F480421

General Info

Members Datasets Scaffolds Average Seq Length
778 494 1554 442

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_041877|Ga0400483_041877_7623_8924
Length 433
Sequence MIPICRKGLEMVTECIDTLVVGGGQAGLAMSEHLGHCGLPHLVLERHRIAERWRSERWDSLVANGPAWHDRFPSLSFADLDPDAFASKEQVADYFVAYAEKIRAPIRCGVEVTAVHRNVGRPGFHVETSAGVLEANSIVAATGPFQRPIIPAVIPEDAGVLQLHSNSYRNPDQLPDGAVMVIGAGSSGTQIADELLKADRHVYLSVGPHERPPRSYRGRDFVWWLGVLGKWDAQAVPGNEHVTIAVSGAYGGRTVDFRRFASDGMTLVGMTTAFEDGVLTFAPDLSDNLLKGDANYLSLLDEADSWVARNGVDLPEEPEARKIGPDLDCVTDPILELDLAKAGVTSIIWATGYALDYSWLKVDVFDETGRPKHLRGITSEPGVYFLGLPWLSRRGSSFIWGVWHDAKYLAEHILTQRRYLDYRPSSERLTETA

Samples

Sample ID Description Type Environment
1 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
18 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
26 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
92 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
124 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
125 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
174 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
175 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
180 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
181 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
182 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
183 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
196 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
197 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
198 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
199 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
200 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
201 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
202 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
203 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
204 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
205 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
206 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
207 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
208 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
209 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
210 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
211 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
212 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
213 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
214 3300044668 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 Metagenome Unclassified
215 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
216 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
217 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
218 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
224 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
225 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
226 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
227 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
228 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
231 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
232 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
233 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
234 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
235 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
236 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
237 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
238 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
239 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
240 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
241 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
242 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
243 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
244 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
245 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
246 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
247 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
248 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
249 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
250 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
251 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
252 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
253 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
254 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
255 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
256 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
257 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
258 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
259 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
260 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
261 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
262 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
263 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
264 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
265 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
268 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
269 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
270 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
271 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
272 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
273 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
274 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
275 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
276 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
277 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
278 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
279 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
280 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
281 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
282 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
283 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
284 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
285 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
286 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
287 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
288 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
289 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
290 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
291 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
292 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
293 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
294 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
295 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
298 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
299 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
300 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
301 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
302 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
303 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
304 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
305 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
306 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
307 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
308 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
309 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
310 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
315 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
317 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
318 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
319 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
322 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
323 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
324 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
325 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
326 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
327 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
328 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
329 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
330 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
331 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
332 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
333 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
334 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
335 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
336 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
337 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
342 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
343 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
344 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
345 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
346 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
347 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
348 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
349 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
350 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
351 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
352 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
353 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
354 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
355 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
356 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
357 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
358 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
359 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
360 2511231006 Pseudomonas sp. GM17 Isolate Nodule
361 2511231012 Pseudomonas sp. GM33 Isolate Nodule
362 2511231014 Pseudomonas sp. GM48 Isolate Nodule
363 2511231015 Pseudomonas sp. GM49 Isolate Nodule
364 2511231017 Pseudomonas sp. GM55 Isolate Nodule
365 2511231024 Pseudomonas sp. GM84 Isolate Nodule
366 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
367 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
368 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
369 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
370 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
371 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
372 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
373 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
374 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
375 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
376 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
377 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
378 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
379 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
380 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
381 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
382 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
383 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
384 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
385 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
386 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
387 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
388 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
389 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
390 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
391 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
392 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
393 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
394 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
395 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
396 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
397 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
398 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
399 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
400 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
401 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
402 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
403 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
404 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
405 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
406 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
407 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
408 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
409 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
410 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
411 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
412 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
413 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
414 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
415 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
416 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
417 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
418 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
419 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
420 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
421 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
422 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
423 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
424 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
425 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
426 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
427 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
428 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
429 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
430 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
431 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
432 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
433 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
434 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
435 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
436 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
437 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
438 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
439 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
440 2765235841 Pseudomonas putida AA7 Isolate Unclassified
441 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
442 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
443 2818991450 Burkholderia sp. 604 Isolate Unclassified
444 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
445 2818991467 Bosea vestrisii 3192 Isolate Unclassified
446 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
447 2841760612 Bosea sp. Tri-49 Isolate Nodule
448 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
449 2844104063 Bosea sp. Tri-39 Isolate Nodule
450 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
451 2851182111 Bosea sp. Tri-44 Isolate Nodule
452 2851246043 Bosea sp. Tri-54 Isolate Nodule
453 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
454 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
455 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
456 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
457 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
458 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
459 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
460 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
461 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
462 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
463 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
464 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
465 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
466 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
467 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
468 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
469 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
470 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
471 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
472 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
473 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
474 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
475 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
476 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
477 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
478 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
479 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
480 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
481 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
482 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
483 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
484 8052494512 Pseudomonas putida LD6 Isolate Unclassified
485 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
486 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
487 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
488 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
489 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
490 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
491 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
492 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
493 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
494 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.65
Metatranscriptomes 0
Isolates 17.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.81
Nodule 2.83
Rhizoplane 11.18
Rhizosphere 67.61
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400483_041877 3300039062 Bacteria 34809
2 JGI24746J21847_1003957 3300001977 Bacteria 2342
3 JGI24740J21852_10006063 3300001979 Bacteria 5051
4 JGI24737J22298_10013202 3300001990 Bacteria 2690
5 JGI24737J22298_10039550 3300001990 Bacteria 1450
6 JGI24743J22301_10000421 3300001991 Bacteria 4790
7 JGI24735J21928_10002925 3300002067 Bacteria 5878
8 JGI24750J21931_1001280 3300002070 Bacteria 3164
9 JGI24745J21846_1001208 3300002073 Bacteria 2483
10 JGI24738J21930_10001734 3300002075 Bacteria 5953
11 JGI24744J21845_10008151 3300002077 Bacteria 2163
12 JGI24742J22300_10001199 3300002244 Bacteria 4044
13 JGI24742J22300_10001931 3300002244 Bacteria 3300
14 JGI25156J39149_1003681 3300002705 Bacteria 4922
15 JGI25165J46597_1003563 3300003214 Bacteria 3793
16 rootH2_10164091 3300003320 Bacteria 4273
17 rootH1_10079884 3300003323 Bacteria 4471
18 JGI25160J50197_1000074 3300003354 Bacteria 103621
19 Ga0055532_1000055 3300003758 Bacteria 160192
20 Ga0055527_1000030 3300003760 Bacteria 160175
21 Ga0055535_1000038 3300003761 Bacteria 160192
22 Ga0055542_1000063 3300003762 Bacteria 160175
23 Ga0055529_1000071 3300003763 Bacteria 160192
24 Ga0055536_1000005 3300003781 Bacteria 383598
25 Ga0055530_10000001 3300003791 Bacteria 383067
26 Ga0055530_10000010 3300003791 Bacteria 173678
27 Ga0055540_1000032 3300003792 Bacteria 173678
28 Ga0055540_1000302 3300003792 Bacteria 43687
29 Ga0058692_1000019 3300003856 Bacteria 255580
30 JGI25405J52794_10004334 3300003911 Bacteria 2533
31 Ga0065165_1000203 3300005262 Bacteria 103001
32 Ga0065714_10002248 3300005288 Bacteria 43256
33 Ga0065714_10064945 3300005288 Bacteria 15037
34 Ga0065704_10070688 3300005289 Bacteria 17694
35 Ga0065704_10071534 3300005289 Bacteria 10781
36 Ga0065704_10109989 3300005289 Bacteria 1990
37 Ga0070676_10016591 3300005328 Bacteria 4074
38 Ga0070683_100051572 3300005329 Bacteria 3810
39 Ga0070690_100010937 3300005330 Bacteria 5297
40 Ga0070670_100009595 3300005331 Bacteria 8262
41 Ga0070666_10042579 3300005335 Bacteria 3039
42 Ga0068868_100015551 3300005338 Bacteria 5631
43 Ga0070660_100065552 3300005339 Bacteria 2827
44 Ga0070689_100028520 3300005340 Bacteria 4220
45 Ga0070668_100009592 3300005347 Bacteria 7182
46 Ga0070669_100053441 3300005353 Bacteria 2957
47 Ga0070675_100013869 3300005354 Bacteria 6345
48 Ga0070671_100011227 3300005355 Bacteria 7193
49 Ga0070674_100014955 3300005356 Bacteria 4834
50 Ga0070688_100019453 3300005365 Bacteria 3934
51 Ga0070659_100071300 3300005366 Bacteria 2762
52 Ga0070709_10005215 3300005434 Bacteria 7030
53 Ga0070714_100061846 3300005435 Bacteria 3217
54 Ga0070714_100079053 3300005435 Bacteria 2859
55 Ga0070713_100031683 3300005436 Bacteria 4214
56 Ga0070713_100113703 3300005436 Bacteria 2363
57 Ga0070710_10012053 3300005437 Bacteria 4286
58 Ga0070701_10001423 3300005438 Bacteria 8853
59 Ga0070711_100028536 3300005439 Bacteria 3673
60 Ga0070700_100008861 3300005441 Bacteria 5499
61 Ga0070700_100010540 3300005441 Bacteria 5107
62 Ga0070694_100070101 3300005444 Bacteria 2413
63 Ga0070663_100002501 3300005455 Bacteria 10363
64 Ga0070678_100008276 3300005456 Bacteria 6223
65 Ga0070662_100012754 3300005457 Bacteria 5579
66 Ga0068867_100007616 3300005459 Bacteria 7660
67 Ga0070685_10007639 3300005466 Bacteria 5534
68 Ga0070699_100208548 3300005518 Bacteria 1739
69 Ga0070679_100005369 3300005530 Bacteria 11863
70 Ga0070684_100030158 3300005535 Bacteria 4605
71 Ga0068853_100025612 3300005539 Bacteria 4952
72 Ga0070672_100006768 3300005543 Bacteria 7735
73 Ga0070686_100005658 3300005544 Bacteria 6923
74 Ga0070695_100000364 3300005545 Bacteria 23264
75 Ga0070695_100124363 3300005545 Bacteria 1769
76 Ga0070696_100155597 3300005546 Bacteria 1681
77 Ga0070665_100043548 3300005548 Bacteria 4511
78 Ga0070704_100073824 3300005549 Bacteria 2486
79 Ga0070664_100025638 3300005564 Bacteria 4889
80 Ga0068854_100009238 3300005578 Bacteria 6361
81 Ga0068856_100024569 3300005614 Bacteria 5866
82 Ga0068856_100041039 3300005614 Bacteria 4547
83 Ga0070702_100001573 3300005615 Bacteria 9412
84 Ga0068852_100014188 3300005616 Bacteria 6122
85 Ga0068864_100049998 3300005618 Bacteria 3597
86 Ga0068866_10009395 3300005718 Bacteria 4150
87 Ga0068861_100019624 3300005719 Bacteria 4829
88 Ga0068858_100006444 3300005842 Bacteria 11425
89 Ga0068860_100106238 3300005843 Bacteria 2681
90 Ga0068862_100022743 3300005844 Bacteria 5245
91 Ga0081455_10000267 3300005937 Bacteria 68735
92 Ga0081455_10006568 3300005937 Bacteria 12443
93 Ga0081540_1000112 3300005983 Bacteria 86810
94 Ga0070717_10061237 3300006028 Bacteria 3118
95 Ga0075365_10007165 3300006038 Bacteria 6225
96 Ga0075365_10035116 3300006038 Bacteria 3242
97 Ga0075365_10085149 3300006038 Bacteria 2147
98 Ga0075364_10048505 3300006051 Bacteria 2767
99 Ga0075364_10052453 3300006051 Bacteria 2665
100 Ga0070712_100014994 3300006175 Bacteria 4982
101 Ga0070712_100028461 3300006175 Bacteria 3738
102 Ga0075367_10010601 3300006178 Bacteria 4847
103 Ga0075369_10000288 3300006186 Bacteria 14920
104 Ga0097621_100027571 3300006237 Bacteria 4468
105 Ga0075431_100090167 3300006847 Bacteria 3164
106 Ga0075429_100191679 3300006880 Bacteria 1791
107 Ga0068865_100017353 3300006881 Bacteria 4629
108 Ga0099823_1000017 3300006944 Bacteria 86474
109 Ga0079104_1000142 3300006946 Bacteria 101403
110 Ga0105251_10001555 3300009011 Bacteria 19680
111 Ga0105251_10005237 3300009011 Bacteria 8548
112 Ga0105244_10000533 3300009036 Bacteria 33932
113 Ga0105244_10027896 3300009036 Bacteria 3036
114 Ga0105250_10019558 3300009092 Bacteria 2738
115 Ga0105250_10038125 3300009092 Bacteria 1927
116 Ga0105247_10003622 3300009101 Bacteria 10026
117 Ga0114129_10079616 3300009147 Bacteria 4555
118 Ga0105243_10001355 3300009148 Bacteria 21785
119 Ga0105242_10015599 3300009176 Bacteria 5902
120 Ga0105242_10139519 3300009176 Bacteria 2102
121 Ga0105248_10016058 3300009177 Bacteria 8241
122 Ga0105239_10026087 3300010375 Bacteria 6433
123 Ga0105246_10013460 3300011119 Bacteria 5130
124 Ga0157373_10000596 3300013100 Bacteria 28045
125 Ga0157369_10019522 3300013105 Bacteria 7585
126 Ga0157369_10034475 3300013105 Bacteria 5555
127 Ga0157369_10225172 3300013105 Bacteria 1962
128 Ga0157374_10016711 3300013296 Bacteria 6455
129 Ga0157378_10030047 3300013297 Bacteria 4800
130 Ga0163162_10001693 3300013306 Bacteria 20666
131 Ga0163162_10173097 3300013306 Bacteria 2283
132 Ga0157375_10080621 3300013308 Bacteria 3293
133 Ga0157375_10117551 3300013308 Bacteria 2764
134 Ga0163163_10006553 3300014325 Bacteria 10196
135 Ga0157380_10011237 3300014326 Bacteria 6464
136 Ga0182008_10001892 3300014497 Bacteria 13592
137 Ga0182008_10063286 3300014497 Bacteria 1822
138 Ga0157379_10013761 3300014968 Bacteria 7091
139 Ga0157379_10037566 3300014968 Bacteria 4319
140 Ga0157376_10011473 3300014969 Bacteria 6533
141 Ga0157376_10105282 3300014969 Bacteria 2473
142 Ga0182007_10001645 3300015262 Bacteria 11820
143 Ga0182007_10002722 3300015262 Bacteria 8650
144 Ga0163161_10042591 3300017792 Bacteria 3266
145 Ga0209674_100022 3300025226 Bacteria 563656
146 Ga0209672_100001 3300025228 Bacteria 2828210
147 Ga0209147_100001 3300025229 Bacteria 2384371
148 Ga0209563_100893 3300025230 Bacteria 8829
149 Ga0207427_101241 3300025231 Bacteria 9781
150 Ga0209258_100001 3300025242 Bacteria 2384269
151 Ga0209148_1000003 3300025254 Bacteria 2384288
152 Ga0209759_1000030 3300025256 Bacteria 285649
153 Ga0209759_1000099 3300025256 Bacteria 156332
154 Ga0209233_1000180 3300025261 Bacteria 140304
155 Ga0209455_1000001 3300025272 Bacteria 2384278
156 Ga0209130_1016248 3300025284 Bacteria 1807
157 Ga0209676_1000003 3300025292 Bacteria 1454178
158 Ga0209676_1005269 3300025292 Bacteria 6832
159 Ga0209676_1005579 3300025292 Bacteria 6507
160 Ga0209564_1011663 3300025295 Bacteria 3912
161 Ga0209050_1000004 3300025298 Bacteria 1600040
162 Ga0209050_1000043 3300025298 Bacteria 398654
163 Ga0209050_1000973 3300025298 Bacteria 36681
164 Ga0207426_1000018 3300025302 Bacteria 566740
165 Ga0207426_1001166 3300025302 Bacteria 23536
166 Ga0209051_1000006 3300025303 Bacteria 1015785
167 Ga0209051_1000030 3300025303 Bacteria 398654
168 Ga0209051_1013437 3300025303 Bacteria 3896
169 Ga0209257_1007357 3300025304 Bacteria 6673
170 Ga0207696_1000006 3300025711 Bacteria 616498
171 Ga0207655_1000143 3300025728 Bacteria 137102
172 Ga0207655_1000338 3300025728 Bacteria 68161
173 Ga0207713_1001164 3300025735 Bacteria 22239
174 Ga0207713_1002903 3300025735 Bacteria 12004
175 Ga0207713_1008002 3300025735 Bacteria 6147
176 Ga0207692_10016197 3300025898 Bacteria 3295
177 Ga0207642_10008029 3300025899 Bacteria 3599
178 Ga0207688_10004354 3300025901 Bacteria 7719
179 Ga0207647_10011975 3300025904 Bacteria 6055
180 Ga0207647_10012058 3300025904 Bacteria 6033
181 Ga0207647_10032556 3300025904 Bacteria 3347
182 Ga0207647_10036104 3300025904 Bacteria 3143
183 Ga0207685_10036809 3300025905 Bacteria 1797
184 Ga0207699_10011719 3300025906 Bacteria 4438
185 Ga0207643_10007264 3300025908 Bacteria 5944
186 Ga0207693_10022861 3300025915 Bacteria 4964
187 Ga0207693_10030879 3300025915 Bacteria 4232
188 Ga0207663_10089077 3300025916 Bacteria 2042
189 Ga0207657_10100233 3300025919 Bacteria 2405
190 Ga0207652_10005052 3300025921 Bacteria 10698
191 Ga0207681_10017265 3300025923 Bacteria 4530
192 Ga0207650_10071105 3300025925 Bacteria 2617
193 Ga0207659_10014933 3300025926 Bacteria 5021
194 Ga0207664_10008313 3300025929 Bacteria 7230
195 Ga0207664_10097964 3300025929 Bacteria 2417
196 Ga0207644_10033171 3300025931 Bacteria 3606
197 Ga0207690_10091224 3300025932 Bacteria 2153
198 Ga0207706_10012640 3300025933 Bacteria 7684
199 Ga0207686_10016005 3300025934 Bacteria 4203
200 Ga0207670_10035383 3300025936 Bacteria 3238
201 Ga0207669_10033283 3300025937 Bacteria 2906
202 Ga0207704_10004528 3300025938 Bacteria 6356
203 Ga0207665_10042356 3300025939 Bacteria 3043
204 Ga0207691_10014772 3300025940 Bacteria 7442
205 Ga0207711_10014213 3300025941 Bacteria 6611
206 Ga0207679_10016229 3300025945 Bacteria 4941
207 Ga0207651_10019781 3300025960 Bacteria 4045
208 Ga0207712_10096174 3300025961 Bacteria 2191
209 Ga0207640_10016683 3300025981 Bacteria 4279
210 Ga0207658_10070802 3300025986 Bacteria 2639
211 Ga0207677_10048065 3300026023 Bacteria 2870
212 Ga0207703_10010891 3300026035 Bacteria 7090
213 Ga0207678_10006648 3300026067 Bacteria 10249
214 Ga0207678_10022319 3300026067 Bacteria 5545
215 Ga0207678_10026376 3300026067 Bacteria 5070
216 Ga0207708_10006078 3300026075 Bacteria 8954
217 Ga0207708_10019143 3300026075 Bacteria 5157
218 Ga0207648_10012751 3300026089 Bacteria 7854
219 Ga0207676_10005094 3300026095 Bacteria 9301
220 Ga0207683_10013468 3300026121 Bacteria 6977
221 Ga0209281_1000262 3300027111 Bacteria 101417
222 Ga0209389_1000022 3300027296 Bacteria 166756
223 Ga0209371_1000107 3300027312 Bacteria 141889
224 Ga0207428_10050389 3300027907 Bacteria 3332
225 Ga0268266_10035207 3300028379 Bacteria 4259
226 Ga0268265_10061763 3300028380 Bacteria 2876
227 Ga0307517_10000111 3300028786 Bacteria 120304
228 Ga0307515_10046410 3300028794 Bacteria 6641
229 Ga0265338_10003493 3300028800 Bacteria 22062
230 Ga0268256_1000093 3300030500 Bacteria 141889
231 Ga0316181_1183171 3300030744 Bacteria 2037
232 Ga0307408_100000145 3300031548 Bacteria 79041
233 Ga0307408_100046947 3300031548 Bacteria 3090
234 Ga0307408_100073272 3300031548 Bacteria 2537
235 Ga0307516_10150830 3300031730 Bacteria 2085
236 Ga0307405_10000291 3300031731 Bacteria 18543
237 Ga0307405_10009505 3300031731 Bacteria 4989
238 Ga0307406_10027418 3300031901 Bacteria 3432
239 Ga0307406_10057341 3300031901 Bacteria 2497
240 Ga0307412_10000005 3300031911 Bacteria 526194
241 Ga0307412_10007665 3300031911 Bacteria 6130
242 Ga0307412_10010708 3300031911 Bacteria 5287
243 Ga0307414_10050104 3300032004 Bacteria 2891
244 Ga0373931_0003897 3300035691 Bacteria 6749
245 Ga0373931_0034414 3300035691 Bacteria 2629
246 Ga0373935_0168719 3300035692 Bacteria 1496
247 Ga0373947_0036194 3300035725 Bacteria 2926
248 Ga0395900_0006518 3300037418 Bacteria 12165
249 Ga0395905_0000009 3300037471 Bacteria 488729
250 Ga0395905_0030642 3300037471 Bacteria 5066
251 Ga0436361_0797715 3300039447 Bacteria 3959
252 Ga0439436_0000760 3300041404 Bacteria 8719
253 Ga0439438_000077 3300041405 Bacteria 45928
254 Ga0439438_000205 3300041405 Bacteria 26994
255 Ga0439438_000478 3300041405 Bacteria 18095
256 Ga0439438_001753 3300041405 Bacteria 9537
257 Ga0439438_007129 3300041405 Bacteria 3854
258 Ga0439447_001669 3300041407 Bacteria 8142
259 Ga0439447_006219 3300041407 Bacteria 3892
260 Ga0439447_019459 3300041407 Bacteria 1809
261 Ga0439466_0000298 3300041411 Bacteria 19175
262 Ga0439466_0003539 3300041411 Bacteria 6040
263 Ga0439466_0004779 3300041411 Bacteria 5205
264 Ga0439431_0000286 3300041997 Bacteria 10408
265 Ga0439445_0008906 3300042004 Bacteria 2357
266 Ga0439432_000501 3300042006 Bacteria 14592
267 Ga0439432_000669 3300042006 Bacteria 12808
268 Ga0439432_002222 3300042006 Bacteria 7324
269 Ga0439452_000545 3300042010 Bacteria 20077
270 Ga0439452_003624 3300042010 Bacteria 5373
271 Ga0439456_000198 3300042013 Bacteria 17189
272 Ga0439463_010663 3300042016 Bacteria 2258
273 Ga0450920_001704 3300042122 Bacteria 3681
274 Ga0450922_002292 3300042124 Bacteria 1808
275 Ga0450900_002383 3300042136 Bacteria 1986
276 Ga0450905_000290 3300042142 Bacteria 5970
277 Ga0450905_005302 3300042142 Bacteria 1730
278 Ga0450907_004974 3300042146 Bacteria 2259
279 Ga0450910_000104 3300042147 Bacteria 8733
280 Ga0439446_0005473 3300042156 Bacteria 3269
281 Ga0439446_0009121 3300042156 Bacteria 2648
282 Ga0439434_0000582 3300042435 Bacteria 10554
283 Ga0466980_0087328 3300044668 Bacteria 2155
284 Ga0466966_0105704 3300044684 Bacteria 1738
285 Ga0466961_0060643 3300044693 Bacteria 2405
286 Ga0466963_0048622 3300044694 Bacteria 2803
287 Ga0466958_0003984 3300045836 Bacteria 7741
288 Ga0466967_0004373 3300045976 Bacteria 9513
289 Ga0495627_016432 3300046453 Bacteria 2533
290 Ga0495592_0000540 3300046454 Bacteria 26898
291 Ga0495603_0010734 3300046455 Bacteria 5555
292 Ga0495603_0014564 3300046455 Bacteria 4756
293 Ga0495603_0030246 3300046455 Bacteria 3262
294 Ga0495590_0000173 3300046457 Bacteria 37961
295 Ga0495591_006982 3300046458 Bacteria 4879
296 Ga0495591_011221 3300046458 Bacteria 3408
297 Ga0495629_0000021 3300046459 Bacteria 153700
298 Ga0495629_0005414 3300046459 Bacteria 9519
299 Ga0495629_0058252 3300046459 Bacteria 2701
300 Ga0495629_0089121 3300046459 Bacteria 2152
301 Ga0495638_0000818 3300046460 Bacteria 32787
302 Ga0495638_0001452 3300046460 Bacteria 21411
303 Ga0495638_0081749 3300046460 Bacteria 1960
304 Ga0495641_0009924 3300046461 Bacteria 5599
305 Ga0495651_0000634 3300046462 Bacteria 27128
306 Ga0495651_0049764 3300046462 Bacteria 3235
307 Ga0495651_0130271 3300046462 Bacteria 1837
308 Ga0495653_0001686 3300046463 Bacteria 17392
309 Ga0495653_0017779 3300046463 Bacteria 5782
310 Ga0495650_0000802 3300046471 Bacteria 38263
311 Ga0495650_0004910 3300046471 Bacteria 8937
312 Ga0495650_0008048 3300046471 Bacteria 6223
313 Ga0495650_0040493 3300046471 Bacteria 1999
314 Ga0495580_0001969 3300046472 Bacteria 18030
315 Ga0495580_0035368 3300046472 Bacteria 3592
316 Ga0495580_0059392 3300046472 Bacteria 2687
317 Ga0495580_0185596 3300046472 Bacteria 1435
318 Ga0495582_0002684 3300046473 Bacteria 9933
319 Ga0495582_0033125 3300046473 Bacteria 2840
320 Ga0495605_0000631 3300046474 Bacteria 27198
321 Ga0495605_0003631 3300046474 Bacteria 9154
322 Ga0495605_0015442 3300046474 Bacteria 4153
323 Ga0495605_0015835 3300046474 Bacteria 4094
324 Ga0495605_0021044 3300046474 Bacteria 3459
325 Ga0495605_0039728 3300046474 Bacteria 2355
326 Ga0495664_0002835 3300046477 Bacteria 9328
327 Ga0495584_0012579 3300046491 Bacteria 4320
328 Ga0495585_0017241 3300046492 Bacteria 4175
329 Ga0495596_0005767 3300046500 Bacteria 5807
330 Ga0495596_0017879 3300046500 Bacteria 2929
331 Ga0495607_0019759 3300046501 Bacteria 4273
332 Ga0495607_0020975 3300046501 Bacteria 4116
333 Ga0495607_0036849 3300046501 Bacteria 2943
334 Ga0495583_0006414 3300046506 Bacteria 7696
335 Ga0495583_0017734 3300046506 Bacteria 3771
336 Ga0495606_0011345 3300046507 Bacteria 7278
337 Ga0495606_0014179 3300046507 Bacteria 6238
338 Ga0495606_0108218 3300046507 Bacteria 1680
339 Ga0495608_0017679 3300046511 Bacteria 4930
340 Ga0495608_0025251 3300046511 Bacteria 4055
341 Ga0495608_0099325 3300046511 Bacteria 1877
342 Ga0495610_0006250 3300046512 Bacteria 8255
343 Ga0495610_0031385 3300046512 Bacteria 2772
344 Ga0495610_0047283 3300046512 Bacteria 2117
345 Ga0495616_0038021 3300046513 Bacteria 2473
346 Ga0495616_0087856 3300046513 Bacteria 1476
347 Ga0495618_0002049 3300046514 Bacteria 13240
348 Ga0495618_0006692 3300046514 Bacteria 6983
349 Ga0495618_0047648 3300046514 Bacteria 2705
350 Ga0495620_0000049 3300046515 Bacteria 106184
351 Ga0495620_0007091 3300046515 Bacteria 6108
352 Ga0495620_0035011 3300046515 Bacteria 2263
353 Ga0495628_0005251 3300046516 Bacteria 11357
354 Ga0495628_0041625 3300046516 Bacteria 3667
355 Ga0495628_0068225 3300046516 Bacteria 2776
356 Ga0495628_0095772 3300046516 Bacteria 2293
357 Ga0495630_0005335 3300046517 Bacteria 9069
358 Ga0495630_0041198 3300046517 Bacteria 3449
359 Ga0495630_0053519 3300046517 Bacteria 3022
360 Ga0495630_0098335 3300046517 Bacteria 2213
361 Ga0495631_0011273 3300046518 Bacteria 4401
362 Ga0495631_0040034 3300046518 Bacteria 2077
363 Ga0495632_0001635 3300046519 Bacteria 18359
364 Ga0495632_0029125 3300046519 Bacteria 2877
365 Ga0495637_0014279 3300046520 Bacteria 3748
366 Ga0495637_0037726 3300046520 Bacteria 2096
367 Ga0495643_0000150 3300046522 Bacteria 113560
368 Ga0495643_0000152 3300046522 Bacteria 112556
369 Ga0495648_0000512 3300046524 Bacteria 41742
370 Ga0495648_0001151 3300046524 Bacteria 26757
371 Ga0495648_0001307 3300046524 Bacteria 24712
372 Ga0495648_0002230 3300046524 Bacteria 18114
373 Ga0495648_0017829 3300046524 Bacteria 5059
374 Ga0495648_0030698 3300046524 Bacteria 3549
375 Ga0495648_0070177 3300046524 Bacteria 2036
376 Ga0495663_0006737 3300046525 Bacteria 3167
377 Ga0495666_0001792 3300046526 Bacteria 10606
378 Ga0495666_0032789 3300046526 Bacteria 2541
379 Ga0495642_0000018 3300046528 Bacteria 108992
380 Ga0495642_0003020 3300046528 Bacteria 6701
381 Ga0495642_0023145 3300046528 Bacteria 2451
382 Ga0495652_0002504 3300046529 Bacteria 18842
383 Ga0495652_0010089 3300046529 Bacteria 8562
384 Ga0495652_0022094 3300046529 Bacteria 5650
385 Ga0495652_0045902 3300046529 Bacteria 3753
386 Ga0495654_0005855 3300046530 Bacteria 7073
387 Ga0495654_0010556 3300046530 Bacteria 5024
388 Ga0495654_0063330 3300046530 Bacteria 1771
389 Ga0495665_0005136 3300046531 Bacteria 7059
390 Ga0495665_0014631 3300046531 Bacteria 4229
391 Ga0495640_0006890 3300046533 Bacteria 8953
392 Ga0495640_0007879 3300046533 Bacteria 8376
393 Ga0495640_0068759 3300046533 Bacteria 2382
394 Ga0495586_0008468 3300046535 Bacteria 5471
395 Ga0495587_0001383 3300046536 Bacteria 16134
396 Ga0495587_0004029 3300046536 Bacteria 9733
397 Ga0495598_0004821 3300046537 Bacteria 2948
398 Ga0495609_0018083 3300046538 Bacteria 3270
399 Ga0495621_0002709 3300046539 Bacteria 4803
400 Ga0495597_0003302 3300046542 Bacteria 9526
401 Ga0495597_0019360 3300046542 Bacteria 3187
402 Ga0495645_0000185 3300046543 Bacteria 44326
403 Ga0495645_0000915 3300046543 Bacteria 20101
404 Ga0495645_0002683 3300046543 Bacteria 12082
405 Ga0495645_0031865 3300046543 Bacteria 3843
406 Ga0495622_0029051 3300046557 Bacteria 2583
407 Ga0495633_0040476 3300046558 Bacteria 2220
408 Ga0495667_0000478 3300046559 Bacteria 25490
409 Ga0495667_0150581 3300046559 Bacteria 1498
410 Ga0495656_0004523 3300046615 Bacteria 4764
411 Ga0495668_0018231 3300046616 Bacteria 4057
412 Ga0495634_0019812 3300046642 Bacteria 4775
413 Ga0495611_0012584 3300046648 Bacteria 3597
414 Ga0495625_0002789 3300046660 Bacteria 18426
415 Ga0495625_0015327 3300046660 Bacteria 6073
416 Ga0495635_0003126 3300046663 Bacteria 11393
417 Ga0495635_0020412 3300046663 Bacteria 4615
418 Ga0495635_0026786 3300046663 Bacteria 4009
419 Ga0495659_0005148 3300046664 Bacteria 4110
420 Ga0495661_0010888 3300046665 Bacteria 6184
421 Ga0495661_0014156 3300046665 Bacteria 5343
422 Ga0495661_0029634 3300046665 Bacteria 3491
423 Ga0495661_0034164 3300046665 Bacteria 3201
424 Ga0495661_0064731 3300046665 Bacteria 2156
425 Ga0495588_0016206 3300046674 Bacteria 3599
426 Ga0495588_0033450 3300046674 Bacteria 2596
427 Ga0495588_0039356 3300046674 Bacteria 2408
428 Ga0495588_0060742 3300046674 Bacteria 1956
429 Ga0495657_0021079 3300046675 Bacteria 4680
430 Ga0495599_0000393 3300046678 Bacteria 25011
431 Ga0495599_0001328 3300046678 Bacteria 14099
432 Ga0495599_0016484 3300046678 Bacteria 4587
433 Ga0495623_0066583 3300046679 Bacteria 2250
434 Ga0495646_0001386 3300046680 Bacteria 14391
435 Ga0495646_0003248 3300046680 Bacteria 10106
436 Ga0495647_0025214 3300046681 Bacteria 2171
437 Ga0495669_0011297 3300046684 Bacteria 3790
438 Ga0495669_0015442 3300046684 Bacteria 3270
439 Ga0495669_0016633 3300046684 Bacteria 3151
440 Ga0495669_0041866 3300046684 Bacteria 2035
441 Ga0495624_0000502 3300046690 Bacteria 30600
442 Ga0495624_0001403 3300046690 Bacteria 18799
443 Ga0495624_0003505 3300046690 Bacteria 11628
444 Ga0495624_0005612 3300046690 Bacteria 9005
445 Ga0495670_0006291 3300046691 Bacteria 5828
446 Ga0495670_0007833 3300046691 Bacteria 5254
447 Ga0495670_0011244 3300046691 Bacteria 4400
448 Ga0495671_0070646 3300046692 Bacteria 1715
449 Ga0495649_0002230 3300046694 Bacteria 13787
450 Ga0495649_0007336 3300046694 Bacteria 6735
451 Ga0495649_0009131 3300046694 Bacteria 5911
452 Ga0495649_0019540 3300046694 Bacteria 3806
453 Ga0495649_0030957 3300046694 Bacteria 2952
454 Ga0495649_0051664 3300046694 Bacteria 2229
455 Ga0495589_0000297 3300046794 Bacteria 39517
456 Ga0495589_0001321 3300046794 Bacteria 14561
457 Ga0495589_0002558 3300046794 Bacteria 10112
458 Ga0495589_0002597 3300046794 Bacteria 10026
459 Ga0495589_0034515 3300046794 Bacteria 2539
460 Ga0495589_0039173 3300046794 Bacteria 2369
461 Ga0495600_0005652 3300046809 Bacteria 7554
462 Ga0495660_0096651 3300046810 Bacteria 1526
463 Ga0495581_0001554 3300047315 Bacteria 12820
464 Ga0495581_0002420 3300047315 Bacteria 10543
465 Ga0495604_0000506 3300047317 Bacteria 34325
466 Ga0495604_0004171 3300047317 Bacteria 11459
467 Ga0495604_0017237 3300047317 Bacteria 5779
468 Ga0495604_0020374 3300047317 Bacteria 5297
469 Ga0495604_0041178 3300047317 Bacteria 3623
470 Ga0495674_0000598 3300047319 Bacteria 33806
471 Ga0495674_0003504 3300047319 Bacteria 15272
472 Ga0495674_0004116 3300047319 Bacteria 14040
473 Ga0495674_0010682 3300047319 Bacteria 8688
474 Ga0495674_0013144 3300047319 Bacteria 7784
475 Ga0495674_0026139 3300047319 Bacteria 5343
476 Ga0495674_0149556 3300047319 Bacteria 1959
477 Ga0495672_0000995 3300047320 Bacteria 29252
478 Ga0495672_0009422 3300047320 Bacteria 7078
479 Ga0495672_0064952 3300047320 Bacteria 2087
480 Ga0495676_0040911 3300047321 Bacteria 3821
481 Ga0495680_0000911 3300047322 Bacteria 32800
482 Ga0495680_0005885 3300047322 Bacteria 11474
483 Ga0495680_0006126 3300047322 Bacteria 11223
484 Ga0495680_0098230 3300047322 Bacteria 2185
485 Ga0495683_0000578 3300047323 Bacteria 27719
486 Ga0495683_0004864 3300047323 Bacteria 7522
487 Ga0495683_0004934 3300047323 Bacteria 7462
488 Ga0495683_0011729 3300047323 Bacteria 4609
489 Ga0495683_0012413 3300047323 Bacteria 4471
490 Ga0495683_0015219 3300047323 Bacteria 4005
491 Ga0495687_000114 3300047443 Bacteria 123531
492 Ga0495687_007776 3300047443 Bacteria 6242
493 Ga0495687_063451 3300047443 Bacteria 1512
494 Ga0495675_0004036 3300047444 Bacteria 8900
495 Ga0495675_0009198 3300047444 Bacteria 6144
496 Ga0495675_0022001 3300047444 Bacteria 4063
497 Ga0495675_0040907 3300047444 Bacteria 2954
498 Ga0495675_0086698 3300047444 Bacteria 1968
499 Ga0495675_0114195 3300047444 Bacteria 1684
500 Ga0495679_000012 3300047446 Bacteria 319098
501 Ga0495679_000836 3300047446 Bacteria 19590
502 Ga0495679_004336 3300047446 Bacteria 6571
503 Ga0495679_015762 3300047446 Bacteria 2753
504 Ga0495673_0026010 3300047469 Bacteria 2804
505 Ga0495673_0034564 3300047469 Bacteria 2336
506 Ga0495673_0068346 3300047469 Bacteria 1501
507 Ga0495681_0003640 3300047470 Bacteria 10704
508 Ga0495681_0011184 3300047470 Bacteria 5366
509 Ga0495681_0030030 3300047470 Bacteria 2774
510 Ga0495681_0031279 3300047470 Bacteria 2696
511 Ga0495681_0048281 3300047470 Bacteria 2019
512 Ga0495684_0000969 3300047471 Bacteria 23399
513 Ga0495686_0000521 3300047472 Bacteria 55487
514 Ga0495686_0018124 3300047472 Bacteria 4730
515 Ga0495593_0009033 3300047673 Bacteria 5783
516 Ga0495593_0026620 3300047673 Bacteria 3191
517 Ga0495593_0027863 3300047673 Bacteria 3106
518 Ga0495593_0030637 3300047673 Bacteria 2942
519 Ga0495593_0031128 3300047673 Bacteria 2916
520 Ga0495593_0082075 3300047673 Bacteria 1666
521 Ga0495602_0000273 3300048088 Bacteria 47682
522 Ga0495602_0004510 3300048088 Bacteria 14524
523 Ga0495602_0004558 3300048088 Bacteria 14460
524 Ga0495602_0004974 3300048088 Bacteria 13929
525 Ga0495602_0033840 3300048088 Bacteria 4788
526 Ga0495614_0000622 3300048089 Bacteria 14840
527 Ga0495626_0004861 3300048091 Bacteria 8085
528 Ga0495626_0013344 3300048091 Bacteria 4270
529 Ga0496100_0001296 3300048903 Bacteria 12196
530 Ga0496100_0004901 3300048903 Bacteria 7151
531 Ga0496100_0025693 3300048903 Bacteria 3603
532 Ga0496100_0069957 3300048903 Bacteria 2339
533 Ga0496101_0015807 3300048904 Bacteria 5093
534 Ga0496102_0014994 3300048905 Bacteria 6744
535 Ga0496102_0018472 3300048905 Bacteria 6128
536 Ga0496102_0027819 3300048905 Bacteria 5049
537 Ga0496102_0180066 3300048905 Bacteria 1991
538 Ga0496103_0001506 3300048906 Bacteria 15592
539 Ga0496103_0002319 3300048906 Bacteria 12038
540 Ga0496103_0003909 3300048906 Bacteria 9064
541 Ga0496104_0005724 3300048907 Bacteria 10878
542 Ga0496104_0012985 3300048907 Bacteria 7497
543 Ga0496105_0050485 3300048908 Bacteria 3435
544 Ga0496105_0058801 3300048908 Bacteria 3172
545 Ga0496105_0100338 3300048908 Bacteria 2390
546 Ga0496106_0012171 3300048909 Bacteria 6349
547 Ga0496106_0032504 3300048909 Bacteria 3890
548 Ga0496107_0034310 3300048910 Bacteria 3634
549 Ga0496108_0053788 3300048911 Bacteria 3377
550 Ga0496109_0011072 3300048912 Bacteria 7733
551 Ga0496109_0024446 3300048912 Bacteria 5371
552 Ga0496110_0005740 3300048913 Bacteria 9751
553 Ga0496110_0279893 3300048913 Bacteria 1519
554 Ga0496111_0008124 3300048914 Bacteria 6932
555 Ga0496112_0010241 3300048915 Bacteria 8500
556 Ga0496112_0018946 3300048915 Bacteria 6487
557 Ga0496113_0005752 3300048916 Bacteria 7770
558 Ga0496113_0011172 3300048916 Bacteria 5976
559 Ga0496114_0005479 3300048917 Bacteria 9932
560 Ga0496114_0009118 3300048917 Bacteria 7865
561 Ga0496114_0129077 3300048917 Bacteria 2181
562 Ga0496114_0137211 3300048917 Bacteria 2115
563 Ga0496114_0234788 3300048917 Bacteria 1612
564 Ga0496115_0006489 3300048918 Bacteria 8574
565 Ga0496116_0000010 3300048919 Bacteria 665608
566 Ga0496116_0011474 3300048919 Bacteria 7326
567 Ga0496116_0013858 3300048919 Bacteria 6472
568 Ga0496117_0000756 3300048920 Bacteria 50927
569 Ga0496117_0001866 3300048920 Bacteria 28433
570 Ga0496117_0003110 3300048920 Bacteria 19816
571 Ga0496117_0003258 3300048920 Bacteria 19091
572 Ga0496117_0008340 3300048920 Bacteria 9855
573 Ga0496117_0011069 3300048920 Bacteria 8118
574 Ga0496117_0055674 3300048920 Bacteria 2761
575 Ga0496117_0103935 3300048920 Bacteria 1789
576 Ga0496118_0000206 3300048921 Bacteria 104093
577 Ga0496118_0002783 3300048921 Bacteria 22896
578 Ga0496118_0006743 3300048921 Bacteria 12502
579 Ga0496118_0008980 3300048921 Bacteria 10196
580 Ga0496118_0011627 3300048921 Bacteria 8561
581 Ga0496118_0018771 3300048921 Bacteria 6212
582 Ga0496118_0045403 3300048921 Bacteria 3430
583 Ga0496118_0094889 3300048921 Bacteria 2038
584 Ga0496121_0000050 3300048924 Bacteria 318295
585 Ga0496121_0002508 3300048924 Bacteria 27906
586 Ga0496121_0007922 3300048924 Bacteria 12702
587 Ga0496121_0015933 3300048924 Bacteria 7807
588 Ga0496121_0049333 3300048924 Bacteria 3570
589 Ga0496122_0008015 3300048925 Bacteria 11538
590 Ga0496122_0014275 3300048925 Bacteria 7694
591 Ga0496122_0061763 3300048925 Bacteria 2747
592 Ga0496122_0079065 3300048925 Bacteria 2300
593 Ga0496123_0000609 3300048926 Bacteria 60290
594 Ga0496123_0000899 3300048926 Bacteria 47084
595 Ga0496123_0109304 3300048926 Bacteria 1584
596 Ga0496124_0004118 3300048927 Bacteria 17182
597 Ga0496124_0007907 3300048927 Bacteria 11201
598 Ga0496124_0045196 3300048927 Bacteria 3776
599 Ga0496124_0045232 3300048927 Bacteria 3775
600 Ga0496124_0049493 3300048927 Bacteria 3585
601 Ga0496124_0059566 3300048927 Bacteria 3207
602 Ga0496125_0000080 3300048928 Bacteria 228514
603 Ga0496125_0000459 3300048928 Bacteria 73809
604 Ga0496125_0004691 3300048928 Bacteria 15574
605 Ga0496125_0007581 3300048928 Bacteria 11524
606 Ga0496125_0008583 3300048928 Bacteria 10671
607 Ga0496125_0048648 3300048928 Bacteria 3533
608 Ga0496126_0000503 3300048929 Bacteria 76786
609 Ga0496126_0020710 3300048929 Bacteria 6440
610 Ga0496126_0037650 3300048929 Bacteria 4511
611 Ga0496126_0051165 3300048929 Bacteria 3762
612 Ga0496126_0210218 3300048929 Bacteria 1638
613 Ga0495678_020403 3300049459 Bacteria 2935
614 Ga0495682_0003186 3300049460 Bacteria 7374
615 Ga0495682_0031538 3300049460 Bacteria 1958
616 Ga0501032_0063633 3300049569 Bacteria 2469
617 Ga0501033_0002856 3300049570 Bacteria 14476
618 Ga0501034_0000685 3300049571 Bacteria 51551
619 Ga0501036_0002276 3300049572 Bacteria 15014
620 Ga0501072_0045789 3300049588 Bacteria 3441
621 Ga0501079_0030568 3300049741 Bacteria 4139
622 Ga0501080_0023846 3300049742 Bacteria 5671
623 Ga0501081_0039894 3300049743 Bacteria 3214
624 Ga0501035_0029657 3300049822 Bacteria 4989
625 nmdc:mga03683_32334_c1 3300050489 Bacteria 2104
626 nmdc:mga03683_42876_c1 3300050489 Bacteria 1864
627 nmdc:mga00v17_106376_c1 3300050491 Bacteria 1776
628 nmdc:mga00v17_14281_c1 3300050491 Bacteria 4429
629 nmdc:mga0yw44_3670_c1 3300050492 Bacteria 5999
630 nmdc:mga0k408_3964_c1 3300050493 Bacteria 7849
631 nmdc:mga05p37_103183_c1 3300050507 Bacteria 3511
632 nmdc:mga05p37_196115_c1 3300050507 Bacteria 2448
633 nmdc:mga09592_223293_c1 3300050508 Bacteria 1632
634 nmdc:mga08y16_147247_c1 3300050511 Bacteria 2448
635 nmdc:mga0sz30_445_c1 3300050516 Bacteria 15645
636 nmdc:mga0sz30_855_c1 3300050516 Bacteria 6127
637 Ga0495612_0030435 3300053078 Bacteria 2174
638 Ga0495595_0004083 3300053084 Bacteria 5850
639 Ga0495619_0019786 3300053085 Bacteria 4283
640 Ga0500651_0014279 3300053093 Bacteria 4858
641 Ga0500659_0000721 3300053135 Bacteria 21335
642 Ga0501082_0019055 3300060353 Bacteria 5912
643 2511265040 2511231006 Bacteria 6794709
644 2511302701 2511231012 Bacteria 6738011
645 2511314092 2511231014 Bacteria 6462302
646 2511320591 2511231015 Bacteria 6598026
647 2511333303 2511231017 Bacteria 6503007
648 2511373517 2511231024 Bacteria 5835885
649 2511825795 2511231156 Bacteria 6845832
650 2512328907 2512047018 Bacteria 6663241
651 2513557385 2513237082 Bacteria 8640282
652 2513562994 2513237083 Bacteria 8410967
653 2514053757 2513237166 Bacteria 10373764
654 2515690032 2515154123 Bacteria 6387382
655 2555247146 2554235231 Bacteria 5215788
656 2555670512 2554235341 Bacteria 6867980
657 2563064952 2562617112 Bacteria 10918404
658 2583792295 2582580891 Bacteria 6800976
659 2597858406 2597489887 Bacteria 6666321
660 2599352462 2599185160 Bacteria 6844013
661 2599358811 2599185161 Bacteria 6960462
662 2599365668 2599185162 Bacteria 6957254
663 2599371454 2599185163 Bacteria 6995158
664 2599383703 2599185164 Bacteria 6841688
665 2599385053 2599185165 Bacteria 6843250
666 2599390363 2599185166 Bacteria 6959206
667 2599402497 2599185168 Bacteria 6997636
668 2599465188 2599185181 Bacteria 6844519
669 2599466415 2599185182 Bacteria 6883168
670 2599486382 2599185185 Bacteria 6652270
671 2599488316 2599185186 Bacteria 6831633
672 2599500629 2599185188 Bacteria 6164180
673 2599612012 2599185212 Bacteria 6765997
674 2599769083 2599185248 Bacteria 6696816
675 2599803005 2599185257 Bacteria 6492581
676 2599888327 2599185289 Bacteria 6778765
677 2599895945 2599185291 Bacteria 6775623
678 2599932293 2599185300 Bacteria 6062622
679 2599944266 2599185302 Bacteria 5954930
680 2599954738 2599185304 Bacteria 5951361
681 2599957829 2599185305 Bacteria 6748700
682 2599966818 2599185306 Bacteria 6637356
683 2599978098 2599185308 Bacteria 6621546
684 2599985680 2599185309 Bacteria 5969593
685 2599991528 2599185310 Bacteria 6014457
686 2599992448 2599185311 Bacteria 6354990
687 2600002523 2599185312 Bacteria 5912071
688 2600004077 2599185313 Bacteria 6658188
689 2600012176 2599185314 Bacteria 6621749
690 2600015553 2599185315 Bacteria 6771107
691 2600023264 2599185316 Bacteria 6320029
692 2600030872 2599185317 Bacteria 6435722
693 2600038311 2599185318 Bacteria 6961590
694 2600044437 2599185319 Bacteria 6637840
695 2600050171 2599185320 Bacteria 5963263
696 2600050761 2599185321 Bacteria 6764560
697 2600058864 2599185322 Bacteria 6763055
698 2600067963 2599185323 Bacteria 6688755
699 2600072718 2599185324 Bacteria 6590677
700 2600077012 2599185325 Bacteria 6324919
701 2600211897 2599185356 Bacteria 6843884
702 2600360676 2600254930 Bacteria 6431253
703 2600362747 2600254931 Bacteria 6734225
704 2601772065 2600255313 Bacteria 6842543
705 2643956730 2643221589 Bacteria 6250934
706 2644021953 2643221602 Bacteria 6249926
707 2644283987 2643221650 Bacteria 7029547
708 2671088637 2667528170 Bacteria 6786960
709 2671096012 2667528171 Bacteria 6900659
710 2671125129 2667528176 Bacteria 6724917
711 2671769373 2671180172 Bacteria 6495783
712 2678263692 2675903515 Bacteria 6580491
713 2687577311 2687453129 Bacteria 4387428
714 2713482058 2711768613 Bacteria 11048459
715 2738835561 2738541298 Bacteria 7286732
716 2738877258 2738541306 Bacteria 7284992
717 2739188964 2738543002 Bacteria 7284546
718 2739223851 2738543008 Bacteria 7282815
719 2743737857 2740892503 Bacteria 6855563
720 2745010023 2744054620 Bacteria 6551379
721 2746087612 2744054900 Bacteria 8399525
722 2746098886 2744054901 Bacteria 8397047
723 2765583638 2765235841 Bacteria 6137024
724 2794597162 2791355520 Bacteria 5948615
725 2808941756 2808606379 Bacteria 5022697
726 2819623984 2818991450 Bacteria 6962147
727 2819700553 2818991464 Bacteria 6907494
728 2819719192 2818991467 Bacteria 5893227
729 2825651925 2825651385 Bacteria 6715909
730 2841765903 2841760612 Bacteria 6454112
731 2842858269 2842854478 Bacteria 6143501
732 2844107513 2844104063 Bacteria 6440972
733 2844671122 2844665904 Bacteria 6817974
734 2851187424 2851182111 Bacteria 6047226
735 2851249553 2851246043 Bacteria 6439203
736 2900634470 2900634093 Bacteria 10263517
737 2904485628 2904483920 Bacteria 7545285
738 2904552097 2904550169 Bacteria 6221258
739 2912966446 2912963787 Bacteria 5646108
740 2913039496 2913036834 Bacteria 6704877
741 2917074340 2917070673 Bacteria 6868303
742 2919485481 2919481497 Bacteria 6907839
743 2919533792 2919527303 Bacteria 7718827
744 2921644375 2921643360 Bacteria 11448031
745 2923156904 2923153595 Bacteria 6870622
746 2923586324 2923586266 Bacteria 6565975
747 2928109552 2928108538 Bacteria 7360024
748 2928136994 2928135762 Bacteria 7259641
749 2928506522 2928503688 Bacteria 7268108
750 2929147153 2929144301 Bacteria 6622272
751 2931369506 2931369376 Bacteria 6847892
752 2935355596 2935353572 Unclassified 6955622
753 2939640029 2939636861 Bacteria 6297853
754 2939651865 2939651529 Bacteria 5895393
755 2945936058 2945934425 Bacteria 7444609
756 2984289194 2984286254 Bacteria 6702062
757 2990710037 2990703756 Bacteria 7715990
758 3007255783 3007252601 Bacteria 4559114
759 3007396321 3007395558 Bacteria 6755444
760 3007869060 3007866637 Bacteria 5899198
761 637320865 637000220 Bacteria 7074893
762 642422576 641736151 Bacteria 7477263
763 642597748 642555112 Bacteria 8676562
764 642621924 642555113 Bacteria 8214658
765 8003955869 8003955200 Bacteria 8601927
766 8015691149 8015687852 Bacteria 6613826
767 8052496839 8052494512 Bacteria 5765634
768 8054931538 8054929484 Bacteria 5599761
769 8055303176 8055301274 Bacteria 8587385
770 8055774287 8055770955 Bacteria 6827675
771 8055882690 8055878733 Bacteria 5907058
772 8056119046 8056115690 Bacteria 5527654
773 8056123851 8056120720 Bacteria 5758328
774 8056129512 8056125926 Bacteria 6228218
775 8056140724 8056137416 Bacteria 6147080
776 8056146089 8056143049 Bacteria 6307666
777 8057163704 8057160832 Bacteria 3268302
778 Ga0400483_041877
779 JGI24746J21847_1003957
780 JGI24740J21852_10006063
781 JGI24737J22298_10013202
782 JGI24737J22298_10039550
783 JGI24743J22301_10000421
784 JGI24735J21928_10002925
785 JGI24750J21931_1001280
786 JGI24745J21846_1001208
787 JGI24738J21930_10001734
788 JGI24744J21845_10008151
789 JGI24742J22300_10001199
790 JGI24742J22300_10001931
791 JGI25156J39149_1003681
792 JGI25165J46597_1003563
793 rootH2_10164091
794 rootH1_10079884
795 JGI25160J50197_1000074
796 Ga0055532_1000055
797 Ga0055527_1000030
798 Ga0055535_1000038
799 Ga0055542_1000063
800 Ga0055529_1000071
801 Ga0055536_1000005
802 Ga0055530_10000001
803 Ga0055530_10000010
804 Ga0055540_1000032
805 Ga0055540_1000302
806 Ga0058692_1000019
807 JGI25405J52794_10004334
808 Ga0065165_1000203
809 Ga0065714_10002248
810 Ga0065714_10064945
811 Ga0065704_10070688
812 Ga0065704_10071534
813 Ga0065704_10109989
814 Ga0070676_10016591
815 Ga0070683_100051572
816 Ga0070690_100010937
817 Ga0070670_100009595
818 Ga0070666_10042579
819 Ga0068868_100015551
820 Ga0070660_100065552
821 Ga0070689_100028520
822 Ga0070668_100009592
823 Ga0070669_100053441
824 Ga0070675_100013869
825 Ga0070671_100011227
826 Ga0070674_100014955
827 Ga0070688_100019453
828 Ga0070659_100071300
829 Ga0070709_10005215
830 Ga0070714_100061846
831 Ga0070714_100079053
832 Ga0070713_100031683
833 Ga0070713_100113703
834 Ga0070710_10012053
835 Ga0070701_10001423
836 Ga0070711_100028536
837 Ga0070700_100008861
838 Ga0070700_100010540
839 Ga0070694_100070101
840 Ga0070663_100002501
841 Ga0070678_100008276
842 Ga0070662_100012754
843 Ga0068867_100007616
844 Ga0070685_10007639
845 Ga0070699_100208548
846 Ga0070679_100005369
847 Ga0070684_100030158
848 Ga0068853_100025612
849 Ga0070672_100006768
850 Ga0070686_100005658
851 Ga0070695_100000364
852 Ga0070695_100124363
853 Ga0070696_100155597
854 Ga0070665_100043548
855 Ga0070704_100073824
856 Ga0070664_100025638
857 Ga0068854_100009238
858 Ga0068856_100024569
859 Ga0068856_100041039
860 Ga0070702_100001573
861 Ga0068852_100014188
862 Ga0068864_100049998
863 Ga0068866_10009395
864 Ga0068861_100019624
865 Ga0068858_100006444
866 Ga0068860_100106238
867 Ga0068862_100022743
868 Ga0081455_10000267
869 Ga0081455_10006568
870 Ga0081540_1000112
871 Ga0070717_10061237
872 Ga0075365_10007165
873 Ga0075365_10035116
874 Ga0075365_10085149
875 Ga0075364_10048505
876 Ga0075364_10052453
877 Ga0070712_100014994
878 Ga0070712_100028461
879 Ga0075367_10010601
880 Ga0075369_10000288
881 Ga0097621_100027571
882 Ga0075431_100090167
883 Ga0075429_100191679
884 Ga0068865_100017353
885 Ga0099823_1000017
886 Ga0079104_1000142
887 Ga0105251_10001555
888 Ga0105251_10005237
889 Ga0105244_10000533
890 Ga0105244_10027896
891 Ga0105250_10019558
892 Ga0105250_10038125
893 Ga0105247_10003622
894 Ga0114129_10079616
895 Ga0105243_10001355
896 Ga0105242_10015599
897 Ga0105242_10139519
898 Ga0105248_10016058
899 Ga0105239_10026087
900 Ga0105246_10013460
901 Ga0157373_10000596
902 Ga0157369_10019522
903 Ga0157369_10034475
904 Ga0157369_10225172
905 Ga0157374_10016711
906 Ga0157378_10030047
907 Ga0163162_10001693
908 Ga0163162_10173097
909 Ga0157375_10080621
910 Ga0157375_10117551
911 Ga0163163_10006553
912 Ga0157380_10011237
913 Ga0182008_10001892
914 Ga0182008_10063286
915 Ga0157379_10013761
916 Ga0157379_10037566
917 Ga0157376_10011473
918 Ga0157376_10105282
919 Ga0182007_10001645
920 Ga0182007_10002722
921 Ga0163161_10042591
922 Ga0209674_100022
923 Ga0209672_100001
924 Ga0209147_100001
925 Ga0209563_100893
926 Ga0207427_101241
927 Ga0209258_100001
928 Ga0209148_1000003
929 Ga0209759_1000030
930 Ga0209759_1000099
931 Ga0209233_1000180
932 Ga0209455_1000001
933 Ga0209130_1016248
934 Ga0209676_1000003
935 Ga0209676_1005269
936 Ga0209676_1005579
937 Ga0209564_1011663
938 Ga0209050_1000004
939 Ga0209050_1000043
940 Ga0209050_1000973
941 Ga0207426_1000018
942 Ga0207426_1001166
943 Ga0209051_1000006
944 Ga0209051_1000030
945 Ga0209051_1013437
946 Ga0209257_1007357
947 Ga0207696_1000006
948 Ga0207655_1000143
949 Ga0207655_1000338
950 Ga0207713_1001164
951 Ga0207713_1002903
952 Ga0207713_1008002
953 Ga0207692_10016197
954 Ga0207642_10008029
955 Ga0207688_10004354
956 Ga0207647_10011975
957 Ga0207647_10012058
958 Ga0207647_10032556
959 Ga0207647_10036104
960 Ga0207685_10036809
961 Ga0207699_10011719
962 Ga0207643_10007264
963 Ga0207693_10022861
964 Ga0207693_10030879
965 Ga0207663_10089077
966 Ga0207657_10100233
967 Ga0207652_10005052
968 Ga0207681_10017265
969 Ga0207650_10071105
970 Ga0207659_10014933
971 Ga0207664_10008313
972 Ga0207664_10097964
973 Ga0207644_10033171
974 Ga0207690_10091224
975 Ga0207706_10012640
976 Ga0207686_10016005
977 Ga0207670_10035383
978 Ga0207669_10033283
979 Ga0207704_10004528
980 Ga0207665_10042356
981 Ga0207691_10014772
982 Ga0207711_10014213
983 Ga0207679_10016229
984 Ga0207651_10019781
985 Ga0207712_10096174
986 Ga0207640_10016683
987 Ga0207658_10070802
988 Ga0207677_10048065
989 Ga0207703_10010891
990 Ga0207678_10006648
991 Ga0207678_10022319
992 Ga0207678_10026376
993 Ga0207708_10006078
994 Ga0207708_10019143
995 Ga0207648_10012751
996 Ga0207676_10005094
997 Ga0207683_10013468
998 Ga0209281_1000262
999 Ga0209389_1000022
1000 Ga0209371_1000107
1001 Ga0207428_10050389
1002 Ga0268266_10035207
1003 Ga0268265_10061763
1004 Ga0307517_10000111
1005 Ga0307515_10046410
1006 Ga0265338_10003493
1007 Ga0268256_1000093
1008 Ga0316181_1183171
1009 Ga0307408_100000145
1010 Ga0307408_100046947
1011 Ga0307408_100073272
1012 Ga0307516_10150830
1013 Ga0307405_10000291
1014 Ga0307405_10009505
1015 Ga0307406_10027418
1016 Ga0307406_10057341
1017 Ga0307412_10000005
1018 Ga0307412_10007665
1019 Ga0307412_10010708
1020 Ga0307414_10050104
1021 Ga0373931_0003897
1022 Ga0373931_0034414
1023 Ga0373935_0168719
1024 Ga0373947_0036194
1025 Ga0395900_0006518
1026 Ga0395905_0000009
1027 Ga0395905_0030642
1028 Ga0436361_0797715
1029 Ga0439436_0000760
1030 Ga0439438_000077
1031 Ga0439438_000205
1032 Ga0439438_000478
1033 Ga0439438_001753
1034 Ga0439438_007129
1035 Ga0439447_001669
1036 Ga0439447_006219
1037 Ga0439447_019459
1038 Ga0439466_0000298
1039 Ga0439466_0003539
1040 Ga0439466_0004779
1041 Ga0439431_0000286
1042 Ga0439445_0008906
1043 Ga0439432_000501
1044 Ga0439432_000669
1045 Ga0439432_002222
1046 Ga0439452_000545
1047 Ga0439452_003624
1048 Ga0439456_000198
1049 Ga0439463_010663
1050 Ga0450920_001704
1051 Ga0450922_002292
1052 Ga0450900_002383
1053 Ga0450905_000290
1054 Ga0450905_005302
1055 Ga0450907_004974
1056 Ga0450910_000104
1057 Ga0439446_0005473
1058 Ga0439446_0009121
1059 Ga0439434_0000582
1060 Ga0466980_0087328
1061 Ga0466966_0105704
1062 Ga0466961_0060643
1063 Ga0466963_0048622
1064 Ga0466958_0003984
1065 Ga0466967_0004373
1066 Ga0495627_016432
1067 Ga0495592_0000540
1068 Ga0495603_0010734
1069 Ga0495603_0014564
1070 Ga0495603_0030246
1071 Ga0495590_0000173
1072 Ga0495591_006982
1073 Ga0495591_011221
1074 Ga0495629_0000021
1075 Ga0495629_0005414
1076 Ga0495629_0058252
1077 Ga0495629_0089121
1078 Ga0495638_0000818
1079 Ga0495638_0001452
1080 Ga0495638_0081749
1081 Ga0495641_0009924
1082 Ga0495651_0000634
1083 Ga0495651_0049764
1084 Ga0495651_0130271
1085 Ga0495653_0001686
1086 Ga0495653_0017779
1087 Ga0495650_0000802
1088 Ga0495650_0004910
1089 Ga0495650_0008048
1090 Ga0495650_0040493
1091 Ga0495580_0001969
1092 Ga0495580_0035368
1093 Ga0495580_0059392
1094 Ga0495580_0185596
1095 Ga0495582_0002684
1096 Ga0495582_0033125
1097 Ga0495605_0000631
1098 Ga0495605_0003631
1099 Ga0495605_0015442
1100 Ga0495605_0015835
1101 Ga0495605_0021044
1102 Ga0495605_0039728
1103 Ga0495664_0002835
1104 Ga0495584_0012579
1105 Ga0495585_0017241
1106 Ga0495596_0005767
1107 Ga0495596_0017879
1108 Ga0495607_0019759
1109 Ga0495607_0020975
1110 Ga0495607_0036849
1111 Ga0495583_0006414
1112 Ga0495583_0017734
1113 Ga0495606_0011345
1114 Ga0495606_0014179
1115 Ga0495606_0108218
1116 Ga0495608_0017679
1117 Ga0495608_0025251
1118 Ga0495608_0099325
1119 Ga0495610_0006250
1120 Ga0495610_0031385
1121 Ga0495610_0047283
1122 Ga0495616_0038021
1123 Ga0495616_0087856
1124 Ga0495618_0002049
1125 Ga0495618_0006692
1126 Ga0495618_0047648
1127 Ga0495620_0000049
1128 Ga0495620_0007091
1129 Ga0495620_0035011
1130 Ga0495628_0005251
1131 Ga0495628_0041625
1132 Ga0495628_0068225
1133 Ga0495628_0095772
1134 Ga0495630_0005335
1135 Ga0495630_0041198
1136 Ga0495630_0053519
1137 Ga0495630_0098335
1138 Ga0495631_0011273
1139 Ga0495631_0040034
1140 Ga0495632_0001635
1141 Ga0495632_0029125
1142 Ga0495637_0014279
1143 Ga0495637_0037726
1144 Ga0495643_0000150
1145 Ga0495643_0000152
1146 Ga0495648_0000512
1147 Ga0495648_0001151
1148 Ga0495648_0001307
1149 Ga0495648_0002230
1150 Ga0495648_0017829
1151 Ga0495648_0030698
1152 Ga0495648_0070177
1153 Ga0495663_0006737
1154 Ga0495666_0001792
1155 Ga0495666_0032789
1156 Ga0495642_0000018
1157 Ga0495642_0003020
1158 Ga0495642_0023145
1159 Ga0495652_0002504
1160 Ga0495652_0010089
1161 Ga0495652_0022094
1162 Ga0495652_0045902
1163 Ga0495654_0005855
1164 Ga0495654_0010556
1165 Ga0495654_0063330
1166 Ga0495665_0005136
1167 Ga0495665_0014631
1168 Ga0495640_0006890
1169 Ga0495640_0007879
1170 Ga0495640_0068759
1171 Ga0495586_0008468
1172 Ga0495587_0001383
1173 Ga0495587_0004029
1174 Ga0495598_0004821
1175 Ga0495609_0018083
1176 Ga0495621_0002709
1177 Ga0495597_0003302
1178 Ga0495597_0019360
1179 Ga0495645_0000185
1180 Ga0495645_0000915
1181 Ga0495645_0002683
1182 Ga0495645_0031865
1183 Ga0495622_0029051
1184 Ga0495633_0040476
1185 Ga0495667_0000478
1186 Ga0495667_0150581
1187 Ga0495656_0004523
1188 Ga0495668_0018231
1189 Ga0495634_0019812
1190 Ga0495611_0012584
1191 Ga0495625_0002789
1192 Ga0495625_0015327
1193 Ga0495635_0003126
1194 Ga0495635_0020412
1195 Ga0495635_0026786
1196 Ga0495659_0005148
1197 Ga0495661_0010888
1198 Ga0495661_0014156
1199 Ga0495661_0029634
1200 Ga0495661_0034164
1201 Ga0495661_0064731
1202 Ga0495588_0016206
1203 Ga0495588_0033450
1204 Ga0495588_0039356
1205 Ga0495588_0060742
1206 Ga0495657_0021079
1207 Ga0495599_0000393
1208 Ga0495599_0001328
1209 Ga0495599_0016484
1210 Ga0495623_0066583
1211 Ga0495646_0001386
1212 Ga0495646_0003248
1213 Ga0495647_0025214
1214 Ga0495669_0011297
1215 Ga0495669_0015442
1216 Ga0495669_0016633
1217 Ga0495669_0041866
1218 Ga0495624_0000502
1219 Ga0495624_0001403
1220 Ga0495624_0003505
1221 Ga0495624_0005612
1222 Ga0495670_0006291
1223 Ga0495670_0007833
1224 Ga0495670_0011244
1225 Ga0495671_0070646
1226 Ga0495649_0002230
1227 Ga0495649_0007336
1228 Ga0495649_0009131
1229 Ga0495649_0019540
1230 Ga0495649_0030957
1231 Ga0495649_0051664
1232 Ga0495589_0000297
1233 Ga0495589_0001321
1234 Ga0495589_0002558
1235 Ga0495589_0002597
1236 Ga0495589_0034515
1237 Ga0495589_0039173
1238 Ga0495600_0005652
1239 Ga0495660_0096651
1240 Ga0495581_0001554
1241 Ga0495581_0002420
1242 Ga0495604_0000506
1243 Ga0495604_0004171
1244 Ga0495604_0017237
1245 Ga0495604_0020374
1246 Ga0495604_0041178
1247 Ga0495674_0000598
1248 Ga0495674_0003504
1249 Ga0495674_0004116
1250 Ga0495674_0010682
1251 Ga0495674_0013144
1252 Ga0495674_0026139
1253 Ga0495674_0149556
1254 Ga0495672_0000995
1255 Ga0495672_0009422
1256 Ga0495672_0064952
1257 Ga0495676_0040911
1258 Ga0495680_0000911
1259 Ga0495680_0005885
1260 Ga0495680_0006126
1261 Ga0495680_0098230
1262 Ga0495683_0000578
1263 Ga0495683_0004864
1264 Ga0495683_0004934
1265 Ga0495683_0011729
1266 Ga0495683_0012413
1267 Ga0495683_0015219
1268 Ga0495687_000114
1269 Ga0495687_007776
1270 Ga0495687_063451
1271 Ga0495675_0004036
1272 Ga0495675_0009198
1273 Ga0495675_0022001
1274 Ga0495675_0040907
1275 Ga0495675_0086698
1276 Ga0495675_0114195
1277 Ga0495679_000012
1278 Ga0495679_000836
1279 Ga0495679_004336
1280 Ga0495679_015762
1281 Ga0495673_0026010
1282 Ga0495673_0034564
1283 Ga0495673_0068346
1284 Ga0495681_0003640
1285 Ga0495681_0011184
1286 Ga0495681_0030030
1287 Ga0495681_0031279
1288 Ga0495681_0048281
1289 Ga0495684_0000969
1290 Ga0495686_0000521
1291 Ga0495686_0018124
1292 Ga0495593_0009033
1293 Ga0495593_0026620
1294 Ga0495593_0027863
1295 Ga0495593_0030637
1296 Ga0495593_0031128
1297 Ga0495593_0082075
1298 Ga0495602_0000273
1299 Ga0495602_0004510
1300 Ga0495602_0004558
1301 Ga0495602_0004974
1302 Ga0495602_0033840
1303 Ga0495614_0000622
1304 Ga0495626_0004861
1305 Ga0495626_0013344
1306 Ga0496100_0001296
1307 Ga0496100_0004901
1308 Ga0496100_0025693
1309 Ga0496100_0069957
1310 Ga0496101_0015807
1311 Ga0496102_0014994
1312 Ga0496102_0018472
1313 Ga0496102_0027819
1314 Ga0496102_0180066
1315 Ga0496103_0001506
1316 Ga0496103_0002319
1317 Ga0496103_0003909
1318 Ga0496104_0005724
1319 Ga0496104_0012985
1320 Ga0496105_0050485
1321 Ga0496105_0058801
1322 Ga0496105_0100338
1323 Ga0496106_0012171
1324 Ga0496106_0032504
1325 Ga0496107_0034310
1326 Ga0496108_0053788
1327 Ga0496109_0011072
1328 Ga0496109_0024446
1329 Ga0496110_0005740
1330 Ga0496110_0279893
1331 Ga0496111_0008124
1332 Ga0496112_0010241
1333 Ga0496112_0018946
1334 Ga0496113_0005752
1335 Ga0496113_0011172
1336 Ga0496114_0005479
1337 Ga0496114_0009118
1338 Ga0496114_0129077
1339 Ga0496114_0137211
1340 Ga0496114_0234788
1341 Ga0496115_0006489
1342 Ga0496116_0000010
1343 Ga0496116_0011474
1344 Ga0496116_0013858
1345 Ga0496117_0000756
1346 Ga0496117_0001866
1347 Ga0496117_0003110
1348 Ga0496117_0003258
1349 Ga0496117_0008340
1350 Ga0496117_0011069
1351 Ga0496117_0055674
1352 Ga0496117_0103935
1353 Ga0496118_0000206
1354 Ga0496118_0002783
1355 Ga0496118_0006743
1356 Ga0496118_0008980
1357 Ga0496118_0011627
1358 Ga0496118_0018771
1359 Ga0496118_0045403
1360 Ga0496118_0094889
1361 Ga0496121_0000050
1362 Ga0496121_0002508
1363 Ga0496121_0007922
1364 Ga0496121_0015933
1365 Ga0496121_0049333
1366 Ga0496122_0008015
1367 Ga0496122_0014275
1368 Ga0496122_0061763
1369 Ga0496122_0079065
1370 Ga0496123_0000609
1371 Ga0496123_0000899
1372 Ga0496123_0109304
1373 Ga0496124_0004118
1374 Ga0496124_0007907
1375 Ga0496124_0045196
1376 Ga0496124_0045232
1377 Ga0496124_0049493
1378 Ga0496124_0059566
1379 Ga0496125_0000080
1380 Ga0496125_0000459
1381 Ga0496125_0004691
1382 Ga0496125_0007581
1383 Ga0496125_0008583
1384 Ga0496125_0048648
1385 Ga0496126_0000503
1386 Ga0496126_0020710
1387 Ga0496126_0037650
1388 Ga0496126_0051165
1389 Ga0496126_0210218
1390 Ga0495678_020403
1391 Ga0495682_0003186
1392 Ga0495682_0031538
1393 Ga0501032_0063633
1394 Ga0501033_0002856
1395 Ga0501034_0000685
1396 Ga0501036_0002276
1397 Ga0501072_0045789
1398 Ga0501079_0030568
1399 Ga0501080_0023846
1400 Ga0501081_0039894
1401 Ga0501035_0029657
1402 nmdc:mga03683_32334_c1
1403 nmdc:mga03683_42876_c1
1404 nmdc:mga00v17_106376_c1
1405 nmdc:mga00v17_14281_c1
1406 nmdc:mga0yw44_3670_c1
1407 nmdc:mga0k408_3964_c1
1408 nmdc:mga05p37_103183_c1
1409 nmdc:mga05p37_196115_c1
1410 nmdc:mga09592_223293_c1
1411 nmdc:mga08y16_147247_c1
1412 nmdc:mga0sz30_445_c1
1413 nmdc:mga0sz30_855_c1
1414 Ga0495612_0030435
1415 Ga0495595_0004083
1416 Ga0495619_0019786
1417 Ga0500651_0014279
1418 Ga0500659_0000721
1419 Ga0501082_0019055
1420 2511265040
1421 2511302701
1422 2511314092
1423 2511320591
1424 2511333303
1425 2511373517
1426 2511825795
1427 2512328907
1428 2513557385
1429 2513562994
1430 2514053757
1431 2515690032
1432 2555247146
1433 2555670512
1434 2563064952
1435 2583792295
1436 2597858406
1437 2599352462
1438 2599358811
1439 2599365668
1440 2599371454
1441 2599383703
1442 2599385053
1443 2599390363
1444 2599402497
1445 2599465188
1446 2599466415
1447 2599486382
1448 2599488316
1449 2599500629
1450 2599612012
1451 2599769083
1452 2599803005
1453 2599888327
1454 2599895945
1455 2599932293
1456 2599944266
1457 2599954738
1458 2599957829
1459 2599966818
1460 2599978098
1461 2599985680
1462 2599991528
1463 2599992448
1464 2600002523
1465 2600004077
1466 2600012176
1467 2600015553
1468 2600023264
1469 2600030872
1470 2600038311
1471 2600044437
1472 2600050171
1473 2600050761
1474 2600058864
1475 2600067963
1476 2600072718
1477 2600077012
1478 2600211897
1479 2600360676
1480 2600362747
1481 2601772065
1482 2643956730
1483 2644021953
1484 2644283987
1485 2671088637
1486 2671096012
1487 2671125129
1488 2671769373
1489 2678263692
1490 2687577311
1491 2713482058
1492 2738835561
1493 2738877258
1494 2739188964
1495 2739223851
1496 2743737857
1497 2745010023
1498 2746087612
1499 2746098886
1500 2765583638
1501 2794597162
1502 2808941756
1503 2819623984
1504 2819700553
1505 2819719192
1506 2825651925
1507 2841765903
1508 2842858269
1509 2844107513
1510 2844671122
1511 2851187424
1512 2851249553
1513 2900634470
1514 2904485628
1515 2904552097
1516 2912966446
1517 2913039496
1518 2917074340
1519 2919485481
1520 2919533792
1521 2921644375
1522 2923156904
1523 2923586324
1524 2928109552
1525 2928136994
1526 2928506522
1527 2929147153
1528 2931369506
1529 2935355596
1530 2939640029
1531 2939651865
1532 2945936058
1533 2984289194
1534 2990710037
1535 3007255783
1536 3007396321
1537 3007869060
1538 637320865
1539 642422576
1540 642597748
1541 642621924
1542 8003955869
1543 8015691149
1544 8052496839
1545 8054931538
1546 8055303176
1547 8055774287
1548 8055882690
1549 8056119046
1550 8056123851
1551 8056129512
1552 8056140724
1553 8056146089
1554 8057163704

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13434

Lys_Orn_oxgnase

L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase

70

211

0.87

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

19

217

0.84

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

16

211

0.71

PF00743

FMO-like

Flavin-binding monooxygenase-like

46

208

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i8t-assembly1.cif.gz_B structure of udp-galactopyranose mutase from e.coli 0.9325 6 38
4mig-assembly1.cif.gz_C pyranose 2-oxidase from phanerochaete chrysosporium, recombinant wild type 0.9307 6 37
4mif-assembly1.cif.gz_B pyranose 2-oxidase from phanerochaete chrysosporium, wild type from natural source 0.9237 6 37
1kj8-assembly1.cif.gz_B crystal structure of purt-encoded glycinamide ribonucleotide transformylase in complex with mg-atp and gar 0.888 6 36
6fqz-assembly1.cif.gz_B plasmodium falciparum 6-phosphogluconate dehydrogenase in its apo form, in complex with its cofactor nadp+ and in complex with its substrate 6-phosphogluconate 0.8851 6 36
ID Description Score Start End Superfamily
af_Q2FZH1_2_136_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9556 170 199 3.40.50.720
4oqyB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9312 170 199 3.40.50.720
af_Q5AC33_13_266_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9127 171 199 3.90.180.10
af_Q5AC33_176_309_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9127 171 199 3.40.50.720
af_P27250_2_339_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.9022 170 199 1.10.510.10
ID Description Score Start End GO Terms
AF-A0A240EB37-F1-model_v4 Putative flavoprotein involved in K+ transport 0.9485 1 415 GO:0004497
GO:0050660
AF-A0A1E7RFD4-F1-model_v4 FAD-dependent oxidoreductase 0.9478 1 417 GO:0004497
GO:0050660
AF-A0A5R2MZZ5-F1-model_v4 FAD-dependent oxidoreductase 0.9441 186 316
AF-A0A382VTP1-F1-model_v4 FAD-dependent oxidoreductase 0.943 120 399 GO:0004497
GO:0050660
AF-A0A7W2Z277-F1-model_v4 NAD(P)-binding domain-containing protein 0.9426 3 417 GO:0004497
GO:0050660

Map