ga0157379_100255247 196
16 3300035170 Ga0373943_0275980 Ga0373943_0275980_208_798 196
17 3300037068 Ga0373925_0216663 Ga0373925_0216663_719_1309 196
18 3300042012 Ga0439455_0140664 Ga0439455_0140664_14_604 196
19 3300045051 Ga0451576_0183871 Ga0451576_0183871_382_972 196
20 3300046459 Ga0495629_0087031 Ga0495629_0087031_166_756 196
21 3300046472 Ga0495580_0171946 Ga0495580_0171946_138_728 196
22 3300046473 Ga0495582_0027136 Ga0495582_0027136_261_851 196
23 3300046683 Ga0495658_0023747 Ga0495658_0023747_542_1132 196
24 3300050507 nmdc:mga05p37_867590_c1 nmdc:mga05p37_867590_c1_142_732 196
25 3300050511 nmdc:mga08y16_73811_c1 nmdc:mga08y16_73811_c1_1056_1646 196
26 3300050512 nmdc:mga0n895_82408_c1 nmdc:mga0n895_82408_c1_890_1480 196
27 3300050513 nmdc:mga0rr50_116270_c1 nmdc:mga0rr50_116270_c1_773_1363 196
28 3300050515 nmdc:mga0a205_19133_c1 nmdc:mga0a205_19133_c1_292_882 196
29 3300005345 Ga0070692_10523184 Ga0070692_105231841 201
30 3300005546 Ga0070696_100835093 Ga0070696_1008350931 201
31 3300009553 Ga0105249_10272944 Ga0105249_102729441 201
32 3300025917 Ga0207660_10460245 Ga0207660_104602451 201
33 3300028380 Ga0268265_10536249 Ga0268265_105362492 201
34 3300042876 Ga0451577_0013815 Ga0451577_0013815_5231_5872 201
35 3300042876 Ga0451577_0154276 Ga0451577_0154276_715_1356 201
36 3300044712 Ga0453684_0051872 Ga0453684_0051872_3012_3653 201
37 3300044712 Ga0453684_0713846 Ga0453684_0713846_296_937 201
38 3300009094 Ga0111539_10262265 Ga0111539_102622653 202
39 3300009176 Ga0105242_10516622 Ga0105242_105166222 202
40 3300009177 Ga0105248_10471100 Ga0105248_104711002 202
41 3300009177 Ga0105248_10898012 Ga0105248_108980121 202
42 3300014325 Ga0163163_10021610 Ga0163163_100216104 202
43 3300015265 Ga0182005_1042338 Ga0182005_10423382 202
44 3300042133 Ga0450896_010607 Ga0450896_010607_569_1177 202
45 3300050509 nmdc:mga0qj67_5159_c1 nmdc:mga0qj67_5159_c1_7473_8081 202
46 3300050511 nmdc:mga08y16_228505_c1 nmdc:mga08y16_228505_c1_17_625 202
47 3300005354 Ga0070675_100186512 Ga0070675_1001865122 203
48 3300005364 Ga0070673_100325774 Ga0070673_1003257742 203
49 3300013104 Ga0157370_10003071 Ga0157370_100030719 203
50 3300013308 Ga0157375_10331166 Ga0157375_103311662 203
51 3300014325 Ga0163163_10170504 Ga0163163_101705045 203
52 3300025925 Ga0207650_10016789 Ga0207650_100167895 203
53 3300025933 Ga0207706_10405129 Ga0207706_104051291 203
54 3300025942 Ga0207689_10239571 Ga0207689_102395712 203
55 3300039437 Ga0436365_0753735 Ga0436365_0753735_834_1496 203
56 3300039453 Ga0436362_1219580 Ga0436362_1219580_192_854 203
57 3300046475 Ga0495639_0114754 Ga0495639_0114754_262_894 203
58 3300046476 Ga0495662_0226911 Ga0495662_0226911_78_710 203
59 3300046536 Ga0495587_0061577 Ga0495587_0061577_1252_1884 203
60 3300046689 Ga0495613_0051972 Ga0495613_0051972_638_1270 203
61 3300047315 Ga0495581_0071443 Ga0495581_0071443_1227_1859 203
62 3300047322 Ga0495680_0293183 Ga0495680_0293183_251_883 203
63 3300048915 Ga0496112_0818765 Ga0496112_0818765_227_841 203
64 3300048918 Ga0496115_0061873 Ga0496115_0061873_2016_2648 203
65 3300049742 Ga0501080_0572881 Ga0501080_0572881_52_684 203
66 3300050510 nmdc:mga06r32_299140_c1 nmdc:mga06r32_299140_c1_92_703 203
67 2162886011 MRS1b_contig_2056278 MRS1b_0831.00002370 204
68 3300005290 Ga0065712_10155384 Ga0065712_101553841 204
69 3300005327 Ga0070658_10002464 Ga0070658_100024642 204
70 3300005327 Ga0070658_10005958 Ga0070658_100059588 204
71 3300005327 Ga0070658_10157855 Ga0070658_101578552 204
72 3300005327 Ga0070658_10180351 Ga0070658_101803513 204
73 3300005328 Ga0070676_10025393 Ga0070676_100253934 204
74 3300005329 Ga0070683_100026660 Ga0070683_1000266604 204
75 3300005329 Ga0070683_100048690 Ga0070683_1000486907 204
76 3300005329 Ga0070683_100053305 Ga0070683_1000533053 204
77 3300005329 Ga0070683_100568855 Ga0070683_1005688552 204
78 3300005336 Ga0070680_100161341 Ga0070680_1001613412 204
79 3300005338 Ga0068868_100018852 Ga0068868_1000188521 204
80 3300005338 Ga0068868_100316346 Ga0068868_1003163462 204
81 3300005339 Ga0070660_100000988 Ga0070660_1000009889 204
82 3300005340 Ga0070689_100709725 Ga0070689_1007097252 204
83 3300005343 Ga0070687_100143573 Ga0070687_1001435733 204
84 3300005344 Ga0070661_100039569 Ga0070661_1000395694 204
85 3300005347 Ga0070668_100119168 Ga0070668_1001191684 204
86 3300005353 Ga0070669_100130023 Ga0070669_1001300233 204
87 3300005353 Ga0070669_100170970 Ga0070669_1001709701 204
88 3300005354 Ga0070675_100321704 Ga0070675_1003217043 204
89 3300005354 Ga0070675_100455687 Ga0070675_1004556871 204
90 3300005355 Ga0070671_100037834 Ga0070671_1000378345 204
91 3300005364 Ga0070673_100110467 Ga0070673_1001104673 204
92 3300005366 Ga0070659_100106891 Ga0070659_1001068912 204
93 3300005366 Ga0070659_100900908 Ga0070659_1009009081 204
94 3300005367 Ga0070667_100062002 Ga0070667_1000620024 204
95 3300005367 Ga0070667_100573917 Ga0070667_1005739172 204
96 3300005457 Ga0070662_100238356 Ga0070662_1002383562 204
97 3300005458 Ga0070681_10007686 Ga0070681_1000768610 204
98 3300005471 Ga0070698_100897029 Ga0070698_1008970291 204
99 3300005530 Ga0070679_100001326 Ga0070679_1000013268 204
100 3300005530 Ga0070679_100108349 Ga0070679_1001083493 204
101 3300005530 Ga0070679_100432040 Ga0070679_1004320401 204
102 3300005535 Ga0070684_100039618 Ga0070684_1000396183 204
103 3300005535 Ga0070684_100204778 Ga0070684_1002047783 204
104 3300005535 Ga0070684_100658288 Ga0070684_1006582881 204
105 3300005539 Ga0068853_100015189 Ga0068853_1000151894 204
106 3300005543 Ga0070672_100064549 Ga0070672_1000645494 204
107 3300005543 Ga0070672_100072178 Ga0070672_1000721781 204
108 3300005543 Ga0070672_100164230 Ga0070672_1001642303 204
109 3300005544 Ga0070686_100269166 Ga0070686_1002691662 204
110 3300005564 Ga0070664_100452038 Ga0070664_1004520382 204
111 3300005577 Ga0068857_100325729 Ga0068857_1003257292 204
112 3300005616 Ga0068852_100042394 Ga0068852_1000423943 204
113 3300005617 Ga0068859_100048664 Ga0068859_1000486642 204
114 3300005617 Ga0068859_100100661 Ga0068859_1001006614 204
115 3300005618 Ga0068864_100201523 Ga0068864_1002015232 204
116 3300005618 Ga0068864_100398103 Ga0068864_1003981032 204
117 3300005841 Ga0068863_100836050 Ga0068863_1008360502 204
118 3300005842 Ga0068858_100280650 Ga0068858_1002806503 204
119 3300005843 Ga0068860_100123760 Ga0068860_1001237604 204
120 3300005843 Ga0068860_100423238 Ga0068860_1004232383 204
121 3300005844 Ga0068862_100114154 Ga0068862_1001141543 204
122 3300006881 Ga0068865_100101415 Ga0068865_1001014153 204
123 3300006931 Ga0097620_100048664 Ga0097620_1000486646 204
124 3300006931 Ga0097620_100100663 Ga0097620_1001006634 204
125 3300007076 Ga0075435_100638599 Ga0075435_1006385992 204
126 3300009094 Ga0111539_10115883 Ga0111539_101158833 204
127 3300009176 Ga0105242_10320683 Ga0105242_103206832 204
128 3300009177 Ga0105248_10124698 Ga0105248_101246982 204
129 3300009177 Ga0105248_10346833 Ga0105248_103468332 204
130 3300009177 Ga0105248_10973668 Ga0105248_109736682 204
131 3300013100 Ga0157373_10011153 Ga0157373_100111537 204
132 3300013102 Ga0157371_10015820 Ga0157371_100158202 204
133 3300013102 Ga0157371_10035193 Ga0157371_100351933 204
134 3300013102 Ga0157371_10501976 Ga0157371_105019762 204
135 3300013102 Ga0157371_10616830 Ga0157371_106168301 204
136 3300013105 Ga0157369_10004455 Ga0157369_1000445516 204
137 3300013105 Ga0157369_10029579 Ga0157369_100295794 204
138 3300013105 Ga0157369_10577148 Ga0157369_105771482 204
139 3300013306 Ga0163162_10173782 Ga0163162_101737824 204
140 3300013307 Ga0157372_10001740 Ga0157372_100017405 204
141 3300013307 Ga0157372_10020733 Ga0157372_100207338 204
142 3300013307 Ga0157372_10074735 Ga0157372_100747352 204
143 3300013307 Ga0157372_10085626 Ga0157372_100856263 204
144 3300013307 Ga0157372_10235864 Ga0157372_102358644 204
145 3300013307 Ga0157372_10381665 Ga0157372_103816651 204
146 3300013308 Ga0157375_10046224 Ga0157375_100462244 204
147 3300013308 Ga0157375_10763537 Ga0157375_107635372 204
148 3300015262 Ga0182007_10159703 Ga0182007_101597031 204
149 3300025907 Ga0207645_10057662 Ga0207645_100576624 204
150 3300025909 Ga0207705_10003006 Ga0207705_1000300610 204
151 3300025909 Ga0207705_10003715 Ga0207705_100037155 204
152 3300025909 Ga0207705_10077432 Ga0207705_100774323 204
153 3300025909 Ga0207705_10108520 Ga0207705_101085203 204
154 3300025909 Ga0207705_10194609 Ga0207705_101946092 204
155 3300025910 Ga0207684_10638051 Ga0207684_106380512 204
156 3300025912 Ga0207707_10011095 Ga0207707_100110958 204
157 3300025917 Ga0207660_10130565 Ga0207660_101305652 204
158 3300025917 Ga0207660_10386906 Ga0207660_103869062 204
159 3300025919 Ga0207657_10000432 Ga0207657_1000043215 204
160 3300025919 Ga0207657_10038770 Ga0207657_100387706 204
161 3300025919 Ga0207657_10205880 Ga0207657_102058803 204
162 3300025921 Ga0207652_10004232 Ga0207652_100042325 204
163 3300025921 Ga0207652_10064735 Ga0207652_100647354 204
164 3300025921 Ga0207652_10377260 Ga0207652_103772602 204
165 3300025923 Ga0207681_10074652 Ga0207681_100746522 204
166 3300025923 Ga0207681_10185204 Ga0207681_101852042 204
167 3300025923 Ga0207681_10529716 Ga0207681_105297161 204
168 3300025925 Ga0207650_10388568 Ga0207650_103885682 204
169 3300025926 Ga0207659_10081703 Ga0207659_100817032 204
170 3300025927 Ga0207687_10347377 Ga0207687_103473772 204
171 3300025932 Ga0207690_10093513 Ga0207690_100935132 204
172 3300025932 Ga0207690_10098229 Ga0207690_100982292 204
173 3300025932 Ga0207690_10530787 Ga0207690_105307872 204
174 3300025933 Ga0207706_10632018 Ga0207706_106320182 204
175 3300025937 Ga0207669_10203669 Ga0207669_102036692 204
176 3300025940 Ga0207691_10007594 Ga0207691_100075943 204
177 3300025940 Ga0207691_10058935 Ga0207691_100589355 204
178 3300025940 Ga0207691_10081342 Ga0207691_100813422 204
179 3300025940 Ga0207691_10296562 Ga0207691_102965623 204
180 3300025941 Ga0207711_10539155 Ga0207711_105391552 204
181 3300025941 Ga0207711_10818216 Ga0207711_108182161 204
182 3300025944 Ga0207661_10028646 Ga0207661_100286464 204
183 3300025944 Ga0207661_10149295 Ga0207661_101492953 204
184 3300025944 Ga0207661_10189464 Ga0207661_101894643 204
185 3300025944 Ga0207661_10194740 Ga0207661_101947402 204
186 3300025945 Ga0207679_10036288 Ga0207679_100362883 204
187 3300025945 Ga0207679_10067526 Ga0207679_100675263 204
188 3300025945 Ga0207679_10695276 Ga0207679_106952761 204
189 3300025945 Ga0207679_10776776 Ga0207679_107767762 204
190 3300025960 Ga0207651_10121381 Ga0207651_101213812 204
191 3300025972 Ga0207668_10264231 Ga0207668_102642313 204
192 3300025972 Ga0207668_10973734 Ga0207668_109737341 204
193 3300025981 Ga0207640_10216695 Ga0207640_102166952 204
194 3300025986 Ga0207658_10169722 Ga0207658_101697222 204
195 3300026023 Ga0207677_10086540 Ga0207677_100865403 204
196 3300026067 Ga0207678_10356505 Ga0207678_103565052 204
197 3300026075 Ga0207708_10166145 Ga0207708_101661453 204
198 3300026089 Ga0207648_10046880 Ga0207648_100468803 204
199 3300026095 Ga0207676_10015954 Ga0207676_100159544 204
200 3300026095 Ga0207676_10207204 Ga0207676_102072043 204
201 3300026116 Ga0207674_10080019 Ga0207674_100800194 204
202 3300026118 Ga0207675_100384023 Ga0207675_1003840232 204
203 3300026142 Ga0207698_10022351 Ga0207698_100223512 204
204 3300028380 Ga0268265_10232457 Ga0268265_102324572 204
205 3300028381 Ga0268264_10507550 Ga0268264_105075503 204
206 3300039437 Ga0436365_1183350 Ga0436365_1183350_100_738 204
207 3300044712 Ga0453684_0702917 Ga0453684_0702917_235_933 204
208 3300046615 Ga0495656_0267389 Ga0495656_0267389_105_770 204
209 3300046679 Ga0495623_0116620 Ga0495623_0116620_728_1366 204
210 3300047318 Ga0495636_0106621 Ga0495636_0106621_228_863 204
211 3300048903 Ga0496100_0140208 Ga0496100_0140208_987_1625 204
212 3300048907 Ga0496104_0026445 Ga0496104_0026445_333_1019 204
213 3300048909 Ga0496106_0337722 Ga0496106_0337722_181_819 204
214 3300048911 Ga0496108_0214327 Ga0496108_0214327_833_1519 204
215 3300048912 Ga0496109_0155608 Ga0496109_0155608_250_936 204
216 3300048913 Ga0496110_0460589 Ga0496110_0460589_14_652 204
217 3300048915 Ga0496112_0003628 Ga0496112_0003628_10803_11489 204
218 3300048916 Ga0496113_0071600 Ga0496113_0071600_271_957 204
219 3300048916 Ga0496113_0076095 Ga0496113_0076095_574_1212 204
220 3300049575 Ga0501039_0350717 Ga0501039_0350717_106_741 204
221 3300049581 Ga0501047_0017450 Ga0501047_0017450_756_1391 204
222 3300049586 Ga0501070_0078070 Ga0501070_0078070_1327_1962 204
223 3300050511 nmdc:mga08y16_187755_c1 nmdc:mga08y16_187755_c1_523_1161 204
224 3300050513 nmdc:mga0rr50_650647_c1 nmdc:mga0rr50_650647_c1_80_766 204
225 3300005440 Ga0070705_100321466 Ga0070705_1003214661 205
226 3300005445 Ga0070708_100275416 Ga0070708_1002754162 205
227 3300005467 Ga0070706_100030111 Ga0070706_1000301112 205
228 3300005518 Ga0070699_100022438 Ga0070699_1000224381 205
229 3300005518 Ga0070699_100592213 Ga0070699_1005922132 205
230 3300005536 Ga0070697_100000366 Ga0070697_1000003667 205
231 3300005536 Ga0070697_100057838 Ga0070697_1000578384 205
232 3300005536 Ga0070697_100153538 Ga0070697_1001535382 205
233 3300005536 Ga0070697_100268567 Ga0070697_1002685672 205
234 3300005546 Ga0070696_100060769 Ga0070696_1000607694 205
235 3300005549 Ga0070704_100051780 Ga0070704_1000517803 205
236 3300005719 Ga0068861_100055926 Ga0068861_1000559264 205
237 3300006844 Ga0075428_100845779 Ga0075428_1008457791 205
238 3300006880 Ga0075429_100025872 Ga0075429_1000258724 205
239 3300006931 Ga0097620_100150365 Ga0097620_1001503652 205
240 3300009147 Ga0114129_10175898 Ga0114129_101758982 205
241 3300009147 Ga0114129_10504730 Ga0114129_105047302 205
242 3300009147 Ga0114129_11753732 Ga0114129_117537321 205
243 3300009553 Ga0105249_10001430 Ga0105249_100014305 205
244 3300013297 Ga0157378_10059181 Ga0157378_100591814 205
245 3300013306 Ga0163162_10000027 Ga0163162_10000027121 205
246 3300025910 Ga0207684_10199837 Ga0207684_101998371 205
247 2162886007 SwRhRL2b_contig_634714 SwRhRL2b_0817.00003990 206
248 3300002459 JGI24751J29686_10000049 JGI24751J29686_1000004947 206
249 3300003203 JGI25406J46586_10021838 JGI25406J46586_100218383 206
250 3300003322 rootL2_10255558 rootL2_102555582 206
251 3300005288 Ga0065714_10064507 Ga0065714_1006450714 206
252 3300005289 Ga0065704_10071515 Ga0065704_100715157 206
253 3300005290 Ga0065712_10000138 Ga0065712_1000013834 206
254 3300005290 Ga0065712_10000296 Ga0065712_100002964 206
255 3300005290 Ga0065712_10080959 Ga0065712_100809594 206
256 3300005290 Ga0065712_10095370 Ga0065712_100953702 206
257 3300005290 Ga0065712_10242962 Ga0065712_102429621 206
258 3300005293 Ga0065715_10004340 Ga0065715_100043408 206
259 3300005293 Ga0065715_10005901 Ga0065715_100059014 206
260 3300005293 Ga0065715_10022879 Ga0065715_100228792 206
261 3300005293 Ga0065715_10033378 Ga0065715_100333781 206
262 3300005293 Ga0065715_10109003 Ga0065715_101090033 206
263 3300005293 Ga0065715_10341202 Ga0065715_103412021 206
264 3300005295 Ga0065707_10087245 Ga0065707_100872454 206
265 3300005295 Ga0065707_10094864 Ga0065707_100948643 206
266 3300005295 Ga0065707_10158018 Ga0065707_101580182 206
267 3300005328 Ga0070676_10057386 Ga0070676_100573862 206
268 3300005330 Ga0070690_100005770 Ga0070690_1000057705 206
269 3300005331 Ga0070670_100022889 Ga0070670_1000228898 206
270 3300005331 Ga0070670_100069882 Ga0070670_1000698824 206
271 3300005334 Ga0068869_100065048 Ga0068869_1000650482 206
272 3300005334 Ga0068869_100264201 Ga0068869_1002642012 206
273 3300005334 Ga0068869_100387138 Ga0068869_1003871382 206
274 3300005335 Ga0070666_10116685 Ga0070666_101166852 206
275 3300005336 Ga0070680_100009370 Ga0070680_1000093705 206
276 3300005336 Ga0070680_100021413 Ga0070680_1000214133 206
277 3300005337 Ga0070682_100002890 Ga0070682_10000289010 206
278 3300005337 Ga0070682_100003390 Ga0070682_10000339012 206
279 3300005337 Ga0070682_100205057 Ga0070682_1002050572 206
280 3300005338 Ga0068868_100417884 Ga0068868_1004178842 206
281 3300005339 Ga0070660_100111873 Ga0070660_1001118733 206
282 3300005340 Ga0070689_100340771 Ga0070689_1003407712 206
283 3300005340 Ga0070689_100610916 Ga0070689_1006109161 206
284 3300005343 Ga0070687_100124760 Ga0070687_1001247601 206
285 3300005344 Ga0070661_100005268 Ga0070661_1000052685 206
286 3300005345 Ga0070692_10009492 Ga0070692_100094923 206
287 3300005345 Ga0070692_10029041 Ga0070692_100290413 206
288 3300005345 Ga0070692_10126341 Ga0070692_101263412 206
289 3300005345 Ga0070692_10160482 Ga0070692_101604822 206
290 3300005345 Ga0070692_10445531 Ga0070692_104455311 206
291 3300005353 Ga0070669_100079505 Ga0070669_1000795052 206
292 3300005355 Ga0070671_100003695 Ga0070671_1000036954 206
293 3300005355 Ga0070671_100044712 Ga0070671_1000447124 206
294 3300005355 Ga0070671_100104686 Ga0070671_1001046862 206
295 3300005356 Ga0070674_100322385 Ga0070674_1003223851 206
296 3300005364 Ga0070673_100039820 Ga0070673_1000398202 206
297 3300005364 Ga0070673_100085054 Ga0070673_1000850542 206
298 3300005364 Ga0070673_100325616 Ga0070673_1003256162 206
299 3300005364 Ga0070673_100583942 Ga0070673_1005839422 206
300 3300005365 Ga0070688_100167768 Ga0070688_1001677681 206
301 3300005366 Ga0070659_100022165 Ga0070659_1000221655 206
302 3300005367 Ga0070667_100032807 Ga0070667_1000328073 206
303 3300005367 Ga0070667_100272039 Ga0070667_1002720391 206
304 3300005406 Ga0070703_10014271 Ga0070703_100142713 206
305 3300005438 Ga0070701_10087404 Ga0070701_100874042 206
306 3300005440 Ga0070705_100001180 Ga0070705_1000011804 206
307 3300005440 Ga0070705_100272842 Ga0070705_1002728422 206
308 3300005441 Ga0070700_100037052 Ga0070700_1000370524 206
309 3300005441 Ga0070700_100071533 Ga0070700_1000715332 206
310 3300005441 Ga0070700_100276478 Ga0070700_1002764782 206
311 3300005444 Ga0070694_100003400 Ga0070694_1000034004 206
312 3300005444 Ga0070694_100026914 Ga0070694_1000269143 206
313 3300005444 Ga0070694_100029349 Ga0070694_1000293492 206
314 3300005444 Ga0070694_100289868 Ga0070694_1002898681 206
315 3300005444 Ga0070694_100294567 Ga0070694_1002945671 206
316 3300005444 Ga0070694_100339785 Ga0070694_1003397852 206
317 3300005445 Ga0070708_100000147 Ga0070708_10000014741 206
318 3300005455 Ga0070663_100275423 Ga0070663_1002754232 206
319 3300005456 Ga0070678_100021052 Ga0070678_1000210524 206
320 3300005457 Ga0070662_100741850 Ga0070662_1007418501 206
321 3300005457 Ga0070662_100758662 Ga0070662_1007586621 206
322 3300005458 Ga0070681_10000110 Ga0070681_1000011031 206
323 3300005458 Ga0070681_10003413 Ga0070681_1000341313 206
324 3300005458 Ga0070681_10003933 Ga0070681_100039334 206
325 3300005458 Ga0070681_10083531 Ga0070681_100835313 206
326 3300005458 Ga0070681_10104289 Ga0070681_101042892 206
327 3300005459 Ga0068867_100017771 Ga0068867_1000177715 206
328 3300005459 Ga0068867_100031255 Ga0068867_1000312554 206
329 3300005459 Ga0068867_100656091 Ga0068867_1006560912 206
330 3300005466 Ga0070685_10219607 Ga0070685_102196072 206
331 3300005467 Ga0070706_100043041 Ga0070706_1000430414 206
332 3300005467 Ga0070706_100144467 Ga0070706_1001444674 206
333 3300005468 Ga0070707_100141374 Ga0070707_1001413742 206
334 3300005471 Ga0070698_100002024 Ga0070698_10000202411 206
335 3300005471 Ga0070698_100005990 Ga0070698_10000599010 206
336 3300005471 Ga0070698_100008639 Ga0070698_1000086393 206
337 3300005471 Ga0070698_100035160 Ga0070698_1000351602 206
338 3300005518 Ga0070699_100008648 Ga0070699_1000086485 206
339 3300005518 Ga0070699_100012911 Ga0070699_1000129117 206
340 3300005518 Ga0070699_100126214 Ga0070699_1001262142 206
341 3300005518 Ga0070699_100438989 Ga0070699_1004389891 206
342 3300005530 Ga0070679_100000060 Ga0070679_10000006034 206
343 3300005530 Ga0070679_100129400 Ga0070679_1001294003 206
344 3300005536 Ga0070697_100001795 Ga0070697_1000017953 206
345 3300005536 Ga0070697_100040260 Ga0070697_1000402605 206
346 3300005539 Ga0068853_100015348 Ga0068853_1000153484 206
347 3300005539 Ga0068853_100632113 Ga0068853_1006321132 206
348 3300005539 Ga0068853_100873477 Ga0068853_1008734771 206
349 3300005543 Ga0070672_100233819 Ga0070672_1002338192 206
350 3300005544 Ga0070686_100071842 Ga0070686_1000718422 206
351 3300005545 Ga0070695_100045162 Ga0070695_1000451623 206
352 3300005545 Ga0070695_100334669 Ga0070695_1003346692 206
353 3300005545 Ga0070695_100467101 Ga0070695_1004671012 206
354 3300005546 Ga0070696_100046031 Ga0070696_1000460313 206
355 3300005546 Ga0070696_100101732 Ga0070696_1001017322 206
356 3300005546 Ga0070696_100135175 Ga0070696_1001351752 206
357 3300005546 Ga0070696_100166170 Ga0070696_1001661702 206
358 3300005546 Ga0070696_100281073 Ga0070696_1002810732 206
359 3300005546 Ga0070696_100412671 Ga0070696_1004126712 206
360 3300005547 Ga0070693_100005900 Ga0070693_1000059004 206
361 3300005547 Ga0070693_100010936 Ga0070693_1000109363 206
362 3300005547 Ga0070693_100152941 Ga0070693_1001529412 206
363 3300005549 Ga0070704_100010265 Ga0070704_1000102654 206
364 3300005549 Ga0070704_100362035 Ga0070704_1003620352 206
365 3300005563 Ga0068855_100254946 Ga0068855_1002549462 206
366 3300005564 Ga0070664_100001504 Ga0070664_10000150417 206
367 3300005564 Ga0070664_100031842 Ga0070664_1000318423 206
368 3300005564 Ga0070664_100276485 Ga0070664_1002764852 206
369 3300005577 Ga0068857_100001572 Ga0068857_10000157211 206
370 3300005577 Ga0068857_100086416 Ga0068857_1000864162 206
371 3300005577 Ga0068857_100094287 Ga0068857_1000942874 206
372 3300005577 Ga0068857_100162106 Ga0068857_1001621062 206
373 3300005578 Ga0068854_100061524 Ga0068854_1000615242 206
374 3300005578 Ga0068854_100156605 Ga0068854_1001566052 206
375 3300005578 Ga0068854_100221745 Ga0068854_1002217451 206
376 3300005578 Ga0068854_100284021 Ga0068854_1002840212 206
377 3300005615 Ga0070702_100001575 Ga0070702_1000015754 206
378 3300005615 Ga0070702_100141267 Ga0070702_1001412671 206
379 3300005616 Ga0068852_100649020 Ga0068852_1006490202 206
380 3300005616 Ga0068852_101144401 Ga0068852_1011444012 206
381 3300005617 Ga0068859_100048141 Ga0068859_1000481416 206
382 3300005617 Ga0068859_100115041 Ga0068859_1001150413 206
383 3300005617 Ga0068859_100126752 Ga0068859_1001267524 206
384 3300005617 Ga0068859_100167174 Ga0068859_1001671743 206
385 3300005617 Ga0068859_100175496 Ga0068859_1001754963 206
386 3300005617 Ga0068859_100351788 Ga0068859_1003517882 206
387 3300005617 Ga0068859_100356719 Ga0068859_1003567192 206
388 3300005617 Ga0068859_100381597 Ga0068859_1003815972 206
389 3300005617 Ga0068859_100473851 Ga0068859_1004738512 206
390 3300005617 Ga0068859_100596716 Ga0068859_1005967162 206
391 3300005617 Ga0068859_100840320 Ga0068859_1008403202 206
392 3300005618 Ga0068864_100017822 Ga0068864_1000178223 206
393 3300005618 Ga0068864_100127786 Ga0068864_1001277862 206
394 3300005618 Ga0068864_100175271 Ga0068864_1001752712 206
395 3300005618 Ga0068864_100597542 Ga0068864_1005975422 206
396 3300005618 Ga0068864_100890942 Ga0068864_1008909421 206
397 3300005718 Ga0068866_10031205 Ga0068866_100312052 206
398 3300005718 Ga0068866_10157304 Ga0068866_101573042 206
399 3300005719 Ga0068861_100011968 Ga0068861_1000119687 206
400 3300005719 Ga0068861_100070334 Ga0068861_1000703343 206
401 3300005834 Ga0068851_10002245 Ga0068851_100022454 206
402 3300005840 Ga0068870_10069572 Ga0068870_100695723 206
403 3300005840 Ga0068870_10186425 Ga0068870_101864251 206
404 3300005840 Ga0068870_10275118 Ga0068870_102751182 206
405 3300005840 Ga0068870_10357233 Ga0068870_103572332 206
406 3300005841 Ga0068863_100074503 Ga0068863_1000745034 206
407 3300005841 Ga0068863_100077484 Ga0068863_1000774844 206
408 3300005841 Ga0068863_100133463 Ga0068863_1001334632 206
409 3300005841 Ga0068863_100331813 Ga0068863_1003318132 206
410 3300005841 Ga0068863_100401584 Ga0068863_1004015841 206
411 3300005842 Ga0068858_100053043 Ga0068858_1000530433 206
412 3300005842 Ga0068858_100119330 Ga0068858_1001193302 206
413 3300005842 Ga0068858_100131784 Ga0068858_1001317843 206
414 3300005842 Ga0068858_100212660 Ga0068858_1002126603 206
415 3300005842 Ga0068858_100402384 Ga0068858_1004023841 206
416 3300005842 Ga0068858_100654960 Ga0068858_1006549602 206
417 3300005843 Ga0068860_100016852 Ga0068860_1000168524 206
418 3300005843 Ga0068860_100053151 Ga0068860_1000531513 206
419 3300005843 Ga0068860_100262864 Ga0068860_1002628642 206
420 3300005844 Ga0068862_100024723 Ga0068862_1000247234 206
421 3300005844 Ga0068862_100832375 Ga0068862_1008323751 206
422 3300005985 Ga0081539_10000490 Ga0081539_1000049012 206
423 3300005985 Ga0081539_10001185 Ga0081539_1000118534 206
424 3300005985 Ga0081539_10143468 Ga0081539_101434682 206
425 3300006173 Ga0070716_100170952 Ga0070716_1001709522 206
426 3300006237 Ga0097621_100003740 Ga0097621_10000374015 206
427 3300006237 Ga0097621_100005158 Ga0097621_1000051588 206
428 3300006237 Ga0097621_100052841 Ga0097621_1000528412 206
429 3300006358 Ga0068871_100041044 Ga0068871_1000410442 206
430 3300006358 Ga0068871_100125202 Ga0068871_1001252022 206
431 3300006358 Ga0068871_100178993 Ga0068871_1001789931 206
432 3300006844 Ga0075428_100119813 Ga0075428_1001198134 206
433 3300006844 Ga0075428_100159158 Ga0075428_1001591583 206
434 3300006844 Ga0075428_100962892 Ga0075428_1009628922 206
435 3300006846 Ga0075430_100113481 Ga0075430_1001134813 206
436 3300006846 Ga0075430_100205083 Ga0075430_1002050832 206
437 3300006847 Ga0075431_100010525 Ga0075431_1000105254 206
438 3300006847 Ga0075431_100097359 Ga0075431_1000973594 206
439 3300006852 Ga0075433_10030871 Ga0075433_100308713 206
440 3300006852 Ga0075433_10115905 Ga0075433_101159052 206
441 3300006871 Ga0075434_100088077 Ga0075434_1000880773 206
442 3300006871 Ga0075434_100169474 Ga0075434_1001694742 206
443 3300006880 Ga0075429_100165114 Ga0075429_1001651142 206
444 3300006881 Ga0068865_100139443 Ga0068865_1001394432 206
445 3300006914 Ga0075436_100011949 Ga0075436_1000119496 206
446 3300006931 Ga0097620_100048144 Ga0097620_1000481446 206
447 3300006931 Ga0097620_100115030 Ga0097620_1001150303 206
448 3300006931 Ga0097620_100126737 Ga0097620_1001267372 206
449 3300006931 Ga0097620_100167159 Ga0097620_1001671593 206
450 3300006931 Ga0097620_100175505 Ga0097620_1001755053 206
451 3300006931 Ga0097620_100351791 Ga0097620_1003517912 206
452 3300006931 Ga0097620_100356677 Ga0097620_1003566772 206
453 3300006931 Ga0097620_100381602 Ga0097620_1003816022 206
454 3300006931 Ga0097620_100473834 Ga0097620_1004738342 206
455 3300006931 Ga0097620_100596737 Ga0097620_1005967372 206
456 3300006931 Ga0097620_100840301 Ga0097620_1008403011 206
457 3300009093 Ga0105240_10016665 Ga0105240_100166655 206
458 3300009093 Ga0105240_11096713 Ga0105240_110967132 206
459 3300009094 Ga0111539_10000363 Ga0111539_1000036322 206
460 3300009094 Ga0111539_10007694 Ga0111539_1000769410 206
461 3300009094 Ga0111539_10084943 Ga0111539_100849434 206
462 3300009094 Ga0111539_10366872 Ga0111539_103668722 206
463 3300009098 Ga0105245_10021239 Ga0105245_100212392 206
464 3300009098 Ga0105245_10161055 Ga0105245_101610553 206
465 3300009098 Ga0105245_11001648 Ga0105245_110016482 206
466 3300009101 Ga0105247_10008100 Ga0105247_100081005 206
467 3300009101 Ga0105247_10043304 Ga0105247_100433042 206
468 3300009101 Ga0105247_10078632 Ga0105247_100786322 206
469 3300009101 Ga0105247_10383634 Ga0105247_103836342 206
470 3300009147 Ga0114129_10020608 Ga0114129_100206088 206
471 3300009147 Ga0114129_10089786 Ga0114129_100897864 206
472 3300009147 Ga0114129_10164080 Ga0114129_101640804 206
473 3300009147 Ga0114129_10236812 Ga0114129_102368123 206
474 3300009147 Ga0114129_10881370 Ga0114129_108813702 206
475 3300009147 Ga0114129_11001971 Ga0114129_110019712 206
476 3300009148 Ga0105243_10008351 Ga0105243_100083512 206
477 3300009148 Ga0105243_10008920 Ga0105243_100089209 206
478 3300009148 Ga0105243_10296930 Ga0105243_102969302 206
479 3300009148 Ga0105243_11026818 Ga0105243_110268182 206
480 3300009174 Ga0105241_10060700 Ga0105241_100607002 206
481 3300009174 Ga0105241_10151207 Ga0105241_101512072 206
482 3300009174 Ga0105241_10277076 Ga0105241_102770762 206
483 3300009174 Ga0105241_10278029 Ga0105241_102780292 206
484 3300009174 Ga0105241_10320905 Ga0105241_103209052 206
485 3300009174 Ga0105241_10442778 Ga0105241_104427782 206
486 3300009174 Ga0105241_10622173 Ga0105241_106221731 206
487 3300009176 Ga0105242_10009899 Ga0105242_100098997 206
488 3300009176 Ga0105242_10113975 Ga0105242_101139754 206
489 3300009176 Ga0105242_11711254 Ga0105242_117112541 206
490 3300009177 Ga0105248_10026948 Ga0105248_100269484 206
491 3300009177 Ga0105248_10088379 Ga0105248_100883791 206
492 3300009177 Ga0105248_10156840 Ga0105248_101568402 206
493 3300009177 Ga0105248_10263195 Ga0105248_102631952 206
494 3300009177 Ga0105248_10685799 Ga0105248_106857991 206
495 3300009545 Ga0105237_10000527 Ga0105237_1000052737 206
496 3300009545 Ga0105237_10674748 Ga0105237_106747482 206
497 3300009551 Ga0105238_10001996 Ga0105238_1000199614 206
498 3300009553 Ga0105249_10083701 Ga0105249_100837011 206
499 3300009553 Ga0105249_10152210 Ga0105249_101522102 206
500 3300009553 Ga0105249_10174470 Ga0105249_101744701 206
501 3300009553 Ga0105249_10880886 Ga0105249_108808861 206
502 3300010375 Ga0105239_10196467 Ga0105239_101964671 206
503 3300010375 Ga0105239_10476447 Ga0105239_104764472 206
504 3300011119 Ga0105246_10080107 Ga0105246_100801072 206
505 3300013100 Ga0157373_10002322 Ga0157373_100023227 206
506 3300013100 Ga0157373_10112898 Ga0157373_101128983 206
507 3300013296 Ga0157374_10281930 Ga0157374_102819302 206
508 3300013297 Ga0157378_10119307 Ga0157378_101193071 206
509 3300013297 Ga0157378_10319762 Ga0157378_103197622 206
510 3300013306 Ga0163162_10003480 Ga0163162_100034809 206
511 3300013306 Ga0163162_10003901 Ga0163162_100039015 206
512 3300013306 Ga0163162_10023609 Ga0163162_100236095 206
513 3300013306 Ga0163162_10207754 Ga0163162_102077543 206
514 3300013306 Ga0163162_10369966 Ga0163162_103699662 206
515 3300013306 Ga0163162_11499426 Ga0163162_114994261 206
516 3300013307 Ga0157372_10543067 Ga0157372_105430671 206
517 3300013307 Ga0157372_10634281 Ga0157372_106342812 206
518 3300013307 Ga0157372_10697949 Ga0157372_106979491 206
519 3300013308 Ga0157375_10011832 Ga0157375_100118323 206
520 3300013308 Ga0157375_10122762 Ga0157375_101227622 206
521 3300013308 Ga0157375_10364736 Ga0157375_103647362 206
522 3300014325 Ga0163163_10000109 Ga0163163_1000010969 206
523 3300014325 Ga0163163_10001737 Ga0163163_1000173715 206
524 3300014325 Ga0163163_10036125 Ga0163163_100361252 206
525 3300014325 Ga0163163_10066690 Ga0163163_100666904 206
526 3300014325 Ga0163163_10348322 Ga0163163_103483222 206
527 3300014325 Ga0163163_10714784 Ga0163163_107147842 206
528 3300014326 Ga0157380_10100489 Ga0157380_101004892 206
529 3300014326 Ga0157380_10201187 Ga0157380_102011872 206
530 3300014326 Ga0157380_10414745 Ga0157380_104147452 206
531 3300014497 Ga0182008_10247148 Ga0182008_102471482 206
532 3300014745 Ga0157377_10006813 Ga0157377_100068135 206
533 3300014745 Ga0157377_10021040 Ga0157377_100210402 206
534 3300014745 Ga0157377_10109144 Ga0157377_101091442 206
535 3300014745 Ga0157377_10336110 Ga0157377_103361102 206
536 3300014968 Ga0157379_10117480 Ga0157379_101174803 206
537 3300014968 Ga0157379_11096170 Ga0157379_110961701 206
538 3300014969 Ga0157376_10283737 Ga0157376_102837371 206
539 3300017792 Ga0163161_10299900 Ga0163161_102999001 206
540 3300025321 Ga0207656_10007353 Ga0207656_100073533 206
541 3300025885 Ga0207653_10008043 Ga0207653_100080432 206
542 3300025899 Ga0207642_10053657 Ga0207642_100536572 206
543 3300025900 Ga0207710_10000832 Ga0207710_1000083212 206
544 3300025900 Ga0207710_10073668 Ga0207710_100736682 206
545 3300025903 Ga0207680_10197115 Ga0207680_101971152 206
546 3300025904 Ga0207647_10017531 Ga0207647_100175318 206
547 3300025907 Ga0207645_10187835 Ga0207645_101878352 206
548 3300025908 Ga0207643_10048397 Ga0207643_100483971 206
549 3300025908 Ga0207643_10057588 Ga0207643_100575882 206
550 3300025908 Ga0207643_10115455 Ga0207643_101154551 206
551 3300025908 Ga0207643_10293395 Ga0207643_102933952 206
552 3300025908 Ga0207643_10298161 Ga0207643_102981612 206
553 3300025910 Ga0207684_10068699 Ga0207684_100686992 206
554 3300025910 Ga0207684_10145844 Ga0207684_101458442 206
555 3300025910 Ga0207684_10258309 Ga0207684_102583091 206
556 3300025911 Ga0207654_10044982 Ga0207654_100449824 206
557 3300025911 Ga0207654_10144411 Ga0207654_101444112 206
558 3300025912 Ga0207707_10000015 Ga0207707_10000015151 206
559 3300025912 Ga0207707_10019734 Ga0207707_100197345 206
560 3300025912 Ga0207707_10027639 Ga0207707_100276395 206
561 3300025912 Ga0207707_10084084 Ga0207707_100840842 206
562 3300025914 Ga0207671_10003690 Ga0207671_100036908 206
563 3300025917 Ga0207660_10005726 Ga0207660_100057266 206
564 3300025917 Ga0207660_10006252 Ga0207660_100062525 206
565 3300025917 Ga0207660_10149062 Ga0207660_101490622 206
566 3300025917 Ga0207660_10256267 Ga0207660_102562672 206
567 3300025918 Ga0207662_10006504 Ga0207662_100065041 206
568 3300025918 Ga0207662_10124583 Ga0207662_101245832 206
569 3300025918 Ga0207662_10190607 Ga0207662_101906072 206
570 3300025919 Ga0207657_10120733 Ga0207657_101207333 206
571 3300025920 Ga0207649_10004830 Ga0207649_100048302 206
572 3300025921 Ga0207652_10000253 Ga0207652_1000025325 206
573 3300025922 Ga0207646_10095640 Ga0207646_100956402 206
574 3300025923 Ga0207681_10474388 Ga0207681_104743882 206
575 3300025924 Ga0207694_10010396 Ga0207694_100103964 206
576 3300025925 Ga0207650_10000009 Ga0207650_1000000972 206
577 3300025925 Ga0207650_10169457 Ga0207650_101694572 206
578 3300025926 Ga0207659_10052425 Ga0207659_100524252 206
579 3300025931 Ga0207644_10010878 Ga0207644_100108782 206
580 3300025931 Ga0207644_10138283 Ga0207644_101382832 206
581 3300025932 Ga0207690_10056520 Ga0207690_100565202 206
582 3300025933 Ga0207706_10406094 Ga0207706_104060942 206
583 3300025934 Ga0207686_10121632 Ga0207686_101216321 206
584 3300025934 Ga0207686_10183059 Ga0207686_101830592 206
585 3300025935 Ga0207709_10004095 Ga0207709_100040954 206
586 3300025935 Ga0207709_10164676 Ga0207709_101646762 206
587 3300025936 Ga0207670_10769264 Ga0207670_107692641 206
588 3300025937 Ga0207669_10151976 Ga0207669_101519762 206
589 3300025940 Ga0207691_10005460 Ga0207691_100054603 206
590 3300025940 Ga0207691_10196613 Ga0207691_101966132 206
591 3300025941 Ga0207711_10010970 Ga0207711_100109707 206
592 3300025941 Ga0207711_10015475 Ga0207711_100154754 206
593 3300025941 Ga0207711_10279676 Ga0207711_102796762 206
594 3300025941 Ga0207711_10411937 Ga0207711_104119372 206
595 3300025942 Ga0207689_10125951 Ga0207689_101259513 206
596 3300025942 Ga0207689_10171397 Ga0207689_101713972 206
597 3300025942 Ga0207689_10687052 Ga0207689_106870522 206
598 3300025945 Ga0207679_10063737 Ga0207679_100637373 206
599 3300025945 Ga0207679_10810794 Ga0207679_108107942 206
600 3300025949 Ga0207667_10119119 Ga0207667_101191194 206
601 3300025960 Ga0207651_10287771 Ga0207651_102877712 206
602 3300025960 Ga0207651_10497533 Ga0207651_104975331 206
603 3300025961 Ga0207712_10015539 Ga0207712_100155394 206
604 3300025961 Ga0207712_10037657 Ga0207712_100376574 206
605 3300025961 Ga0207712_10184263 Ga0207712_101842632 206
606 3300025981 Ga0207640_10030812 Ga0207640_100308122 206
607 3300025981 Ga0207640_10308458 Ga0207640_103084582 206
608 3300025986 Ga0207658_10258637 Ga0207658_102586372 206
609 3300026023 Ga0207677_10310025 Ga0207677_103100251 206
610 3300026035 Ga0207703_10101203 Ga0207703_101012032 206
611 3300026035 Ga0207703_10357415 Ga0207703_103574152 206
612 3300026041 Ga0207639_10170263 Ga0207639_101702632 206
613 3300026041 Ga0207639_10793951 Ga0207639_107939512 206
614 3300026067 Ga0207678_10322868 Ga0207678_103228682 206
615 3300026075 Ga0207708_10032899 Ga0207708_100328992 206
616 3300026075 Ga0207708_10035821 Ga0207708_100358213 206
617 3300026075 Ga0207708_10133653 Ga0207708_101336532 206
618 3300026075 Ga0207708_10201623 Ga0207708_102016232 206
619 3300026075 Ga0207708_10279779 Ga0207708_102797791 206
620 3300026088 Ga0207641_10053459 Ga0207641_100534593 206
621 3300026088 Ga0207641_10110759 Ga0207641_101107592 206
622 3300026088 Ga0207641_10123284 Ga0207641_101232844 206
623 3300026088 Ga0207641_10131881 Ga0207641_101318812 206
624 3300026088 Ga0207641_10708856 Ga0207641_107088562 206
625 3300026088 Ga0207641_11328018 Ga0207641_113280181 206
626 3300026089 Ga0207648_10045328 Ga0207648_100453282 206
627 3300026089 Ga0207648_10122000 Ga0207648_101220002 206
628 3300026089 Ga0207648_10122034 Ga0207648_101220342 206
629 3300026089 Ga0207648_10170744 Ga0207648_101707443 206
630 3300026095 Ga0207676_10010544 Ga0207676_100105442 206
631 3300026095 Ga0207676_10088803 Ga0207676_100888033 206
632 3300026095 Ga0207676_10088868 Ga0207676_100888684 206
633 3300026095 Ga0207676_10834994 Ga0207676_108349941 206
634 3300026116 Ga0207674_10000036 Ga0207674_1000003668 206
635 3300026116 Ga0207674_10088804 Ga0207674_100888042 206
636 3300026116 Ga0207674_10228298 Ga0207674_102282982 206
637 3300026118 Ga0207675_100004763 Ga0207675_1000047633 206
638 3300026118 Ga0207675_100021047 Ga0207675_1000210472 206
639 3300026118 Ga0207675_100349776 Ga0207675_1003497762 206
640 3300026121 Ga0207683_10060668 Ga0207683_100606682 206
641 3300026142 Ga0207698_10118214 Ga0207698_101182142 206
642 3300027907 Ga0207428_10008435 Ga0207428_100084356 206
643 3300028380 Ga0268265_10021396 Ga0268265_100213962 206
644 3300028380 Ga0268265_10029798 Ga0268265_100297982 206
645 3300028380 Ga0268265_10526912 Ga0268265_105269122 206
646 3300028381 Ga0268264_10062557 Ga0268264_100625572 206
647 3300028381 Ga0268264_10121248 Ga0268264_101212484 206
648 3300028381 Ga0268264_10167421 Ga0268264_101674212 206
649 3300028381 Ga0268264_10289706 Ga0268264_102897062 206
650 3300028381 Ga0268264_10371909 Ga0268264_103719091 206
651 3300028381 Ga0268264_10542848 Ga0268264_105428482 206
652 3300031548 Ga0307408_100001243 Ga0307408_1000012436 206
653 3300031548 Ga0307408_100092047 Ga0307408_1000920471 206
654 3300031548 Ga0307408_100463348 Ga0307408_1004633482 206
655 3300031731 Ga0307405_10081512 Ga0307405_100815122 206
656 3300031852 Ga0307410_10023943 Ga0307410_100239432 206
657 3300031852 Ga0307410_10090006 Ga0307410_100900062 206
658 3300031901 Ga0307406_10001021 Ga0307406_100010214 206
659 3300031901 Ga0307406_10414832 Ga0307406_104148322 206
660 3300031903 Ga0307407_10282757 Ga0307407_102827571 206
661 3300031911 Ga0307412_10025475 Ga0307412_100254753 206
662 3300031911 Ga0307412_10045820 Ga0307412_100458204 206
663 3300031911 Ga0307412_10194818 Ga0307412_101948182 206
664 3300031995 Ga0307409_100028349 Ga0307409_1000283494 206
665 3300031995 Ga0307409_100165559 Ga0307409_1001655592 206
666 3300031995 Ga0307409_100178926 Ga0307409_1001789262 206
667 3300032002 Ga0307416_100079110 Ga0307416_1000791102 206
668 3300032002 Ga0307416_100115235 Ga0307416_1001152353 206
669 3300032004 Ga0307414_10000585 Ga0307414_1000058514 206
670 3300032005 Ga0307411_10136405 Ga0307411_101364052 206
671 3300032005 Ga0307411_10187652 Ga0307411_101876522 206
672 3300032126 Ga0307415_100000479 Ga0307415_1000004794 206
673 3300032126 Ga0307415_100311952 Ga0307415_1003119522 206
674 3300034957 Ga0373938_0067568 Ga0373938_0067568_82_750 206
675 3300035091 Ga0373951_0002340 Ga0373951_0002340_4104_4724 206
676 3300035091 Ga0373951_0058889 Ga0373951_0058889_85_705 206
677 3300035115 Ga0373941_0013172 Ga0373941_0013172_808_1428 206
678 3300035207 Ga0373942_0002199 Ga0373942_0002199_1626_2246 206
679 3300035691 Ga0373931_0061976 Ga0373931_0061976_915_1583 206
680 3300037418 Ga0395900_0361786 Ga0395900_0361786_110_793 206
681 3300037466 Ga0395898_0030070 Ga0395898_0030070_2739_3422 206
682 3300037466 Ga0395898_0109812 Ga0395898_0109812_772_1458 206
683 3300038443 Ga0395901_0134830 Ga0395901_0134830_1802_2485 206
684 3300038699 Ga0242422_00508 Ga0242422_00508_1274_1894 206
685 3300042157 Ga0439458_0002105 Ga0439458_0002105_713_1333 206
686 3300042438 Ga0439459_0080726 Ga0439459_0080726_137_757 206
687 3300045051 Ga0451576_0329975 Ga0451576_0329975_645_1265 206
688 3300048905 Ga0496102_0737962 Ga0496102_0737962_95_715 206
689 3300048907 Ga0496104_0351339 Ga0496104_0351339_326_1009 206
690 3300048909 Ga0496106_0064473 Ga0496106_0064473_164_784 206
691 3300048910 Ga0496107_0390484 Ga0496107_0390484_217_960 206
692 3300048913 Ga0496110_0165894 Ga0496110_0165894_431_1051 206
693 3300048914 Ga0496111_0232941 Ga0496111_0232941_447_1067 206
694 3300048915 Ga0496112_0105263 Ga0496112_0105263_1607_2311 206
695 3300048915 Ga0496112_0148038 Ga0496112_0148038_1070_1690 206
696 3300048915 Ga0496112_0223885 Ga0496112_0223885_1006_1626 206
697 3300048915 Ga0496112_0262779 Ga0496112_0262779_1041_1661 206
698 3300048915 Ga0496112_0714713 Ga0496112_0714713_31_651 206
699 3300049515 Ga0501292_025620 Ga0501292_025620_149_880 206
700 3300049519 Ga0501296_001846 Ga0501296_001846_552_1172 206
701 3300049519 Ga0501296_011344 Ga0501296_011344_215_946 206
702 3300049521 Ga0501298_005326 Ga0501298_005326_107_793 206
703 3300049521 Ga0501298_020745 Ga0501298_020745_383_1114 206
704 3300049522 Ga0501299_001169 Ga0501299_001169_65_751 206
705 3300049522 Ga0501299_003968 Ga0501299_003968_600_1334 206
706 3300049574 Ga0501038_0007917 Ga0501038_0007917_5672_6292 206
707 3300049649 Ga0501198_004307 Ga0501198_004307_996_1682 206
708 3300049649 Ga0501198_004796 Ga0501198_004796_498_1229 206
709 3300049651 Ga0501201_003184 Ga0501201_003184_732_1418 206
710 3300049652 Ga0501202_000726 Ga0501202_000726_620_1351 206
711 3300049654 Ga0501207_003365 Ga0501207_003365_335_1066 206
712 3300049655 Ga0501208_020754 Ga0501208_020754_362_1048 206
713 3300049660 Ga0501216_000404 Ga0501216_000404_928_1659 206
714 3300049661 Ga0501217_000501 Ga0501217_000501_4543_5274 206
715 3300049661 Ga0501217_001421 Ga0501217_001421_2592_3278 206
716 3300049663 Ga0501223_001838 Ga0501223_001838_535_1266 206
717 3300049663 Ga0501223_016291 Ga0501223_016291_49_669 206
718 3300049663 Ga0501223_062810 Ga0501223_062810_14_634 206
719 3300049664 Ga0501224_001054 Ga0501224_001054_2569_3300 206
720 3300049664 Ga0501224_006907 Ga0501224_006907_90_710 206
721 3300049664 Ga0501224_018057 Ga0501224_018057_377_997 206
722 3300049665 Ga0501227_018590 Ga0501227_018590_114_845 206
723 3300049667 Ga0501230_052488 Ga0501230_052488_30_656 206
724 3300049668 Ga0501233_008080 Ga0501233_008080_124_744 206
725 3300049668 Ga0501233_023161 Ga0501233_023161_455_1186 206
726 3300049668 Ga0501233_132883 Ga0501233_132883_42_662 206
727 3300049669 Ga0501235_081883 Ga0501235_081883_77_697 206
728 3300049670 Ga0501236_009647 Ga0501236_009647_431_1162 206
729 3300049672 Ga0501239_021443 Ga0501239_021443_45_665 206
730 3300049677 Ga0501247_036223 Ga0501247_036223_56_676 206
731 3300049679 Ga0501249_015470 Ga0501249_015470_567_1187 206
732 3300049679 Ga0501249_071115 Ga0501249_071115_22_648 206
733 3300049686 Ga0501257_009411 Ga0501257_009411_1475_2161 206
734 3300049686 Ga0501257_022771 Ga0501257_022771_661_1392 206
735 3300049688 Ga0501259_010695 Ga0501259_010695_707_1438 206
736 3300049688 Ga0501259_021923 Ga0501259_021923_165_788 206
737 3300049688 Ga0501259_026097 Ga0501259_026097_230_916 206
738 3300049704 Ga0501221_013909 Ga0501221_013909_331_951 206
739 3300049704 Ga0501221_030679 Ga0501221_030679_54_785 206
740 3300049705 Ga0501225_0000268 Ga0501225_0000268_6400_7131 206
741 3300049705 Ga0501225_0016736 Ga0501225_0016736_764_1384 206
742 3300049705 Ga0501225_0021865 Ga0501225_0021865_31_651 206
743 3300049705 Ga0501225_0104743 Ga0501225_0104743_15_635 206
744 3300049706 Ga0501229_002612 Ga0501229_002612_1375_2106 206
745 3300049708 Ga0501245_010927 Ga0501245_010927_142_873 206
746 3300049759 Ga0501262_025378 Ga0501262_025378_115_735 206
747 3300049765 Ga0501268_022068 Ga0501268_022068_331_951 206
748 3300049770 Ga0501273_017449 Ga0501273_017449_53_784 206
749 3300049771 Ga0501274_003906 Ga0501274_003906_539_1159 206
750 3300049775 Ga0501279_016223 Ga0501279_016223_157_777 206
751 3300049851 Ga0501212_012785 Ga0501212_012785_516_1214 206
752 3300049853 Ga0501226_011791 Ga0501226_011791_33_653 206
753 3300050507 nmdc:mga05p37_154084_c1 nmdc:mga05p37_154084_c1_480_1100 206
754 3300050507 nmdc:mga05p37_196792_c1 nmdc:mga05p37_196792_c1_1330_1950 206
755 3300050507 nmdc:mga05p37_250717_c1 nmdc:mga05p37_250717_c1_109_729 206
756 3300050507 nmdc:mga05p37_571766_c1 nmdc:mga05p37_571766_c1_525_1193 206
757 3300050507 nmdc:mga05p37_72456_c1 nmdc:mga05p37_72456_c1_3282_3902 206
758 3300050508 nmdc:mga09592_227502_c1 nmdc:mga09592_227502_c1_591_1211 206
759 3300050508 nmdc:mga09592_40904_c1 nmdc:mga09592_40904_c1_1296_1916 206
760 3300050509 nmdc:mga0qj67_291008_c1 nmdc:mga0qj67_291008_c1_85_705 206
761 3300050509 nmdc:mga0qj67_29879_c1 nmdc:mga0qj67_29879_c1_819_1505 206
762 3300050510 nmdc:mga06r32_25661_c1 nmdc:mga06r32_25661_c1_3358_4044 206
763 3300050510 nmdc:mga06r32_46784_c1 nmdc:mga06r32_46784_c1_1789_2409 206
764 3300050511 nmdc:mga08y16_34486_c1 nmdc:mga08y16_34486_c1_3177_3797 206
765 3300050511 nmdc:mga08y16_358652_c1 nmdc:mga08y16_358652_c1_557_1177 206
766 3300050511 nmdc:mga08y16_605681_c1 nmdc:mga08y16_605681_c1_333_1001 206
767 3300050511 nmdc:mga08y16_720465_c1 nmdc:mga08y16_720465_c1_150_770 206
768 3300050512 nmdc:mga0n895_1020706_c1 nmdc:mga0n895_1020706_c1_114_734 206
769 3300050512 nmdc:mga0n895_160092_c1 nmdc:mga0n895_160092_c1_1613_2233 206
770 3300050512 nmdc:mga0n895_236378_c1 nmdc:mga0n895_236378_c1_61_681 206
771 3300050513 nmdc:mga0rr50_190895_c1 nmdc:mga0rr50_190895_c1_208_828 206
772 3300050514 nmdc:mga08x19_8914_c1 nmdc:mga08x19_8914_c1_4709_5413 206
773 3300050515 nmdc:mga0a205_12578_c1 nmdc:mga0a205_12578_c1_1775_2395 206
774 3300050515 nmdc:mga0a205_175881_c1 nmdc:mga0a205_175881_c1_943_1563 206
775 3300050515 nmdc:mga0a205_63313_c1 nmdc:mga0a205_63313_c1_2371_2991 206
776 3300050515 nmdc:mga0a205_641779_c1 nmdc:mga0a205_641779_c1_204_824 206
777 3300054114 Ga0501084_0510789 Ga0501084_0510789_360_980 206
778 3300061734 Ga0530510_0313794 Ga0530510_0313794_274_894 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

34

239

0.97

PF00398

RrnaAD

Ribosomal RNA adenine dimethylase

89

196

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jg3-assembly1.cif.gz_A crystal structure of l-isoaspartyl (d-aspartyl) o-methyltransferase with adenosine & vyp(isp)ha substrate 0.9725 2 204
4o29-assembly1.cif.gz_A protein-l-isoaspartate o-methyltransferase from pyrobaculum aerophilum in complex with s-adenosyl-l-homocysteine 0.9671 2 198
2yxe-assembly1.cif.gz_B crystal structure of l-isoaspartyl protein carboxyl methyltranferase 0.9621 2 204
3lbf-assembly4.cif.gz_D crystal structure of protein l-isoaspartyl methyltransferase from escherichia coli 0.9593 2 203
4l7v-assembly1.cif.gz_A crystal structure of protein l-isoaspartyl-o-methyltransferase of vibrio cholerae 0.9547 2 203
ID Description Score Start End Superfamily
1jg3A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9725 2 204 3.40.50.150
4o29A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9671 2 198 3.40.50.150
4l7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9547 2 203 3.40.50.150
1jg3A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.954 2 204 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9507 66 123 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7V9C9T6-F1-model_v4 Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) 1 1 104 GO:0004719
GO:0005737
GO:0032259
GO:0036211
AF-A0A2V8QNU0-F1-model_v4 Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) 0.9959 49 206 GO:0004719
GO:0005737
GO:0030091
GO:0032259
GO:0036211
AF-A0A536YMJ3-F1-model_v4 Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) 0.9926 13 107 GO:0004719
GO:0005737
GO:0032259
GO:0036211
AF-A0A7V9C9T6-F1-model_v4 Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) 0.9905 1 104 GO:0004719
GO:0005737
GO:0032259
GO:0036211
AF-A0A531KNU9-F1-model_v4 Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) 0.9903 13 135 GO:0004719
GO:0005737
GO:0032259
GO:0036211

Feature Viewer

pLDDT pTM Quality
94.64 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map