F480435
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 778 | 602 | 1556 | 116 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0007127|Ga0501034_0007127_2893_3264 |
| Length | 123 |
| Sequence | MKDKWTRHSYRTERTRDRVRETTINNGRPRLTVHRSLKYIYAQVVDDANGKTLAYASSLEKALNSGKGKSNKNVDAAKKVGEAIAKKAIAAGVKQVAFDRGGNIYHGRVKALAEAARAGGLEF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 5 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 10 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 11 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 55 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 56 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 57 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 58 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 62 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 79 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 80 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 81 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 85 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 115 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 118 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 119 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 120 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 121 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 122 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 123 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 124 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 125 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 126 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 127 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 128 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 129 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 130 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 131 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 132 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 133 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 134 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 135 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 136 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 137 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 138 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 139 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 140 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 141 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 142 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 143 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 144 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 145 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 146 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 147 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 148 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 149 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 150 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 151 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 152 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 153 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 154 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 155 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 156 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 157 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 158 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 159 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 160 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 161 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 162 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 163 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 164 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 165 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 166 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 167 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 168 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 169 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 170 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 171 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 172 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 173 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 190 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 191 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 192 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 193 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 194 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 195 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 196 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 197 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 198 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 199 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 200 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 201 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 202 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 203 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 204 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 205 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 206 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 207 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 216 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 217 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 255 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 256 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 259 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 260 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 264 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 265 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 266 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 267 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 270 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 271 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 272 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 273 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 274 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 275 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 276 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 293 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 294 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 295 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 296 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 297 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 298 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 299 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 300 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 301 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 302 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 303 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 304 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 305 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 306 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 307 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 308 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 309 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 310 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 311 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 312 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 313 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 314 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 315 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 316 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 317 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 318 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 319 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 320 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 321 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 322 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 323 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 324 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 325 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 326 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 327 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 328 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 329 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 330 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 331 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 332 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 333 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 334 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 335 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 336 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 337 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 338 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 339 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 340 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 341 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 342 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 343 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 344 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 345 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 346 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 347 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 348 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 349 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 350 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 351 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 352 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 353 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 354 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 355 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 356 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 357 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 358 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 359 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 360 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 361 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 362 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 363 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 364 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 365 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 366 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 367 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 368 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 369 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 370 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 371 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 372 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 373 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 374 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 375 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 376 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 377 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 378 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 379 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 380 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 381 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 382 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 383 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 384 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 385 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 386 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 387 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 388 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 389 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 390 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 391 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 392 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 393 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 394 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 395 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 396 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 397 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 398 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 399 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 400 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 401 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 402 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 403 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 404 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 405 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 406 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 407 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 408 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 409 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 410 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 411 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 412 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 413 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 414 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 415 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 416 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 417 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 418 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 419 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 420 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 421 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 422 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 423 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 424 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 425 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 426 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 427 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 428 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 429 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 430 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 431 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 432 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 433 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 434 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 435 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 436 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 437 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 438 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 439 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 440 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 441 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 442 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 443 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 444 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 445 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 446 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 447 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 448 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 449 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 450 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 451 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 452 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 453 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 454 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 455 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 456 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 457 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 458 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 459 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 460 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 461 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 462 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 463 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 464 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 465 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 466 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 467 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 468 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 469 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 470 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 471 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 472 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 473 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 474 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 475 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 476 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 477 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 478 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 479 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 480 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 481 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 482 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 483 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 484 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 485 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 486 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 487 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 488 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 489 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 490 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 491 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 492 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 493 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 494 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 495 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 496 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 497 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 498 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 499 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 500 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 501 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 502 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 503 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 504 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 505 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 506 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 507 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 508 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 509 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 510 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 511 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 512 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 513 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 514 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 515 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 516 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 517 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 518 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 519 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 520 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 521 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 522 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 523 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 524 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 525 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 526 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 527 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 528 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 529 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 530 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 531 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 532 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 533 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 534 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 535 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 536 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 537 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 538 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 539 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 540 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 541 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 542 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 543 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 544 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 545 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 546 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 547 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 548 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 549 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 550 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 551 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 552 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 553 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 554 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 555 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 556 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 557 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 558 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 559 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 560 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 561 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 562 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 563 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 564 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 565 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 566 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 567 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 568 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 569 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 570 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 571 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 572 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 573 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 574 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 575 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 576 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 577 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 578 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 579 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 580 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 581 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 582 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 583 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 584 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 585 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 586 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 587 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 588 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 589 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 590 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 591 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 592 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 593 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 594 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 595 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 596 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 597 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 598 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 599 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 600 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 601 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 602 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 51.54 |
| Metatranscriptomes | 8.35 |
| Isolates | 40.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.64 |
| Bulb | 0 |
| Endosphere | 8.48 |
| Nodule | 29.69 |
| Rhizoplane | 3.73 |
| Rhizosphere | 45.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501034_0007127 | 3300049571 | Bacteria | 11926 |
| 2 | JGI24740J21852_10002133 | 3300001979 | Bacteria | 9037 |
| 3 | JGI24740J21852_10038834 | 3300001979 | Bacteria | 1457 |
| 4 | JGI25158J39367_1001134 | 3300002739 | Bacteria | 4832 |
| 5 | JGI25152J39213_1036488 | 3300002773 | Bacteria | 719 |
| 6 | JGI25159J45721_1001742 | 3300002987 | Bacteria | 8761 |
| 7 | JGI25151J46595_10000038 | 3300003187 | Bacteria | 180430 |
| 8 | JGI25151J46595_10033134 | 3300003187 | Bacteria | 1994 |
| 9 | JGI25165J46597_1013643 | 3300003214 | Bacteria | 1115 |
| 10 | JGI25160J50197_1002401 | 3300003354 | Bacteria | 8731 |
| 11 | JGI25160J50197_1023262 | 3300003354 | Bacteria | 1793 |
| 12 | JGI25161J50226_1002372 | 3300003374 | Bacteria | 4860 |
| 13 | Ga0006562J51391_1004293 | 3300003578 | Bacteria | 16914 |
| 14 | Ga0006562J51391_1024742 | 3300003578 | Bacteria | 1660 |
| 15 | Ga0055526_1003723 | 3300003771 | Bacteria | 9520 |
| 16 | Ga0055526_1006649 | 3300003771 | Bacteria | 6207 |
| 17 | Ga0055526_1007926 | 3300003771 | Bacteria | 5404 |
| 18 | Ga0055526_1011996 | 3300003771 | Bacteria | 3831 |
| 19 | Ga0055526_1012008 | 3300003771 | Bacteria | 3828 |
| 20 | Ga0055524_1006440 | 3300003775 | Bacteria | 5089 |
| 21 | Ga0055524_1073072 | 3300003775 | Bacteria | 652 |
| 22 | Ga0055536_1001886 | 3300003781 | Bacteria | 12178 |
| 23 | Ga0055536_1002273 | 3300003781 | Bacteria | 10907 |
| 24 | Ga0055528_1067071 | 3300003790 | Bacteria | 658 |
| 25 | Ga0055530_10024067 | 3300003791 | Bacteria | 1736 |
| 26 | Ga0055531_10002421 | 3300003794 | Bacteria | 12498 |
| 27 | Ga0055531_10017723 | 3300003794 | Bacteria | 2987 |
| 28 | Ga0055543_1000856 | 3300004625 | Bacteria | 14666 |
| 29 | Ga0058863_11693745 | 3300004799 | Bacteria | 807 |
| 30 | Ga0065165_1002620 | 3300005262 | Bacteria | 14666 |
| 31 | Ga0070683_100320604 | 3300005329 | Bacteria | 1475 |
| 32 | Ga0070683_101890700 | 3300005329 | Bacteria | 574 |
| 33 | Ga0070683_102389569 | 3300005329 | Bacteria | 507 |
| 34 | Ga0068869_100104915 | 3300005334 | Bacteria | 2143 |
| 35 | Ga0070666_11467565 | 3300005335 | Bacteria | 510 |
| 36 | Ga0070680_100019894 | 3300005336 | Bacteria | 5323 |
| 37 | Ga0070680_101866482 | 3300005336 | Bacteria | 521 |
| 38 | Ga0070682_100023836 | 3300005337 | Bacteria | 3637 |
| 39 | Ga0070660_100440227 | 3300005339 | Bacteria | 1081 |
| 40 | Ga0070691_10009880 | 3300005341 | Bacteria | 4347 |
| 41 | Ga0070661_101186508 | 3300005344 | Bacteria | 638 |
| 42 | Ga0070692_10781994 | 3300005345 | Bacteria | 650 |
| 43 | Ga0070668_101925805 | 3300005347 | Bacteria | 545 |
| 44 | Ga0070673_101480685 | 3300005364 | Bacteria | 640 |
| 45 | Ga0070688_100380571 | 3300005365 | Bacteria | 1040 |
| 46 | Ga0070659_101249388 | 3300005366 | Bacteria | 658 |
| 47 | Ga0070703_10308472 | 3300005406 | Bacteria | 662 |
| 48 | Ga0070705_100091317 | 3300005440 | Bacteria | 1898 |
| 49 | Ga0070694_100222560 | 3300005444 | Bacteria | 1416 |
| 50 | Ga0070663_100136781 | 3300005455 | Bacteria | 1866 |
| 51 | Ga0070663_101742180 | 3300005455 | Bacteria | 558 |
| 52 | Ga0070678_100021594 | 3300005456 | Bacteria | 4249 |
| 53 | Ga0070681_10007102 | 3300005458 | Bacteria | 10905 |
| 54 | Ga0070679_100035523 | 3300005530 | Bacteria | 4945 |
| 55 | Ga0070684_101563992 | 3300005535 | Bacteria | 622 |
| 56 | Ga0068853_100006917 | 3300005539 | Bacteria | 9054 |
| 57 | Ga0070695_100090950 | 3300005545 | Bacteria | 2037 |
| 58 | Ga0070696_100006293 | 3300005546 | Bacteria | 7950 |
| 59 | Ga0070693_100011024 | 3300005547 | Bacteria | 4545 |
| 60 | Ga0070665_102502843 | 3300005548 | Bacteria | 518 |
| 61 | Ga0070704_100332501 | 3300005549 | Bacteria | 1277 |
| 62 | Ga0070664_100068199 | 3300005564 | Bacteria | 3041 |
| 63 | Ga0068857_100128196 | 3300005577 | Bacteria | 2287 |
| 64 | Ga0068857_101469202 | 3300005577 | Bacteria | 664 |
| 65 | Ga0070702_100213515 | 3300005615 | Bacteria | 1286 |
| 66 | Ga0068852_101644606 | 3300005616 | Bacteria | 665 |
| 67 | Ga0068864_102115899 | 3300005618 | Bacteria | 569 |
| 68 | Ga0068870_10799251 | 3300005840 | Bacteria | 659 |
| 69 | Ga0068860_100163395 | 3300005843 | Bacteria | 2148 |
| 70 | Ga0075365_10382100 | 3300006038 | Bacteria | 993 |
| 71 | Ga0075365_11043898 | 3300006038 | Bacteria | 576 |
| 72 | Ga0075364_11060089 | 3300006051 | Bacteria | 551 |
| 73 | Ga0075362_10232402 | 3300006177 | Bacteria | 903 |
| 74 | Ga0075362_10479714 | 3300006177 | Bacteria | 634 |
| 75 | Ga0075369_10079325 | 3300006186 | Bacteria | 1454 |
| 76 | Ga0075370_10579154 | 3300006353 | Bacteria | 679 |
| 77 | Ga0075431_101356955 | 3300006847 | Bacteria | 671 |
| 78 | Ga0068865_100456060 | 3300006881 | Bacteria | 1058 |
| 79 | Ga0079104_1037364 | 3300006946 | Bacteria | 1157 |
| 80 | Ga0099826_10165412 | 3300006948 | Bacteria | 1248 |
| 81 | Ga0105243_10014127 | 3300009148 | Bacteria | 6039 |
| 82 | Ga0105242_10178320 | 3300009176 | Bacteria | 1873 |
| 83 | Ga0105237_10016531 | 3300009545 | Bacteria | 7666 |
| 84 | Ga0105238_10215115 | 3300009551 | Bacteria | 1898 |
| 85 | Ga0105238_11112508 | 3300009551 | Bacteria | 813 |
| 86 | Ga0105239_10608275 | 3300010375 | Bacteria | 1247 |
| 87 | Ga0157370_10420619 | 3300013104 | Bacteria | 1229 |
| 88 | Ga0157369_10087882 | 3300013105 | Bacteria | 3319 |
| 89 | Ga0171462_1042 | 3300013250 | Bacteria | 66199 |
| 90 | Ga0157372_10469158 | 3300013307 | Bacteria | 1467 |
| 91 | Ga0157375_10341498 | 3300013308 | Bacteria | 1663 |
| 92 | Ga0163163_10751432 | 3300014325 | Bacteria | 1039 |
| 93 | Ga0157380_12868643 | 3300014326 | Bacteria | 548 |
| 94 | Ga0157379_10273185 | 3300014968 | Bacteria | 1537 |
| 95 | Ga0157379_10642369 | 3300014968 | Bacteria | 993 |
| 96 | Ga0157376_10492824 | 3300014969 | Bacteria | 1203 |
| 97 | Ga0206353_11755279 | 3300020082 | Bacteria | 585 |
| 98 | Ga0214542_1023288 | 3300021321 | Bacteria | 3746 |
| 99 | Ga0214543_1005345 | 3300021327 | Bacteria | 23734 |
| 100 | Ga0213872_10012804 | 3300021361 | Bacteria | 3938 |
| 101 | Ga0213872_10103949 | 3300021361 | Bacteria | 1264 |
| 102 | Ga0213872_10183657 | 3300021361 | Bacteria | 902 |
| 103 | Ga0209436_100747 | 3300025208 | Bacteria | 13472 |
| 104 | Ga0209673_1037691 | 3300025273 | Bacteria | 1417 |
| 105 | Ga0209130_1000007 | 3300025284 | Bacteria | 591584 |
| 106 | Ga0209130_1008921 | 3300025284 | Bacteria | 2908 |
| 107 | Ga0209675_1002527 | 3300025291 | Bacteria | 9311 |
| 108 | Ga0209676_1001545 | 3300025292 | Bacteria | 20721 |
| 109 | Ga0209676_1028639 | 3300025292 | Bacteria | 1730 |
| 110 | Ga0209025_1000014 | 3300025294 | Bacteria | 865448 |
| 111 | Ga0209025_1000303 | 3300025294 | Bacteria | 110086 |
| 112 | Ga0209025_1179903 | 3300025294 | Bacteria | 544 |
| 113 | Ga0209564_1000140 | 3300025295 | Bacteria | 179856 |
| 114 | Ga0209564_1002872 | 3300025295 | Bacteria | 12632 |
| 115 | Ga0209564_1003215 | 3300025295 | Bacteria | 11464 |
| 116 | Ga0209050_1002103 | 3300025298 | Bacteria | 18193 |
| 117 | Ga0209256_1000108 | 3300025299 | Bacteria | 185884 |
| 118 | Ga0209256_1000540 | 3300025299 | Bacteria | 54759 |
| 119 | Ga0207426_1000064 | 3300025302 | Bacteria | 358276 |
| 120 | Ga0209051_1002149 | 3300025303 | Bacteria | 14647 |
| 121 | Ga0209257_1000817 | 3300025304 | Bacteria | 45150 |
| 122 | Ga0209257_1061703 | 3300025304 | Bacteria | 1016 |
| 123 | Ga0207688_10483414 | 3300025901 | Bacteria | 774 |
| 124 | Ga0207699_10775565 | 3300025906 | Bacteria | 704 |
| 125 | Ga0207643_10882990 | 3300025908 | Bacteria | 579 |
| 126 | Ga0207654_10065182 | 3300025911 | Bacteria | 2144 |
| 127 | Ga0207707_10017730 | 3300025912 | Bacteria | 6211 |
| 128 | Ga0207671_10301103 | 3300025914 | Bacteria | 1267 |
| 129 | Ga0207660_10003004 | 3300025917 | Bacteria | 11039 |
| 130 | Ga0207660_11379492 | 3300025917 | Bacteria | 571 |
| 131 | Ga0207652_10232689 | 3300025921 | Bacteria | 1661 |
| 132 | Ga0207690_10008933 | 3300025932 | Bacteria | 5948 |
| 133 | Ga0207686_10481845 | 3300025934 | Bacteria | 959 |
| 134 | Ga0207709_10018685 | 3300025935 | Bacteria | 3887 |
| 135 | Ga0207689_10101680 | 3300025942 | Bacteria | 2361 |
| 136 | Ga0207679_10196515 | 3300025945 | Bacteria | 1682 |
| 137 | Ga0207667_10128005 | 3300025949 | Bacteria | 2615 |
| 138 | Ga0207658_10055258 | 3300025986 | Bacteria | 2942 |
| 139 | Ga0207639_11069964 | 3300026041 | Bacteria | 756 |
| 140 | Ga0207678_10000118 | 3300026067 | Bacteria | 65608 |
| 141 | Ga0207674_10135964 | 3300026116 | Bacteria | 2420 |
| 142 | Ga0207675_102134487 | 3300026118 | Bacteria | 576 |
| 143 | Ga0207683_10026403 | 3300026121 | Bacteria | 5012 |
| 144 | Ga0207698_10074815 | 3300026142 | Bacteria | 2703 |
| 145 | Ga0209282_1086341 | 3300027666 | Bacteria | 1659 |
| 146 | Ga0209974_10092975 | 3300027876 | Bacteria | 1047 |
| 147 | Ga0209974_10099296 | 3300027876 | Bacteria | 1016 |
| 148 | Ga0268264_10075388 | 3300028381 | Bacteria | 2869 |
| 149 | Ga0265319_1072110 | 3300028563 | Bacteria | 1106 |
| 150 | Ga0265334_10134553 | 3300028573 | Bacteria | 878 |
| 151 | Ga0265318_10009217 | 3300028577 | Bacteria | 4353 |
| 152 | Ga0307515_10017924 | 3300028794 | Bacteria | 12859 |
| 153 | Ga0265320_10061498 | 3300031240 | Bacteria | 1790 |
| 154 | Ga0265331_10063094 | 3300031250 | Bacteria | 1746 |
| 155 | Ga0307513_10402061 | 3300031456 | Bacteria | 1104 |
| 156 | Ga0307408_100504141 | 3300031548 | Bacteria | 1060 |
| 157 | Ga0316579_10255456 | 3300031691 | Bacteria | 848 |
| 158 | Ga0265342_10111276 | 3300031712 | Bacteria | 1550 |
| 159 | Ga0307405_10055833 | 3300031731 | Bacteria | 2474 |
| 160 | Ga0307410_10470776 | 3300031852 | Bacteria | 1029 |
| 161 | Ga0307412_10758338 | 3300031911 | Bacteria | 838 |
| 162 | Ga0307416_100606726 | 3300032002 | Bacteria | 1175 |
| 163 | Ga0307414_10139116 | 3300032004 | Bacteria | 1898 |
| 164 | Ga0307414_10746594 | 3300032004 | Bacteria | 889 |
| 165 | Ga0307411_10326731 | 3300032005 | Bacteria | 1241 |
| 166 | Ga0307415_100903696 | 3300032126 | Bacteria | 814 |
| 167 | Ga0373948_0190212 | 3300034817 | Bacteria | 531 |
| 168 | Ga0373934_0049988 | 3300035086 | Bacteria | 1656 |
| 169 | Ga0373936_0210250 | 3300035113 | Bacteria | 861 |
| 170 | Ga0373939_0066937 | 3300035114 | Bacteria | 1159 |
| 171 | Ga0373953_0264496 | 3300035117 | Bacteria | 748 |
| 172 | Ga0373957_0037891 | 3300035120 | Bacteria | 1803 |
| 173 | Ga0373955_0045569 | 3300035172 | Bacteria | 2367 |
| 174 | Ga0373924_0513905 | 3300035410 | Bacteria | 538 |
| 175 | Ga0373931_0019779 | 3300035691 | Bacteria | 3364 |
| 176 | Ga0373933_0127218 | 3300035724 | Bacteria | 1599 |
| 177 | Ga0316584_0827847 | 3300036712 | Bacteria | 627 |
| 178 | Ga0395899_0181581 | 3300037312 | Bacteria | 1477 |
| 179 | Ga0395900_0300836 | 3300037418 | Bacteria | 1590 |
| 180 | Ga0395900_0439171 | 3300037418 | Bacteria | 1263 |
| 181 | Ga0395898_0007760 | 3300037466 | Bacteria | 11394 |
| 182 | Ga0395898_0509502 | 3300037466 | Bacteria | 1144 |
| 183 | Ga0395905_0032064 | 3300037471 | Bacteria | 4942 |
| 184 | Ga0395901_0102929 | 3300038443 | Bacteria | 2996 |
| 185 | Ga0395901_1974174 | 3300038443 | Bacteria | 530 |
| 186 | Ga0400483_002645 | 3300039062 | Bacteria | 1458 |
| 187 | Ga0400483_032695 | 3300039062 | Bacteria | 3006 |
| 188 | Ga0400489_86969 | 3300039093 | Bacteria | 10581 |
| 189 | Ga0237816_03981 | 3300039145 | Bacteria | 1048 |
| 190 | Ga0436361_0002743 | 3300039447 | Bacteria | 628 |
| 191 | Ga0436361_0291348 | 3300039447 | Bacteria | 1687 |
| 192 | Ga0436361_0925804 | 3300039447 | Bacteria | 732 |
| 193 | Ga0436361_1086504 | 3300039447 | Bacteria | 2345 |
| 194 | Ga0436362_0680415 | 3300039453 | Bacteria | 872 |
| 195 | Ga0439436_0051371 | 3300041404 | Bacteria | 1164 |
| 196 | Ga0439453_0043502 | 3300041408 | Bacteria | 888 |
| 197 | Ga0439466_0062082 | 3300041411 | Bacteria | 1202 |
| 198 | Ga0439466_0090356 | 3300041411 | Bacteria | 960 |
| 199 | Ga0439465_0114390 | 3300041413 | Bacteria | 942 |
| 200 | Ga0439465_0189032 | 3300041413 | Bacteria | 747 |
| 201 | Ga0439465_0232320 | 3300041413 | Bacteria | 678 |
| 202 | Ga0451789_1140541 | 3300041443 | Bacteria | 1097 |
| 203 | Ga0451791_1659963 | 3300041451 | Bacteria | 583 |
| 204 | Ga0451797_1119904 | 3300041453 | Bacteria | 734 |
| 205 | Ga0451800_1262250 | 3300041459 | Bacteria | 657 |
| 206 | Ga0451841_1428859 | 3300041498 | Bacteria | 783 |
| 207 | Ga0451855_1035573 | 3300041511 | Bacteria | 645 |
| 208 | Ga0439442_040365 | 3300042002 | Bacteria | 980 |
| 209 | Ga0439445_0014796 | 3300042004 | Bacteria | 1904 |
| 210 | Ga0439432_159318 | 3300042006 | Bacteria | 661 |
| 211 | Ga0439449_0006732 | 3300042007 | Bacteria | 4386 |
| 212 | Ga0439452_028778 | 3300042010 | Bacteria | 1383 |
| 213 | Ga0439434_0022899 | 3300042435 | Bacteria | 1879 |
| 214 | Ga0466965_0043824 | 3300044683 | Bacteria | 2210 |
| 215 | Ga0466965_0205491 | 3300044683 | Bacteria | 1046 |
| 216 | Ga0466965_0353017 | 3300044683 | Bacteria | 806 |
| 217 | Ga0466968_0039813 | 3300044735 | Bacteria | 1979 |
| 218 | Ga0495617_130347 | 3300046452 | Bacteria | 807 |
| 219 | Ga0495651_0137565 | 3300046462 | Bacteria | 1775 |
| 220 | Ga0495653_0956443 | 3300046463 | Bacteria | 508 |
| 221 | Ga0495639_0567609 | 3300046475 | Bacteria | 582 |
| 222 | Ga0495585_0262220 | 3300046492 | Bacteria | 859 |
| 223 | Ga0495608_0103481 | 3300046511 | Bacteria | 1835 |
| 224 | Ga0495652_0168520 | 3300046529 | Bacteria | 1692 |
| 225 | Ga0495587_0020378 | 3300046536 | Bacteria | 4094 |
| 226 | Ga0495667_0460271 | 3300046559 | Bacteria | 799 |
| 227 | Ga0495657_0117764 | 3300046675 | Bacteria | 1676 |
| 228 | Ga0495599_0298978 | 3300046678 | Bacteria | 972 |
| 229 | Ga0495670_0530728 | 3300046691 | Bacteria | 640 |
| 230 | Ga0495680_0258167 | 3300047322 | Bacteria | 1233 |
| 231 | Ga0495675_0040498 | 3300047444 | Bacteria | 2969 |
| 232 | Ga0496100_0316414 | 3300048903 | Bacteria | 1171 |
| 233 | Ga0496101_0250750 | 3300048904 | Bacteria | 1379 |
| 234 | Ga0496102_0021900 | 3300048905 | Bacteria | 5658 |
| 235 | Ga0496102_0622502 | 3300048905 | Bacteria | 1002 |
| 236 | Ga0496102_1516812 | 3300048905 | Bacteria | 589 |
| 237 | Ga0496102_1792465 | 3300048905 | Bacteria | 531 |
| 238 | Ga0496103_0005971 | 3300048906 | Bacteria | 7283 |
| 239 | Ga0496104_0017664 | 3300048907 | Bacteria | 6502 |
| 240 | Ga0496104_0038871 | 3300048907 | Bacteria | 4454 |
| 241 | Ga0496104_1101570 | 3300048907 | Bacteria | 698 |
| 242 | Ga0496105_0180037 | 3300048908 | Bacteria | 1731 |
| 243 | Ga0496106_0004608 | 3300048909 | Bacteria | 10225 |
| 244 | Ga0496107_0008725 | 3300048910 | Bacteria | 7023 |
| 245 | Ga0496110_0355217 | 3300048913 | Bacteria | 1335 |
| 246 | Ga0496114_0381187 | 3300048917 | Bacteria | 1248 |
| 247 | Ga0496114_1518847 | 3300048917 | Bacteria | 558 |
| 248 | Ga0496115_0001671 | 3300048918 | Bacteria | 15949 |
| 249 | Ga0496115_0999984 | 3300048918 | Bacteria | 639 |
| 250 | Ga0496116_0083743 | 3300048919 | Bacteria | 1967 |
| 251 | Ga0496116_0121347 | 3300048919 | Bacteria | 1512 |
| 252 | Ga0496116_0369072 | 3300048919 | Bacteria | 649 |
| 253 | Ga0496117_0085746 | 3300048920 | Bacteria | 2049 |
| 254 | Ga0496117_0115516 | 3300048920 | Bacteria | 1661 |
| 255 | Ga0496117_0280764 | 3300048920 | Bacteria | 892 |
| 256 | Ga0496119_0276186 | 3300048922 | Bacteria | 837 |
| 257 | Ga0496121_0018961 | 3300048924 | Bacteria | 6903 |
| 258 | Ga0496121_0058894 | 3300048924 | Bacteria | 3171 |
| 259 | Ga0496121_0473270 | 3300048924 | Bacteria | 802 |
| 260 | Ga0496122_0019871 | 3300048925 | Bacteria | 6109 |
| 261 | Ga0496122_0344328 | 3300048925 | Bacteria | 781 |
| 262 | Ga0496123_0008564 | 3300048926 | Bacteria | 9374 |
| 263 | Ga0496123_0073670 | 3300048926 | Bacteria | 2117 |
| 264 | Ga0496124_0326832 | 3300048927 | Bacteria | 1095 |
| 265 | Ga0496125_0000815 | 3300048928 | Bacteria | 50702 |
| 266 | Ga0496125_0053349 | 3300048928 | Bacteria | 3315 |
| 267 | Ga0496125_0155181 | 3300048928 | Bacteria | 1565 |
| 268 | Ga0496125_0410546 | 3300048928 | Bacteria | 788 |
| 269 | Ga0496126_0036822 | 3300048929 | Bacteria | 4572 |
| 270 | Ga0496126_0269663 | 3300048929 | Bacteria | 1413 |
| 271 | Ga0501306_000444 | 3300049127 | Bacteria | 3135 |
| 272 | Ga0501306_001033 | 3300049127 | Bacteria | 2464 |
| 273 | Ga0501306_004298 | 3300049127 | Bacteria | 1590 |
| 274 | Ga0501306_007899 | 3300049127 | Bacteria | 1284 |
| 275 | Ga0501308_064523 | 3300049128 | Bacteria | 559 |
| 276 | Ga0501309_004872 | 3300049129 | Bacteria | 1579 |
| 277 | Ga0501309_022451 | 3300049129 | Bacteria | 893 |
| 278 | Ga0501310_001976 | 3300049130 | Bacteria | 1910 |
| 279 | Ga0501310_015362 | 3300049130 | Bacteria | 908 |
| 280 | Ga0501310_063217 | 3300049130 | Bacteria | 555 |
| 281 | Ga0501341_05883 | 3300049131 | Bacteria | 743 |
| 282 | Ga0501304_000523 | 3300049160 | Bacteria | 2043 |
| 283 | Ga0501305_009509 | 3300049161 | Bacteria | 1279 |
| 284 | Ga0501305_089282 | 3300049161 | Bacteria | 562 |
| 285 | Ga0501307_026867 | 3300049162 | Bacteria | 780 |
| 286 | Ga0501307_040231 | 3300049162 | Bacteria | 677 |
| 287 | Ga0501307_079477 | 3300049162 | Bacteria | 534 |
| 288 | Ga0501294_026713 | 3300049517 | Bacteria | 654 |
| 289 | Ga0501303_037340 | 3300049526 | Bacteria | 593 |
| 290 | Ga0501311_006601 | 3300049527 | Bacteria | 1311 |
| 291 | Ga0501311_050333 | 3300049527 | Bacteria | 652 |
| 292 | Ga0501311_100954 | 3300049527 | Bacteria | 511 |
| 293 | Ga0501312_002690 | 3300049528 | Bacteria | 1941 |
| 294 | Ga0501314_000486 | 3300049530 | Bacteria | 2489 |
| 295 | Ga0501314_002564 | 3300049530 | Bacteria | 1414 |
| 296 | Ga0501314_002648 | 3300049530 | Bacteria | 1399 |
| 297 | Ga0501315_000060 | 3300049531 | Bacteria | 4828 |
| 298 | Ga0501315_040696 | 3300049531 | Bacteria | 702 |
| 299 | Ga0501315_053140 | 3300049531 | Bacteria | 640 |
| 300 | Ga0501315_103836 | 3300049531 | Bacteria | 505 |
| 301 | Ga0501316_000132 | 3300049532 | Bacteria | 3939 |
| 302 | Ga0501316_051721 | 3300049532 | Bacteria | 593 |
| 303 | Ga0501317_000084 | 3300049533 | Bacteria | 4633 |
| 304 | Ga0501318_008515 | 3300049534 | Bacteria | 1098 |
| 305 | Ga0501319_002038 | 3300049535 | Bacteria | 1246 |
| 306 | Ga0501320_005669 | 3300049536 | Bacteria | 1146 |
| 307 | Ga0501320_007634 | 3300049536 | Bacteria | 1045 |
| 308 | Ga0501320_016479 | 3300049536 | Bacteria | 818 |
| 309 | Ga0501321_033209 | 3300049537 | Bacteria | 698 |
| 310 | Ga0501322_018829 | 3300049538 | Bacteria | 594 |
| 311 | Ga0501323_005178 | 3300049539 | Bacteria | 1415 |
| 312 | Ga0501325_003833 | 3300049541 | Bacteria | 1119 |
| 313 | Ga0501326_04357 | 3300049542 | Bacteria | 749 |
| 314 | Ga0501332_01776 | 3300049548 | Bacteria | 1163 |
| 315 | Ga0501335_000789 | 3300049551 | Bacteria | 2207 |
| 316 | Ga0501031_0000651 | 3300049568 | Bacteria | 20547 |
| 317 | Ga0501031_0004402 | 3300049568 | Bacteria | 9129 |
| 318 | Ga0501032_0000111 | 3300049569 | Bacteria | 69802 |
| 319 | Ga0501032_0006160 | 3300049569 | Bacteria | 8827 |
| 320 | Ga0501032_0014074 | 3300049569 | Bacteria | 5674 |
| 321 | Ga0501032_0173231 | 3300049569 | Bacteria | 1414 |
| 322 | Ga0501032_0320313 | 3300049569 | Bacteria | 1001 |
| 323 | Ga0501032_0345929 | 3300049569 | Bacteria | 958 |
| 324 | Ga0501032_0491575 | 3300049569 | Bacteria | 784 |
| 325 | Ga0501033_0007122 | 3300049570 | Bacteria | 8728 |
| 326 | Ga0501033_0010287 | 3300049570 | Bacteria | 7177 |
| 327 | Ga0501033_0080471 | 3300049570 | Bacteria | 2390 |
| 328 | Ga0501033_0194969 | 3300049570 | Bacteria | 1448 |
| 329 | Ga0501033_0341631 | 3300049570 | Bacteria | 1049 |
| 330 | Ga0501033_0387415 | 3300049570 | Bacteria | 976 |
| 331 | Ga0501033_0857555 | 3300049570 | Bacteria | 612 |
| 332 | Ga0501034_0000208 | 3300049571 | Bacteria | 111739 |
| 333 | Ga0501034_0004897 | 3300049571 | Bacteria | 14760 |
| 334 | Ga0501034_0009019 | 3300049571 | Bacteria | 10475 |
| 335 | Ga0501034_0009460 | 3300049571 | Bacteria | 10201 |
| 336 | Ga0501034_0030885 | 3300049571 | Bacteria | 5444 |
| 337 | Ga0501034_0053012 | 3300049571 | Bacteria | 4086 |
| 338 | Ga0501034_0069393 | 3300049571 | Bacteria | 3535 |
| 339 | Ga0501034_1117733 | 3300049571 | Bacteria | 668 |
| 340 | Ga0501034_1231203 | 3300049571 | Bacteria | 627 |
| 341 | Ga0501036_0002605 | 3300049572 | Bacteria | 14223 |
| 342 | Ga0501036_0074242 | 3300049572 | Bacteria | 2876 |
| 343 | Ga0501036_0087845 | 3300049572 | Bacteria | 2628 |
| 344 | Ga0501036_0194494 | 3300049572 | Bacteria | 1706 |
| 345 | Ga0501036_0454935 | 3300049572 | Bacteria | 1066 |
| 346 | Ga0501036_0862776 | 3300049572 | Bacteria | 744 |
| 347 | Ga0501036_1209638 | 3300049572 | Bacteria | 616 |
| 348 | Ga0501037_0000131 | 3300049573 | Bacteria | 69802 |
| 349 | Ga0501037_0007990 | 3300049573 | Bacteria | 7753 |
| 350 | Ga0501037_0061483 | 3300049573 | Bacteria | 2738 |
| 351 | Ga0501037_0094809 | 3300049573 | Bacteria | 2158 |
| 352 | Ga0501037_0135567 | 3300049573 | Bacteria | 1763 |
| 353 | Ga0501037_0183612 | 3300049573 | Bacteria | 1483 |
| 354 | Ga0501037_0338366 | 3300049573 | Bacteria | 1040 |
| 355 | Ga0501037_0841677 | 3300049573 | Bacteria | 604 |
| 356 | Ga0501038_0000109 | 3300049574 | Bacteria | 69802 |
| 357 | Ga0501038_0009962 | 3300049574 | Bacteria | 8704 |
| 358 | Ga0501038_0047294 | 3300049574 | Bacteria | 3727 |
| 359 | Ga0501038_0213052 | 3300049574 | Bacteria | 1544 |
| 360 | Ga0501038_0655218 | 3300049574 | Bacteria | 790 |
| 361 | Ga0501038_0813200 | 3300049574 | Bacteria | 694 |
| 362 | Ga0501039_0000072 | 3300049575 | Bacteria | 76673 |
| 363 | Ga0501039_0002279 | 3300049575 | Bacteria | 14235 |
| 364 | Ga0501039_0765045 | 3300049575 | Bacteria | 754 |
| 365 | Ga0501040_0046602 | 3300049576 | Bacteria | 2959 |
| 366 | Ga0501040_0300420 | 3300049576 | Bacteria | 1148 |
| 367 | Ga0501042_0724963 | 3300049578 | Bacteria | 723 |
| 368 | Ga0501043_0015219 | 3300049579 | Bacteria | 6023 |
| 369 | Ga0501043_0128759 | 3300049579 | Bacteria | 1984 |
| 370 | Ga0501043_0195389 | 3300049579 | Bacteria | 1572 |
| 371 | Ga0501046_0004977 | 3300049580 | Bacteria | 11926 |
| 372 | Ga0501046_0016665 | 3300049580 | Bacteria | 6147 |
| 373 | Ga0501046_0528686 | 3300049580 | Bacteria | 842 |
| 374 | Ga0501047_0001212 | 3300049581 | Bacteria | 25586 |
| 375 | Ga0501047_0017299 | 3300049581 | Bacteria | 6904 |
| 376 | Ga0501047_0058328 | 3300049581 | Bacteria | 3729 |
| 377 | Ga0501047_0317813 | 3300049581 | Bacteria | 1397 |
| 378 | Ga0501047_0380412 | 3300049581 | Bacteria | 1246 |
| 379 | Ga0501047_0682282 | 3300049581 | Bacteria | 845 |
| 380 | Ga0501047_1205785 | 3300049581 | Bacteria | 570 |
| 381 | Ga0501048_0000501 | 3300049582 | Bacteria | 27413 |
| 382 | Ga0501048_0166830 | 3300049582 | Bacteria | 1559 |
| 383 | Ga0501067_0001102 | 3300049583 | Bacteria | 14576 |
| 384 | Ga0501067_0021386 | 3300049583 | Bacteria | 3580 |
| 385 | Ga0501069_0584467 | 3300049585 | Bacteria | 670 |
| 386 | Ga0501070_0015591 | 3300049586 | Bacteria | 6390 |
| 387 | Ga0501070_0016943 | 3300049586 | Bacteria | 6115 |
| 388 | Ga0501070_0110480 | 3300049586 | Bacteria | 2272 |
| 389 | Ga0501070_0363567 | 3300049586 | Bacteria | 1174 |
| 390 | Ga0501070_0487433 | 3300049586 | Bacteria | 991 |
| 391 | Ga0501070_1114929 | 3300049586 | Bacteria | 608 |
| 392 | Ga0501071_0650932 | 3300049587 | Bacteria | 811 |
| 393 | Ga0501072_0596597 | 3300049588 | Bacteria | 871 |
| 394 | Ga0501073_0025762 | 3300049589 | Bacteria | 4214 |
| 395 | Ga0501073_0091635 | 3300049589 | Bacteria | 2113 |
| 396 | Ga0501073_0208047 | 3300049589 | Bacteria | 1352 |
| 397 | Ga0501073_0713502 | 3300049589 | Bacteria | 692 |
| 398 | Ga0501073_0960866 | 3300049589 | Bacteria | 588 |
| 399 | Ga0501074_0886865 | 3300049590 | Bacteria | 628 |
| 400 | Ga0501076_1206125 | 3300049592 | Bacteria | 623 |
| 401 | Ga0501252_088693 | 3300049682 | Bacteria | 521 |
| 402 | Ga0501257_101426 | 3300049686 | Bacteria | 756 |
| 403 | Ga0501080_0000005 | 3300049742 | Bacteria | 176271 |
| 404 | Ga0501080_0141993 | 3300049742 | Bacteria | 2220 |
| 405 | Ga0501083_0197166 | 3300049744 | Bacteria | 1314 |
| 406 | Ga0501083_0597580 | 3300049744 | Bacteria | 718 |
| 407 | Ga0501083_1164584 | 3300049744 | Bacteria | 502 |
| 408 | Ga0501263_026500 | 3300049760 | Bacteria | 802 |
| 409 | Ga0501280_003866 | 3300049776 | Bacteria | 2252 |
| 410 | Ga0501035_0000049 | 3300049822 | Bacteria | 145684 |
| 411 | Ga0501035_0000347 | 3300049822 | Bacteria | 53369 |
| 412 | Ga0501035_0009004 | 3300049822 | Bacteria | 9284 |
| 413 | Ga0501035_0112268 | 3300049822 | Bacteria | 2388 |
| 414 | Ga0501035_0591111 | 3300049822 | Bacteria | 905 |
| 415 | Ga0501035_1098899 | 3300049822 | Bacteria | 621 |
| 416 | Ga0501044_0000030 | 3300049823 | Bacteria | 173442 |
| 417 | Ga0501044_0000234 | 3300049823 | Bacteria | 69802 |
| 418 | Ga0501044_0022577 | 3300049823 | Bacteria | 6704 |
| 419 | Ga0501044_0050656 | 3300049823 | Bacteria | 4283 |
| 420 | Ga0501044_0062595 | 3300049823 | Bacteria | 3803 |
| 421 | Ga0501044_0141730 | 3300049823 | Bacteria | 2392 |
| 422 | Ga0501044_0737439 | 3300049823 | Bacteria | 868 |
| 423 | Ga0501044_0876789 | 3300049823 | Bacteria | 773 |
| 424 | Ga0501044_1115511 | 3300049823 | Bacteria | 658 |
| 425 | Ga0501044_1164998 | 3300049823 | Bacteria | 639 |
| 426 | Ga0501044_1203502 | 3300049823 | Bacteria | 625 |
| 427 | Ga0501044_1404140 | 3300049823 | Bacteria | 564 |
| 428 | Ga0501045_0262165 | 3300049824 | Bacteria | 1286 |
| 429 | nmdc:mga0yw44_31343_c1 | 3300050492 | Bacteria | 2023 |
| 430 | nmdc:mga0k408_304127_c1 | 3300050493 | Bacteria | 952 |
| 431 | nmdc:mga07m45_52036_c1 | 3300050496 | Bacteria | 2311 |
| 432 | nmdc:mga0sz30_69529_c1 | 3300050516 | Bacteria | 1514 |
| 433 | Ga0495612_0061025 | 3300053078 | Bacteria | 1561 |
| 434 | Ga0495619_1165051 | 3300053085 | Bacteria | 511 |
| 435 | Ga0500595_071600 | 3300053119 | Bacteria | 1027 |
| 436 | Ga0500608_136998 | 3300053122 | Bacteria | 1090 |
| 437 | Ga0500618_115134 | 3300053125 | Bacteria | 608 |
| 438 | Ga0500559_0144555 | 3300053136 | Bacteria | 1115 |
| 439 | Ga0500559_0471422 | 3300053136 | Bacteria | 579 |
| 440 | Ga0500616_0009749 | 3300053153 | Bacteria | 5803 |
| 441 | Ga0500616_0011972 | 3300053153 | Bacteria | 5096 |
| 442 | Ga0500616_0019860 | 3300053153 | Bacteria | 3782 |
| 443 | Ga0500627_0074523 | 3300053158 | Bacteria | 1507 |
| 444 | Ga0500627_0141891 | 3300053158 | Bacteria | 1085 |
| 445 | Ga0500634_0000031 | 3300053161 | Bacteria | 75547 |
| 446 | Ga0501084_0807405 | 3300054114 | Bacteria | 790 |
| 447 | Ga0587084_021570 | 3300059477 | Bacteria | 967 |
| 448 | Ga0587066_200630 | 3300059490 | Bacteria | 525 |
| 449 | Ga0587077_000009 | 3300059493 | Bacteria | 7681 |
| 450 | Ga0587077_001192 | 3300059493 | Bacteria | 2699 |
| 451 | Ga0587077_026576 | 3300059493 | Bacteria | 1070 |
| 452 | Ga0587077_186543 | 3300059493 | Bacteria | 565 |
| 453 | Ga0587080_021206 | 3300059503 | Bacteria | 1067 |
| 454 | Ga0587089_002504 | 3300059509 | Bacteria | 1873 |
| 455 | Ga0587090_014809 | 3300059510 | Bacteria | 1145 |
| 456 | Ga0587106_001821 | 3300059605 | Bacteria | 1981 |
| 457 | Ga0587125_000201 | 3300059607 | Bacteria | 2966 |
| 458 | Ga0587101_003354 | 3300059623 | Bacteria | 1619 |
| 459 | Ga0587101_058421 | 3300059623 | Bacteria | 683 |
| 460 | Ga0587109_032265 | 3300059624 | Bacteria | 1000 |
| 461 | Ga0587062_001650 | 3300059639 | Bacteria | 1979 |
| 462 | Ga0587076_001067 | 3300059645 | Bacteria | 2654 |
| 463 | Ga0587079_001202 | 3300059647 | Bacteria | 2808 |
| 464 | Ga0587111_0000152 | 3300060346 | Bacteria | 5041 |
| 465 | Ga0501082_0021073 | 3300060353 | Bacteria | 5621 |
| 466 | Ga0501082_1059422 | 3300060353 | Bacteria | 709 |
| 467 | 2510308402 | 2510065057 | Bacteria | 6649661 |
| 468 | 2511501273 | 2511231052 | Bacteria | 6974333 |
| 469 | 2512532698 | 2512047086 | Bacteria | 6850303 |
| 470 | 2512971973 | 2512875026 | Bacteria | 6861065 |
| 471 | 2513587135 | 2513237086 | Bacteria | 7265287 |
| 472 | 2513594036 | 2513237087 | Bacteria | 5817514 |
| 473 | 2513607082 | 2513237089 | Bacteria | 6553624 |
| 474 | 2513620836 | 2513237091 | Bacteria | 6900273 |
| 475 | 2513886845 | 2513237140 | Bacteria | 7076289 |
| 476 | 2513906986 | 2513237143 | Bacteria | 6664116 |
| 477 | 2513909598 | 2513237144 | Bacteria | 7530820 |
| 478 | 2513987843 | 2513237156 | Bacteria | 6402557 |
| 479 | 2514008878 | 2513237160 | Bacteria | 6650282 |
| 480 | 2515613333 | 2515154107 | Bacteria | 6795637 |
| 481 | 2516209151 | 2516143018 | Bacteria | 6951533 |
| 482 | 2516892555 | 2516653046 | Bacteria | 6989037 |
| 483 | 2517569367 | 2517487022 | Bacteria | 7227575 |
| 484 | 2524454330 | 2524023207 | Bacteria | 6813453 |
| 485 | 2537874336 | 2537561587 | Bacteria | 5425293 |
| 486 | 2551678253 | 2551306084 | Bacteria | 8942552 |
| 487 | 2551687644 | 2551306085 | Bacteria | 7347181 |
| 488 | 2551728469 | 2551306091 | Bacteria | 7086830 |
| 489 | 2551730900 | 2551306091 | Bacteria | 7086830 |
| 490 | 2551742268 | 2551306093 | Bacteria | 7064773 |
| 491 | 2554248079 | 2554235003 | Bacteria | 5877155 |
| 492 | 2559295196 | 2558860242 | Bacteria | 5568029 |
| 493 | 2599333506 | 2599185156 | Bacteria | 5403036 |
| 494 | 2599601516 | 2599185210 | Bacteria | 5624189 |
| 495 | 2599721230 | 2599185236 | Bacteria | 6875203 |
| 496 | 2600192217 | 2599185352 | Bacteria | 7228948 |
| 497 | 2600375485 | 2600254933 | Bacteria | 4750527 |
| 498 | 2601612145 | 2600255279 | Bacteria | 5605316 |
| 499 | 2601749071 | 2600255308 | Bacteria | 5611129 |
| 500 | 2643808297 | 2643221557 | Bacteria | 7184309 |
| 501 | 2643857821 | 2643221568 | Bacteria | 5187270 |
| 502 | 2643919618 | 2643221582 | Bacteria | 5804683 |
| 503 | 2643963604 | 2643221591 | Bacteria | 4397626 |
| 504 | 2644068117 | 2643221610 | Bacteria | 7480339 |
| 505 | 2644108034 | 2643221618 | Bacteria | 7717186 |
| 506 | 2644150544 | 2643221626 | Bacteria | 8069654 |
| 507 | 2644165887 | 2643221629 | Bacteria | 5850260 |
| 508 | 2644207704 | 2643221637 | Bacteria | 5345260 |
| 509 | 2644310100 | 2643221655 | Bacteria | 7722067 |
| 510 | 2644335306 | 2643221659 | Bacteria | 7890716 |
| 511 | 2644347103 | 2643221662 | Bacteria | 5851492 |
| 512 | 2644379287 | 2643221668 | Bacteria | 7306521 |
| 513 | 2644410388 | 2643221674 | Bacteria | 3919126 |
| 514 | 2644419061 | 2643221675 | Bacteria | 7473456 |
| 515 | 2644450420 | 2643221680 | Bacteria | 7473610 |
| 516 | 2644520159 | 2643221693 | Bacteria | 5513853 |
| 517 | 2644544821 | 2643221698 | Bacteria | 7756764 |
| 518 | 2644617148 | 2643221712 | Bacteria | 7729434 |
| 519 | 2644654489 | 2643221718 | Bacteria | 5345506 |
| 520 | 2644677794 | 2643221723 | Bacteria | 7095460 |
| 521 | 2644687285 | 2643221726 | Bacteria | 7455827 |
| 522 | 2644735423 | 2643221734 | Bacteria | 5365412 |
| 523 | 2657686412 | 2657244999 | Bacteria | 5946535 |
| 524 | 2753359561 | 2751185800 | Bacteria | 5467370 |
| 525 | 2753460133 | 2751185821 | Bacteria | 6189929 |
| 526 | 2758641822 | 2758568016 | Bacteria | 5645291 |
| 527 | 2776913092 | 2775507049 | Bacteria | 6284736 |
| 528 | 2792624838 | 2791355091 | Bacteria | 6135441 |
| 529 | 2792630872 | 2791355092 | Bacteria | 6248105 |
| 530 | 2792642402 | 2791355094 | Bacteria | 7011481 |
| 531 | 2793282380 | 2791355253 | Bacteria | 5171699 |
| 532 | 2802719380 | 2802428858 | Bacteria | 6636079 |
| 533 | 2802723059 | 2802428859 | Bacteria | 6667919 |
| 534 | 2802734756 | 2802428860 | Bacteria | 6525526 |
| 535 | 2802741296 | 2802428861 | Bacteria | 6534206 |
| 536 | 2802745045 | 2802428862 | Bacteria | 6633353 |
| 537 | 2802751480 | 2802428863 | Bacteria | 6410669 |
| 538 | 2804751748 | 2802429268 | Bacteria | 6094027 |
| 539 | 2808985086 | 2808606387 | Bacteria | 5697198 |
| 540 | 2819559514 | 2818991439 | Bacteria | 6907412 |
| 541 | 2819683813 | 2818991461 | Bacteria | 7026071 |
| 542 | 2819720936 | 2818991467 | Bacteria | 5893227 |
| 543 | 2821124588 | 2821123053 | Bacteria | 7836056 |
| 544 | 2828310162 | 2828305725 | Bacteria | 4916900 |
| 545 | 2837653705 | 2837651117 | Bacteria | 3772164 |
| 546 | 2838079222 | 2838074704 | Bacteria | 6785777 |
| 547 | 2838675949 | 2838675328 | Bacteria | 4909118 |
| 548 | 2838714831 | 2838714209 | Bacteria | 5525906 |
| 549 | 2838721368 | 2838719591 | Bacteria | 5523910 |
| 550 | 2838725591 | 2838724970 | Bacteria | 4908691 |
| 551 | 2838742443 | 2838736955 | Bacteria | 5760694 |
| 552 | 2841846400 | 2841840854 | Bacteria | 5761912 |
| 553 | 2841848335 | 2841846520 | Bacteria | 5345850 |
| 554 | 2841859110 | 2841859092 | Bacteria | 5436171 |
| 555 | 2842125635 | 2842124991 | Bacteria | 5346824 |
| 556 | 2842130844 | 2842130223 | Bacteria | 4909145 |
| 557 | 2842146122 | 2842140634 | Bacteria | 5759631 |
| 558 | 2842153986 | 2842152218 | Bacteria | 4908957 |
| 559 | 2842171075 | 2842170452 | Bacteria | 5525737 |
| 560 | 2842177606 | 2842175837 | Bacteria | 4908771 |
| 561 | 2842187940 | 2842187318 | Bacteria | 5524014 |
| 562 | 2842212251 | 2842211629 | Bacteria | 5523832 |
| 563 | 2842226130 | 2842224351 | Bacteria | 5524473 |
| 564 | 2842515894 | 2842515876 | Bacteria | 5436280 |
| 565 | 2844169509 | 2844163670 | Bacteria | 7266046 |
| 566 | 2847418402 | 2847417321 | Bacteria | 6913799 |
| 567 | 2848993381 | 2848992105 | Bacteria | 6810864 |
| 568 | 2854912153 | 2854911287 | Bacteria | 5582813 |
| 569 | 2854919416 | 2854916844 | Bacteria | 5725939 |
| 570 | 2855831625 | 2855825444 | Bacteria | 6785811 |
| 571 | 2855840743 | 2855839649 | Bacteria | 7135830 |
| 572 | 2855873433 | 2855872281 | Bacteria | 6964271 |
| 573 | 2857532169 | 2857531043 | Bacteria | 6754041 |
| 574 | 2858801270 | 2858800743 | Bacteria | 6603254 |
| 575 | 2896386893 | 2896384573 | Bacteria | 7700774 |
| 576 | 2899794871 | 2899792073 | Bacteria | 4926588 |
| 577 | 2899807792 | 2899803654 | Bacteria | 5577784 |
| 578 | 2899848092 | 2899845264 | Bacteria | 5672268 |
| 579 | 2913301776 | 2913295892 | Bacteria | 6333755 |
| 580 | 2915985667 | 2915980308 | Bacteria | 6624279 |
| 581 | 2915991802 | 2915986958 | Bacteria | 6739310 |
| 582 | 2916000605 | 2915993759 | Bacteria | 7016183 |
| 583 | 2916007563 | 2916000859 | Bacteria | 6865702 |
| 584 | 2916008881 | 2916007675 | Bacteria | 6898660 |
| 585 | 2916018774 | 2916014648 | Bacteria | 6946486 |
| 586 | 2916026382 | 2916021584 | Bacteria | 6854472 |
| 587 | 2916034651 | 2916028427 | Bacteria | 6748433 |
| 588 | 2916040632 | 2916035215 | Bacteria | 6755766 |
| 589 | 2916048200 | 2916041962 | Bacteria | 6820487 |
| 590 | 2916054389 | 2916048683 | Bacteria | 6543552 |
| 591 | 2916060798 | 2916055098 | Bacteria | 6758838 |
| 592 | 2916068168 | 2916061851 | Bacteria | 6737736 |
| 593 | 2916075016 | 2916068649 | Bacteria | 6943657 |
| 594 | 2916079907 | 2916076590 | Bacteria | 6596108 |
| 595 | 2917699281 | 2917699015 | Bacteria | 7043791 |
| 596 | 2919114920 | 2919114240 | Bacteria | 5700270 |
| 597 | 2919167992 | 2919166419 | Bacteria | 4952238 |
| 598 | 2920824108 | 2920822456 | Bacteria | 6897201 |
| 599 | 2921208183 | 2921201388 | Bacteria | 6926299 |
| 600 | 2921209424 | 2921208531 | Bacteria | 6745326 |
| 601 | 2921242266 | 2921237296 | Bacteria | 6876710 |
| 602 | 2921248073 | 2921244191 | Bacteria | 6568419 |
| 603 | 2921256123 | 2921250672 | Bacteria | 6677771 |
| 604 | 2921263459 | 2921257292 | Bacteria | 6808382 |
| 605 | 2921270090 | 2921263974 | Bacteria | 6864552 |
| 606 | 2921285908 | 2921282425 | Bacteria | 6826397 |
| 607 | 2921296757 | 2921289301 | Bacteria | 7316391 |
| 608 | 2921299126 | 2921296804 | Bacteria | 7176999 |
| 609 | 2924147668 | 2924144063 | Bacteria | 6883928 |
| 610 | 2924157725 | 2924150972 | Bacteria | 7169444 |
| 611 | 2924165050 | 2924158325 | Bacteria | 7188855 |
| 612 | 2924172870 | 2924165586 | Bacteria | 7260590 |
| 613 | 2924179189 | 2924172951 | Bacteria | 6749356 |
| 614 | 2924184584 | 2924179722 | Bacteria | 6843264 |
| 615 | 2924192968 | 2924186466 | Bacteria | 6876637 |
| 616 | 2924199578 | 2924193448 | Bacteria | 6955718 |
| 617 | 2924204254 | 2924200457 | Bacteria | 6757188 |
| 618 | 2924213328 | 2924207177 | Bacteria | 6917007 |
| 619 | 2924221991 | 2924221636 | Bacteria | 7113495 |
| 620 | 2924233677 | 2924228884 | Bacteria | 6633132 |
| 621 | 2926755886 | 2926754445 | Bacteria | 5964435 |
| 622 | 2926762984 | 2926760298 | Bacteria | 5505990 |
| 623 | 2929140704 | 2929138655 | Bacteria | 5810547 |
| 624 | 2933008631 | 2933006813 | Bacteria | 4912075 |
| 625 | 2933011730 | 2933011516 | Bacteria | 5439334 |
| 626 | 2933596766 | 2933594066 | Bacteria | 5594265 |
| 627 | 2937001412 | 2936996657 | Bacteria | 6298727 |
| 628 | 2937008152 | 2937002841 | Bacteria | 6934057 |
| 629 | 2937015640 | 2937009748 | Bacteria | 6746052 |
| 630 | 2937019600 | 2937016420 | Bacteria | 6782579 |
| 631 | 2937028369 | 2937023124 | Bacteria | 6815156 |
| 632 | 2937034849 | 2937029754 | Bacteria | 6424026 |
| 633 | 2937040791 | 2937036028 | Bacteria | 6846469 |
| 634 | 2937049358 | 2937042894 | Bacteria | 6741576 |
| 635 | 2937056390 | 2937049772 | Bacteria | 6757901 |
| 636 | 2937060869 | 2937056579 | Bacteria | 7107896 |
| 637 | 2937069363 | 2937063883 | Bacteria | 7199456 |
| 638 | 2937076553 | 2937071275 | Bacteria | 6984483 |
| 639 | 2937079344 | 2937078374 | Bacteria | 6610289 |
| 640 | 2937088449 | 2937084907 | Bacteria | 6618516 |
| 641 | 2937096831 | 2937091812 | Bacteria | 6979387 |
| 642 | 2937105920 | 2937098957 | Bacteria | 7249374 |
| 643 | 2937113064 | 2937106411 | Bacteria | 6947143 |
| 644 | 2937118556 | 2937113482 | Bacteria | 6505872 |
| 645 | 2937125238 | 2937119839 | Bacteria | 6597547 |
| 646 | 2937129969 | 2937126314 | Bacteria | 6771275 |
| 647 | 2941499945 | 2941499720 | Bacteria | 7599444 |
| 648 | 2957377131 | 2957375807 | Bacteria | 6425588 |
| 649 | 2957385711 | 2957382221 | Bacteria | 6737050 |
| 650 | 2957388834 | 2957388812 | Bacteria | 6778072 |
| 651 | 2957401724 | 2957395598 | Bacteria | 6822399 |
| 652 | 2957406440 | 2957402308 | Bacteria | 6741770 |
| 653 | 2957414199 | 2957408893 | Bacteria | 6558585 |
| 654 | 2957418167 | 2957415311 | Bacteria | 6991633 |
| 655 | 2957429132 | 2957422303 | Bacteria | 7172205 |
| 656 | 2957435561 | 2957430029 | Bacteria | 7022557 |
| 657 | 2957443035 | 2957437181 | Bacteria | 6568994 |
| 658 | 2957449774 | 2957443900 | Bacteria | 6869977 |
| 659 | 2957453197 | 2957450854 | Bacteria | 6765715 |
| 660 | 2957464197 | 2957457609 | Bacteria | 6967680 |
| 661 | 2957468115 | 2957464669 | Bacteria | 6568877 |
| 662 | 2957477674 | 2957471148 | Bacteria | 6797643 |
| 663 | 2957483693 | 2957478035 | Bacteria | 6756658 |
| 664 | 2957491290 | 2957484790 | Bacteria | 6703082 |
| 665 | 2957496673 | 2957491536 | Bacteria | 6695180 |
| 666 | 2957504891 | 2957498199 | Bacteria | 7126688 |
| 667 | 2957512931 | 2957505466 | Bacteria | 7253085 |
| 668 | 2960586009 | 2960584000 | Bacteria | 6864594 |
| 669 | 2960593524 | 2960591022 | Bacteria | 6622873 |
| 670 | 2960602387 | 2960597568 | Bacteria | 6550735 |
| 671 | 2960609000 | 2960603979 | Bacteria | 6898737 |
| 672 | 2960616763 | 2960610863 | Bacteria | 6691244 |
| 673 | 2960623102 | 2960617483 | Bacteria | 6727748 |
| 674 | 2960630975 | 2960624210 | Bacteria | 6875384 |
| 675 | 2960636897 | 2960631154 | Bacteria | 6732508 |
| 676 | 2960639647 | 2960637947 | Bacteria | 7296468 |
| 677 | 2960652512 | 2960645483 | Bacteria | 7211087 |
| 678 | 2960655266 | 2960652885 | Bacteria | 7083688 |
| 679 | 2960666651 | 2960660292 | Bacteria | 7041660 |
| 680 | 2960673108 | 2960667422 | Bacteria | 6763020 |
| 681 | 2960677294 | 2960674078 | Bacteria | 6609048 |
| 682 | 2960686306 | 2960680706 | Bacteria | 6624464 |
| 683 | 2960693515 | 2960687367 | Bacteria | 6535474 |
| 684 | 2960700508 | 2960693952 | Bacteria | 6749742 |
| 685 | 2964611278 | 2964607997 | Bacteria | 7101408 |
| 686 | 2964621253 | 2964615318 | Bacteria | 6809089 |
| 687 | 2964626449 | 2964621998 | Bacteria | 6834995 |
| 688 | 2964635555 | 2964628898 | Bacteria | 7083044 |
| 689 | 2964641218 | 2964636051 | Bacteria | 7091832 |
| 690 | 2964647065 | 2964643177 | Bacteria | 6820887 |
| 691 | 2964655518 | 2964649959 | Bacteria | 6675118 |
| 692 | 2964661947 | 2964656573 | Bacteria | 7100150 |
| 693 | 2964670116 | 2964663802 | Bacteria | 7019362 |
| 694 | 2964677219 | 2964670856 | Bacteria | 6851364 |
| 695 | 2964684937 | 2964678106 | Bacteria | 6792020 |
| 696 | 2964691771 | 2964685014 | Bacteria | 6839111 |
| 697 | 2964698502 | 2964691889 | Bacteria | 6802758 |
| 698 | 2964703426 | 2964698721 | Bacteria | 6765331 |
| 699 | 2964710555 | 2964705432 | Bacteria | 7114648 |
| 700 | 2964713692 | 2964712639 | Bacteria | 6695970 |
| 701 | 2964721086 | 2964719344 | Bacteria | 7286602 |
| 702 | 2967671048 | 2967664464 | Bacteria | 6948836 |
| 703 | 2967672372 | 2967671571 | Bacteria | 7021409 |
| 704 | 2967683408 | 2967678726 | Bacteria | 7264382 |
| 705 | 2967692234 | 2967686174 | Bacteria | 6678622 |
| 706 | 2967694496 | 2967693043 | Bacteria | 6804451 |
| 707 | 2967702496 | 2967699805 | Bacteria | 6854538 |
| 708 | 2967714194 | 2967706974 | Bacteria | 7186053 |
| 709 | 2967718843 | 2967714385 | Bacteria | 7000047 |
| 710 | 2967726171 | 2967721400 | Bacteria | 7073753 |
| 711 | 2967729651 | 2967728569 | Bacteria | 6641507 |
| 712 | 2967739543 | 2967735183 | Bacteria | 6827012 |
| 713 | 2967745159 | 2967742019 | Bacteria | 6794534 |
| 714 | 2967754770 | 2967748971 | Bacteria | 6733771 |
| 715 | 2967762227 | 2967755722 | Bacteria | 6814706 |
| 716 | 2967766739 | 2967762386 | Bacteria | 6923502 |
| 717 | 2967775199 | 2967769361 | Bacteria | 6587838 |
| 718 | 2967782608 | 2967775926 | Bacteria | 6738189 |
| 719 | 2970026362 | 2970019648 | Bacteria | 7072033 |
| 720 | 2970033121 | 2970026789 | Bacteria | 6785236 |
| 721 | 2970034148 | 2970033650 | Bacteria | 7118744 |
| 722 | 2970046970 | 2970040964 | Bacteria | 6731123 |
| 723 | 2970051795 | 2970047711 | Bacteria | 7088379 |
| 724 | 2970060506 | 2970054988 | Bacteria | 6611507 |
| 725 | 2970062281 | 2970061556 | Bacteria | 7099761 |
| 726 | 2970069231 | 2970068827 | Bacteria | 7123112 |
| 727 | 2970079547 | 2970076120 | Bacteria | 6697332 |
| 728 | 2970086677 | 2970082768 | Bacteria | 6183754 |
| 729 | 2970091738 | 2970088815 | Bacteria | 6933825 |
| 730 | 2970102539 | 2970095765 | Bacteria | 6936963 |
| 731 | 2970107857 | 2970102677 | Bacteria | 6812532 |
| 732 | 2970115556 | 2970109326 | Bacteria | 6863976 |
| 733 | 2970120782 | 2970116247 | Bacteria | 6501857 |
| 734 | 2970128519 | 2970122695 | Bacteria | 6625855 |
| 735 | 2970129814 | 2970129317 | Bacteria | 6806560 |
| 736 | 2970143451 | 2970136068 | Bacteria | 7207982 |
| 737 | 2970149811 | 2970143518 | Bacteria | 6446480 |
| 738 | 2970156336 | 2970149975 | Bacteria | 6779706 |
| 739 | 2970158341 | 2970156795 | Bacteria | 7168044 |
| 740 | 2970167607 | 2970164137 | Bacteria | 6861252 |
| 741 | 2970173588 | 2970170962 | Bacteria | 6876229 |
| 742 | 2970178667 | 2970177841 | Bacteria | 6768001 |
| 743 | 2970190747 | 2970184632 | Bacteria | 7054431 |
| 744 | 2970198216 | 2970191845 | Bacteria | 7032787 |
| 745 | 2977520502 | 2977516862 | Bacteria | 6940108 |
| 746 | 2977530225 | 2977523885 | Bacteria | 6960446 |
| 747 | 2977532345 | 2977530762 | Bacteria | 6951399 |
| 748 | 2977541447 | 2977537788 | Bacteria | 6929320 |
| 749 | 2977551372 | 2977544691 | Bacteria | 6875412 |
| 750 | 2977557499 | 2977551784 | Bacteria | 7125765 |
| 751 | 2977559958 | 2977558990 | Bacteria | 6863948 |
| 752 | 2977569829 | 2977565890 | Bacteria | 6901543 |
| 753 | 2977578819 | 2977572785 | Bacteria | 6763888 |
| 754 | 2977583943 | 2977579622 | Bacteria | 6772100 |
| 755 | 2978974443 | 2978969890 | Bacteria | 5400756 |
| 756 | 2979094523 | 2979089926 | Bacteria | 5670289 |
| 757 | 2979098094 | 2979095461 | Bacteria | 5669583 |
| 758 | 2979103765 | 2979100975 | Bacteria | 5423623 |
| 759 | 2984511669 | 2984509177 | Bacteria | 5274802 |
| 760 | 2984521970 | 2984518228 | Bacteria | 5277463 |
| 761 | 2984541268 | 2984537506 | Bacteria | 5277481 |
| 762 | 2984589781 | 2984587000 | Bacteria | 5263363 |
| 763 | 2984603546 | 2984601300 | Bacteria | 5455244 |
| 764 | 2989353401 | 2989349275 | Bacteria | 6349068 |
| 765 | 2989775906 | 2989771324 | Bacteria | 5605128 |
| 766 | 2996898883 | 2996893221 | Bacteria | 5823108 |
| 767 | 3003933078 | 3003930520 | Bacteria | 5667563 |
| 768 | 643825412 | 643692032 | Bacteria | 6891900 |
| 769 | 648741354 | 648276728 | Bacteria | 6968865 |
| 770 | 650740402 | 650716007 | Bacteria | 5573770 |
| 771 | 8001845412 | 8001845381 | Bacteria | 5804942 |
| 772 | 8003571464 | 8003570095 | Bacteria | 5747666 |
| 773 | 8003993241 | 8003992118 | Bacteria | 7266902 |
| 774 | 8004000498 | 8003999396 | Bacteria | 7063185 |
| 775 | 8024489488 | 8024486573 | Bacteria | 6540512 |
| 776 | 8045865491 | 8045864390 | Bacteria | 5043873 |
| 777 | 8054462017 | 8054460903 | Bacteria | 4872905 |
| 778 | 8054562913 | 8054558443 | Bacteria | 5204801 |
| 779 | Ga0501034_0007127 | |||
| 780 | JGI24740J21852_10002133 | |||
| 781 | JGI24740J21852_10038834 | |||
| 782 | JGI25158J39367_1001134 | |||
| 783 | JGI25152J39213_1036488 | |||
| 784 | JGI25159J45721_1001742 | |||
| 785 | JGI25151J46595_10000038 | |||
| 786 | JGI25151J46595_10033134 | |||
| 787 | JGI25165J46597_1013643 | |||
| 788 | JGI25160J50197_1002401 | |||
| 789 | JGI25160J50197_1023262 | |||
| 790 | JGI25161J50226_1002372 | |||
| 791 | Ga0006562J51391_1004293 | |||
| 792 | Ga0006562J51391_1024742 | |||
| 793 | Ga0055526_1003723 | |||
| 794 | Ga0055526_1006649 | |||
| 795 | Ga0055526_1007926 | |||
| 796 | Ga0055526_1011996 | |||
| 797 | Ga0055526_1012008 | |||
| 798 | Ga0055524_1006440 | |||
| 799 | Ga0055524_1073072 | |||
| 800 | Ga0055536_1001886 | |||
| 801 | Ga0055536_1002273 | |||
| 802 | Ga0055528_1067071 | |||
| 803 | Ga0055530_10024067 | |||
| 804 | Ga0055531_10002421 | |||
| 805 | Ga0055531_10017723 | |||
| 806 | Ga0055543_1000856 | |||
| 807 | Ga0058863_11693745 | |||
| 808 | Ga0065165_1002620 | |||
| 809 | Ga0070683_100320604 | |||
| 810 | Ga0070683_101890700 | |||
| 811 | Ga0070683_102389569 | |||
| 812 | Ga0068869_100104915 | |||
| 813 | Ga0070666_11467565 | |||
| 814 | Ga0070680_100019894 | |||
| 815 | Ga0070680_101866482 | |||
| 816 | Ga0070682_100023836 | |||
| 817 | Ga0070660_100440227 | |||
| 818 | Ga0070691_10009880 | |||
| 819 | Ga0070661_101186508 | |||
| 820 | Ga0070692_10781994 | |||
| 821 | Ga0070668_101925805 | |||
| 822 | Ga0070673_101480685 | |||
| 823 | Ga0070688_100380571 | |||
| 824 | Ga0070659_101249388 | |||
| 825 | Ga0070703_10308472 | |||
| 826 | Ga0070705_100091317 | |||
| 827 | Ga0070694_100222560 | |||
| 828 | Ga0070663_100136781 | |||
| 829 | Ga0070663_101742180 | |||
| 830 | Ga0070678_100021594 | |||
| 831 | Ga0070681_10007102 | |||
| 832 | Ga0070679_100035523 | |||
| 833 | Ga0070684_101563992 | |||
| 834 | Ga0068853_100006917 | |||
| 835 | Ga0070695_100090950 | |||
| 836 | Ga0070696_100006293 | |||
| 837 | Ga0070693_100011024 | |||
| 838 | Ga0070665_102502843 | |||
| 839 | Ga0070704_100332501 | |||
| 840 | Ga0070664_100068199 | |||
| 841 | Ga0068857_100128196 | |||
| 842 | Ga0068857_101469202 | |||
| 843 | Ga0070702_100213515 | |||
| 844 | Ga0068852_101644606 | |||
| 845 | Ga0068864_102115899 | |||
| 846 | Ga0068870_10799251 | |||
| 847 | Ga0068860_100163395 | |||
| 848 | Ga0075365_10382100 | |||
| 849 | Ga0075365_11043898 | |||
| 850 | Ga0075364_11060089 | |||
| 851 | Ga0075362_10232402 | |||
| 852 | Ga0075362_10479714 | |||
| 853 | Ga0075369_10079325 | |||
| 854 | Ga0075370_10579154 | |||
| 855 | Ga0075431_101356955 | |||
| 856 | Ga0068865_100456060 | |||
| 857 | Ga0079104_1037364 | |||
| 858 | Ga0099826_10165412 | |||
| 859 | Ga0105243_10014127 | |||
| 860 | Ga0105242_10178320 | |||
| 861 | Ga0105237_10016531 | |||
| 862 | Ga0105238_10215115 | |||
| 863 | Ga0105238_11112508 | |||
| 864 | Ga0105239_10608275 | |||
| 865 | Ga0157370_10420619 | |||
| 866 | Ga0157369_10087882 | |||
| 867 | Ga0171462_1042 | |||
| 868 | Ga0157372_10469158 | |||
| 869 | Ga0157375_10341498 | |||
| 870 | Ga0163163_10751432 | |||
| 871 | Ga0157380_12868643 | |||
| 872 | Ga0157379_10273185 | |||
| 873 | Ga0157379_10642369 | |||
| 874 | Ga0157376_10492824 | |||
| 875 | Ga0206353_11755279 | |||
| 876 | Ga0214542_1023288 | |||
| 877 | Ga0214543_1005345 | |||
| 878 | Ga0213872_10012804 | |||
| 879 | Ga0213872_10103949 | |||
| 880 | Ga0213872_10183657 | |||
| 881 | Ga0209436_100747 | |||
| 882 | Ga0209673_1037691 | |||
| 883 | Ga0209130_1000007 | |||
| 884 | Ga0209130_1008921 | |||
| 885 | Ga0209675_1002527 | |||
| 886 | Ga0209676_1001545 | |||
| 887 | Ga0209676_1028639 | |||
| 888 | Ga0209025_1000014 | |||
| 889 | Ga0209025_1000303 | |||
| 890 | Ga0209025_1179903 | |||
| 891 | Ga0209564_1000140 | |||
| 892 | Ga0209564_1002872 | |||
| 893 | Ga0209564_1003215 | |||
| 894 | Ga0209050_1002103 | |||
| 895 | Ga0209256_1000108 | |||
| 896 | Ga0209256_1000540 | |||
| 897 | Ga0207426_1000064 | |||
| 898 | Ga0209051_1002149 | |||
| 899 | Ga0209257_1000817 | |||
| 900 | Ga0209257_1061703 | |||
| 901 | Ga0207688_10483414 | |||
| 902 | Ga0207699_10775565 | |||
| 903 | Ga0207643_10882990 | |||
| 904 | Ga0207654_10065182 | |||
| 905 | Ga0207707_10017730 | |||
| 906 | Ga0207671_10301103 | |||
| 907 | Ga0207660_10003004 | |||
| 908 | Ga0207660_11379492 | |||
| 909 | Ga0207652_10232689 | |||
| 910 | Ga0207690_10008933 | |||
| 911 | Ga0207686_10481845 | |||
| 912 | Ga0207709_10018685 | |||
| 913 | Ga0207689_10101680 | |||
| 914 | Ga0207679_10196515 | |||
| 915 | Ga0207667_10128005 | |||
| 916 | Ga0207658_10055258 | |||
| 917 | Ga0207639_11069964 | |||
| 918 | Ga0207678_10000118 | |||
| 919 | Ga0207674_10135964 | |||
| 920 | Ga0207675_102134487 | |||
| 921 | Ga0207683_10026403 | |||
| 922 | Ga0207698_10074815 | |||
| 923 | Ga0209282_1086341 | |||
| 924 | Ga0209974_10092975 | |||
| 925 | Ga0209974_10099296 | |||
| 926 | Ga0268264_10075388 | |||
| 927 | Ga0265319_1072110 | |||
| 928 | Ga0265334_10134553 | |||
| 929 | Ga0265318_10009217 | |||
| 930 | Ga0307515_10017924 | |||
| 931 | Ga0265320_10061498 | |||
| 932 | Ga0265331_10063094 | |||
| 933 | Ga0307513_10402061 | |||
| 934 | Ga0307408_100504141 | |||
| 935 | Ga0316579_10255456 | |||
| 936 | Ga0265342_10111276 | |||
| 937 | Ga0307405_10055833 | |||
| 938 | Ga0307410_10470776 | |||
| 939 | Ga0307412_10758338 | |||
| 940 | Ga0307416_100606726 | |||
| 941 | Ga0307414_10139116 | |||
| 942 | Ga0307414_10746594 | |||
| 943 | Ga0307411_10326731 | |||
| 944 | Ga0307415_100903696 | |||
| 945 | Ga0373948_0190212 | |||
| 946 | Ga0373934_0049988 | |||
| 947 | Ga0373936_0210250 | |||
| 948 | Ga0373939_0066937 | |||
| 949 | Ga0373953_0264496 | |||
| 950 | Ga0373957_0037891 | |||
| 951 | Ga0373955_0045569 | |||
| 952 | Ga0373924_0513905 | |||
| 953 | Ga0373931_0019779 | |||
| 954 | Ga0373933_0127218 | |||
| 955 | Ga0316584_0827847 | |||
| 956 | Ga0395899_0181581 | |||
| 957 | Ga0395900_0300836 | |||
| 958 | Ga0395900_0439171 | |||
| 959 | Ga0395898_0007760 | |||
| 960 | Ga0395898_0509502 | |||
| 961 | Ga0395905_0032064 | |||
| 962 | Ga0395901_0102929 | |||
| 963 | Ga0395901_1974174 | |||
| 964 | Ga0400483_002645 | |||
| 965 | Ga0400483_032695 | |||
| 966 | Ga0400489_86969 | |||
| 967 | Ga0237816_03981 | |||
| 968 | Ga0436361_0002743 | |||
| 969 | Ga0436361_0291348 | |||
| 970 | Ga0436361_0925804 | |||
| 971 | Ga0436361_1086504 | |||
| 972 | Ga0436362_0680415 | |||
| 973 | Ga0439436_0051371 | |||
| 974 | Ga0439453_0043502 | |||
| 975 | Ga0439466_0062082 | |||
| 976 | Ga0439466_0090356 | |||
| 977 | Ga0439465_0114390 | |||
| 978 | Ga0439465_0189032 | |||
| 979 | Ga0439465_0232320 | |||
| 980 | Ga0451789_1140541 | |||
| 981 | Ga0451791_1659963 | |||
| 982 | Ga0451797_1119904 | |||
| 983 | Ga0451800_1262250 | |||
| 984 | Ga0451841_1428859 | |||
| 985 | Ga0451855_1035573 | |||
| 986 | Ga0439442_040365 | |||
| 987 | Ga0439445_0014796 | |||
| 988 | Ga0439432_159318 | |||
| 989 | Ga0439449_0006732 | |||
| 990 | Ga0439452_028778 | |||
| 991 | Ga0439434_0022899 | |||
| 992 | Ga0466965_0043824 | |||
| 993 | Ga0466965_0205491 | |||
| 994 | Ga0466965_0353017 | |||
| 995 | Ga0466968_0039813 | |||
| 996 | Ga0495617_130347 | |||
| 997 | Ga0495651_0137565 | |||
| 998 | Ga0495653_0956443 | |||
| 999 | Ga0495639_0567609 | |||
| 1000 | Ga0495585_0262220 | |||
| 1001 | Ga0495608_0103481 | |||
| 1002 | Ga0495652_0168520 | |||
| 1003 | Ga0495587_0020378 | |||
| 1004 | Ga0495667_0460271 | |||
| 1005 | Ga0495657_0117764 | |||
| 1006 | Ga0495599_0298978 | |||
| 1007 | Ga0495670_0530728 | |||
| 1008 | Ga0495680_0258167 | |||
| 1009 | Ga0495675_0040498 | |||
| 1010 | Ga0496100_0316414 | |||
| 1011 | Ga0496101_0250750 | |||
| 1012 | Ga0496102_0021900 | |||
| 1013 | Ga0496102_0622502 | |||
| 1014 | Ga0496102_1516812 | |||
| 1015 | Ga0496102_1792465 | |||
| 1016 | Ga0496103_0005971 | |||
| 1017 | Ga0496104_0017664 | |||
| 1018 | Ga0496104_0038871 | |||
| 1019 | Ga0496104_1101570 | |||
| 1020 | Ga0496105_0180037 | |||
| 1021 | Ga0496106_0004608 | |||
| 1022 | Ga0496107_0008725 | |||
| 1023 | Ga0496110_0355217 | |||
| 1024 | Ga0496114_0381187 | |||
| 1025 | Ga0496114_1518847 | |||
| 1026 | Ga0496115_0001671 | |||
| 1027 | Ga0496115_0999984 | |||
| 1028 | Ga0496116_0083743 | |||
| 1029 | Ga0496116_0121347 | |||
| 1030 | Ga0496116_0369072 | |||
| 1031 | Ga0496117_0085746 | |||
| 1032 | Ga0496117_0115516 | |||
| 1033 | Ga0496117_0280764 | |||
| 1034 | Ga0496119_0276186 | |||
| 1035 | Ga0496121_0018961 | |||
| 1036 | Ga0496121_0058894 | |||
| 1037 | Ga0496121_0473270 | |||
| 1038 | Ga0496122_0019871 | |||
| 1039 | Ga0496122_0344328 | |||
| 1040 | Ga0496123_0008564 | |||
| 1041 | Ga0496123_0073670 | |||
| 1042 | Ga0496124_0326832 | |||
| 1043 | Ga0496125_0000815 | |||
| 1044 | Ga0496125_0053349 | |||
| 1045 | Ga0496125_0155181 | |||
| 1046 | Ga0496125_0410546 | |||
| 1047 | Ga0496126_0036822 | |||
| 1048 | Ga0496126_0269663 | |||
| 1049 | Ga0501306_000444 | |||
| 1050 | Ga0501306_001033 | |||
| 1051 | Ga0501306_004298 | |||
| 1052 | Ga0501306_007899 | |||
| 1053 | Ga0501308_064523 | |||
| 1054 | Ga0501309_004872 | |||
| 1055 | Ga0501309_022451 | |||
| 1056 | Ga0501310_001976 | |||
| 1057 | Ga0501310_015362 | |||
| 1058 | Ga0501310_063217 | |||
| 1059 | Ga0501341_05883 | |||
| 1060 | Ga0501304_000523 | |||
| 1061 | Ga0501305_009509 | |||
| 1062 | Ga0501305_089282 | |||
| 1063 | Ga0501307_026867 | |||
| 1064 | Ga0501307_040231 | |||
| 1065 | Ga0501307_079477 | |||
| 1066 | Ga0501294_026713 | |||
| 1067 | Ga0501303_037340 | |||
| 1068 | Ga0501311_006601 | |||
| 1069 | Ga0501311_050333 | |||
| 1070 | Ga0501311_100954 | |||
| 1071 | Ga0501312_002690 | |||
| 1072 | Ga0501314_000486 | |||
| 1073 | Ga0501314_002564 | |||
| 1074 | Ga0501314_002648 | |||
| 1075 | Ga0501315_000060 | |||
| 1076 | Ga0501315_040696 | |||
| 1077 | Ga0501315_053140 | |||
| 1078 | Ga0501315_103836 | |||
| 1079 | Ga0501316_000132 | |||
| 1080 | Ga0501316_051721 | |||
| 1081 | Ga0501317_000084 | |||
| 1082 | Ga0501318_008515 | |||
| 1083 | Ga0501319_002038 | |||
| 1084 | Ga0501320_005669 | |||
| 1085 | Ga0501320_007634 | |||
| 1086 | Ga0501320_016479 | |||
| 1087 | Ga0501321_033209 | |||
| 1088 | Ga0501322_018829 | |||
| 1089 | Ga0501323_005178 | |||
| 1090 | Ga0501325_003833 | |||
| 1091 | Ga0501326_04357 | |||
| 1092 | Ga0501332_01776 | |||
| 1093 | Ga0501335_000789 | |||
| 1094 | Ga0501031_0000651 | |||
| 1095 | Ga0501031_0004402 | |||
| 1096 | Ga0501032_0000111 | |||
| 1097 | Ga0501032_0006160 | |||
| 1098 | Ga0501032_0014074 | |||
| 1099 | Ga0501032_0173231 | |||
| 1100 | Ga0501032_0320313 | |||
| 1101 | Ga0501032_0345929 | |||
| 1102 | Ga0501032_0491575 | |||
| 1103 | Ga0501033_0007122 | |||
| 1104 | Ga0501033_0010287 | |||
| 1105 | Ga0501033_0080471 | |||
| 1106 | Ga0501033_0194969 | |||
| 1107 | Ga0501033_0341631 | |||
| 1108 | Ga0501033_0387415 | |||
| 1109 | Ga0501033_0857555 | |||
| 1110 | Ga0501034_0000208 | |||
| 1111 | Ga0501034_0004897 | |||
| 1112 | Ga0501034_0009019 | |||
| 1113 | Ga0501034_0009460 | |||
| 1114 | Ga0501034_0030885 | |||
| 1115 | Ga0501034_0053012 | |||
| 1116 | Ga0501034_0069393 | |||
| 1117 | Ga0501034_1117733 | |||
| 1118 | Ga0501034_1231203 | |||
| 1119 | Ga0501036_0002605 | |||
| 1120 | Ga0501036_0074242 | |||
| 1121 | Ga0501036_0087845 | |||
| 1122 | Ga0501036_0194494 | |||
| 1123 | Ga0501036_0454935 | |||
| 1124 | Ga0501036_0862776 | |||
| 1125 | Ga0501036_1209638 | |||
| 1126 | Ga0501037_0000131 | |||
| 1127 | Ga0501037_0007990 | |||
| 1128 | Ga0501037_0061483 | |||
| 1129 | Ga0501037_0094809 | |||
| 1130 | Ga0501037_0135567 | |||
| 1131 | Ga0501037_0183612 | |||
| 1132 | Ga0501037_0338366 | |||
| 1133 | Ga0501037_0841677 | |||
| 1134 | Ga0501038_0000109 | |||
| 1135 | Ga0501038_0009962 | |||
| 1136 | Ga0501038_0047294 | |||
| 1137 | Ga0501038_0213052 | |||
| 1138 | Ga0501038_0655218 | |||
| 1139 | Ga0501038_0813200 | |||
| 1140 | Ga0501039_0000072 | |||
| 1141 | Ga0501039_0002279 | |||
| 1142 | Ga0501039_0765045 | |||
| 1143 | Ga0501040_0046602 | |||
| 1144 | Ga0501040_0300420 | |||
| 1145 | Ga0501042_0724963 | |||
| 1146 | Ga0501043_0015219 | |||
| 1147 | Ga0501043_0128759 | |||
| 1148 | Ga0501043_0195389 | |||
| 1149 | Ga0501046_0004977 | |||
| 1150 | Ga0501046_0016665 | |||
| 1151 | Ga0501046_0528686 | |||
| 1152 | Ga0501047_0001212 | |||
| 1153 | Ga0501047_0017299 | |||
| 1154 | Ga0501047_0058328 | |||
| 1155 | Ga0501047_0317813 | |||
| 1156 | Ga0501047_0380412 | |||
| 1157 | Ga0501047_0682282 | |||
| 1158 | Ga0501047_1205785 | |||
| 1159 | Ga0501048_0000501 | |||
| 1160 | Ga0501048_0166830 | |||
| 1161 | Ga0501067_0001102 | |||
| 1162 | Ga0501067_0021386 | |||
| 1163 | Ga0501069_0584467 | |||
| 1164 | Ga0501070_0015591 | |||
| 1165 | Ga0501070_0016943 | |||
| 1166 | Ga0501070_0110480 | |||
| 1167 | Ga0501070_0363567 | |||
| 1168 | Ga0501070_0487433 | |||
| 1169 | Ga0501070_1114929 | |||
| 1170 | Ga0501071_0650932 | |||
| 1171 | Ga0501072_0596597 | |||
| 1172 | Ga0501073_0025762 | |||
| 1173 | Ga0501073_0091635 | |||
| 1174 | Ga0501073_0208047 | |||
| 1175 | Ga0501073_0713502 | |||
| 1176 | Ga0501073_0960866 | |||
| 1177 | Ga0501074_0886865 | |||
| 1178 | Ga0501076_1206125 | |||
| 1179 | Ga0501252_088693 | |||
| 1180 | Ga0501257_101426 | |||
| 1181 | Ga0501080_0000005 | |||
| 1182 | Ga0501080_0141993 | |||
| 1183 | Ga0501083_0197166 | |||
| 1184 | Ga0501083_0597580 | |||
| 1185 | Ga0501083_1164584 | |||
| 1186 | Ga0501263_026500 | |||
| 1187 | Ga0501280_003866 | |||
| 1188 | Ga0501035_0000049 | |||
| 1189 | Ga0501035_0000347 | |||
| 1190 | Ga0501035_0009004 | |||
| 1191 | Ga0501035_0112268 | |||
| 1192 | Ga0501035_0591111 | |||
| 1193 | Ga0501035_1098899 | |||
| 1194 | Ga0501044_0000030 | |||
| 1195 | Ga0501044_0000234 | |||
| 1196 | Ga0501044_0022577 | |||
| 1197 | Ga0501044_0050656 | |||
| 1198 | Ga0501044_0062595 | |||
| 1199 | Ga0501044_0141730 | |||
| 1200 | Ga0501044_0737439 | |||
| 1201 | Ga0501044_0876789 | |||
| 1202 | Ga0501044_1115511 | |||
| 1203 | Ga0501044_1164998 | |||
| 1204 | Ga0501044_1203502 | |||
| 1205 | Ga0501044_1404140 | |||
| 1206 | Ga0501045_0262165 | |||
| 1207 | nmdc:mga0yw44_31343_c1 | |||
| 1208 | nmdc:mga0k408_304127_c1 | |||
| 1209 | nmdc:mga07m45_52036_c1 | |||
| 1210 | nmdc:mga0sz30_69529_c1 | |||
| 1211 | Ga0495612_0061025 | |||
| 1212 | Ga0495619_1165051 | |||
| 1213 | Ga0500595_071600 | |||
| 1214 | Ga0500608_136998 | |||
| 1215 | Ga0500618_115134 | |||
| 1216 | Ga0500559_0144555 | |||
| 1217 | Ga0500559_0471422 | |||
| 1218 | Ga0500616_0009749 | |||
| 1219 | Ga0500616_0011972 | |||
| 1220 | Ga0500616_0019860 | |||
| 1221 | Ga0500627_0074523 | |||
| 1222 | Ga0500627_0141891 | |||
| 1223 | Ga0500634_0000031 | |||
| 1224 | Ga0501084_0807405 | |||
| 1225 | Ga0587084_021570 | |||
| 1226 | Ga0587066_200630 | |||
| 1227 | Ga0587077_000009 | |||
| 1228 | Ga0587077_001192 | |||
| 1229 | Ga0587077_026576 | |||
| 1230 | Ga0587077_186543 | |||
| 1231 | Ga0587080_021206 | |||
| 1232 | Ga0587089_002504 | |||
| 1233 | Ga0587090_014809 | |||
| 1234 | Ga0587106_001821 | |||
| 1235 | Ga0587125_000201 | |||
| 1236 | Ga0587101_003354 | |||
| 1237 | Ga0587101_058421 | |||
| 1238 | Ga0587109_032265 | |||
| 1239 | Ga0587062_001650 | |||
| 1240 | Ga0587076_001067 | |||
| 1241 | Ga0587079_001202 | |||
| 1242 | Ga0587111_0000152 | |||
| 1243 | Ga0501082_0021073 | |||
| 1244 | Ga0501082_1059422 | |||
| 1245 | 2510308402 | |||
| 1246 | 2511501273 | |||
| 1247 | 2512532698 | |||
| 1248 | 2512971973 | |||
| 1249 | 2513587135 | |||
| 1250 | 2513594036 | |||
| 1251 | 2513607082 | |||
| 1252 | 2513620836 | |||
| 1253 | 2513886845 | |||
| 1254 | 2513906986 | |||
| 1255 | 2513909598 | |||
| 1256 | 2513987843 | |||
| 1257 | 2514008878 | |||
| 1258 | 2515613333 | |||
| 1259 | 2516209151 | |||
| 1260 | 2516892555 | |||
| 1261 | 2517569367 | |||
| 1262 | 2524454330 | |||
| 1263 | 2537874336 | |||
| 1264 | 2551678253 | |||
| 1265 | 2551687644 | |||
| 1266 | 2551728469 | |||
| 1267 | 2551730900 | |||
| 1268 | 2551742268 | |||
| 1269 | 2554248079 | |||
| 1270 | 2559295196 | |||
| 1271 | 2599333506 | |||
| 1272 | 2599601516 | |||
| 1273 | 2599721230 | |||
| 1274 | 2600192217 | |||
| 1275 | 2600375485 | |||
| 1276 | 2601612145 | |||
| 1277 | 2601749071 | |||
| 1278 | 2643808297 | |||
| 1279 | 2643857821 | |||
| 1280 | 2643919618 | |||
| 1281 | 2643963604 | |||
| 1282 | 2644068117 | |||
| 1283 | 2644108034 | |||
| 1284 | 2644150544 | |||
| 1285 | 2644165887 | |||
| 1286 | 2644207704 | |||
| 1287 | 2644310100 | |||
| 1288 | 2644335306 | |||
| 1289 | 2644347103 | |||
| 1290 | 2644379287 | |||
| 1291 | 2644410388 | |||
| 1292 | 2644419061 | |||
| 1293 | 2644450420 | |||
| 1294 | 2644520159 | |||
| 1295 | 2644544821 | |||
| 1296 | 2644617148 | |||
| 1297 | 2644654489 | |||
| 1298 | 2644677794 | |||
| 1299 | 2644687285 | |||
| 1300 | 2644735423 | |||
| 1301 | 2657686412 | |||
| 1302 | 2753359561 | |||
| 1303 | 2753460133 | |||
| 1304 | 2758641822 | |||
| 1305 | 2776913092 | |||
| 1306 | 2792624838 | |||
| 1307 | 2792630872 | |||
| 1308 | 2792642402 | |||
| 1309 | 2793282380 | |||
| 1310 | 2802719380 | |||
| 1311 | 2802723059 | |||
| 1312 | 2802734756 | |||
| 1313 | 2802741296 | |||
| 1314 | 2802745045 | |||
| 1315 | 2802751480 | |||
| 1316 | 2804751748 | |||
| 1317 | 2808985086 | |||
| 1318 | 2819559514 | |||
| 1319 | 2819683813 | |||
| 1320 | 2819720936 | |||
| 1321 | 2821124588 | |||
| 1322 | 2828310162 | |||
| 1323 | 2837653705 | |||
| 1324 | 2838079222 | |||
| 1325 | 2838675949 | |||
| 1326 | 2838714831 | |||
| 1327 | 2838721368 | |||
| 1328 | 2838725591 | |||
| 1329 | 2838742443 | |||
| 1330 | 2841846400 | |||
| 1331 | 2841848335 | |||
| 1332 | 2841859110 | |||
| 1333 | 2842125635 | |||
| 1334 | 2842130844 | |||
| 1335 | 2842146122 | |||
| 1336 | 2842153986 | |||
| 1337 | 2842171075 | |||
| 1338 | 2842177606 | |||
| 1339 | 2842187940 | |||
| 1340 | 2842212251 | |||
| 1341 | 2842226130 | |||
| 1342 | 2842515894 | |||
| 1343 | 2844169509 | |||
| 1344 | 2847418402 | |||
| 1345 | 2848993381 | |||
| 1346 | 2854912153 | |||
| 1347 | 2854919416 | |||
| 1348 | 2855831625 | |||
| 1349 | 2855840743 | |||
| 1350 | 2855873433 | |||
| 1351 | 2857532169 | |||
| 1352 | 2858801270 | |||
| 1353 | 2896386893 | |||
| 1354 | 2899794871 | |||
| 1355 | 2899807792 | |||
| 1356 | 2899848092 | |||
| 1357 | 2913301776 | |||
| 1358 | 2915985667 | |||
| 1359 | 2915991802 | |||
| 1360 | 2916000605 | |||
| 1361 | 2916007563 | |||
| 1362 | 2916008881 | |||
| 1363 | 2916018774 | |||
| 1364 | 2916026382 | |||
| 1365 | 2916034651 | |||
| 1366 | 2916040632 | |||
| 1367 | 2916048200 | |||
| 1368 | 2916054389 | |||
| 1369 | 2916060798 | |||
| 1370 | 2916068168 | |||
| 1371 | 2916075016 | |||
| 1372 | 2916079907 | |||
| 1373 | 2917699281 | |||
| 1374 | 2919114920 | |||
| 1375 | 2919167992 | |||
| 1376 | 2920824108 | |||
| 1377 | 2921208183 | |||
| 1378 | 2921209424 | |||
| 1379 | 2921242266 | |||
| 1380 | 2921248073 | |||
| 1381 | 2921256123 | |||
| 1382 | 2921263459 | |||
| 1383 | 2921270090 | |||
| 1384 | 2921285908 | |||
| 1385 | 2921296757 | |||
| 1386 | 2921299126 | |||
| 1387 | 2924147668 | |||
| 1388 | 2924157725 | |||
| 1389 | 2924165050 | |||
| 1390 | 2924172870 | |||
| 1391 | 2924179189 | |||
| 1392 | 2924184584 | |||
| 1393 | 2924192968 | |||
| 1394 | 2924199578 | |||
| 1395 | 2924204254 | |||
| 1396 | 2924213328 | |||
| 1397 | 2924221991 | |||
| 1398 | 2924233677 | |||
| 1399 | 2926755886 | |||
| 1400 | 2926762984 | |||
| 1401 | 2929140704 | |||
| 1402 | 2933008631 | |||
| 1403 | 2933011730 | |||
| 1404 | 2933596766 | |||
| 1405 | 2937001412 | |||
| 1406 | 2937008152 | |||
| 1407 | 2937015640 | |||
| 1408 | 2937019600 | |||
| 1409 | 2937028369 | |||
| 1410 | 2937034849 | |||
| 1411 | 2937040791 | |||
| 1412 | 2937049358 | |||
| 1413 | 2937056390 | |||
| 1414 | 2937060869 | |||
| 1415 | 2937069363 | |||
| 1416 | 2937076553 | |||
| 1417 | 2937079344 | |||
| 1418 | 2937088449 | |||
| 1419 | 2937096831 | |||
| 1420 | 2937105920 | |||
| 1421 | 2937113064 | |||
| 1422 | 2937118556 | |||
| 1423 | 2937125238 | |||
| 1424 | 2937129969 | |||
| 1425 | 2941499945 | |||
| 1426 | 2957377131 | |||
| 1427 | 2957385711 | |||
| 1428 | 2957388834 | |||
| 1429 | 2957401724 | |||
| 1430 | 2957406440 | |||
| 1431 | 2957414199 | |||
| 1432 | 2957418167 | |||
| 1433 | 2957429132 | |||
| 1434 | 2957435561 | |||
| 1435 | 2957443035 | |||
| 1436 | 2957449774 | |||
| 1437 | 2957453197 | |||
| 1438 | 2957464197 | |||
| 1439 | 2957468115 | |||
| 1440 | 2957477674 | |||
| 1441 | 2957483693 | |||
| 1442 | 2957491290 | |||
| 1443 | 2957496673 | |||
| 1444 | 2957504891 | |||
| 1445 | 2957512931 | |||
| 1446 | 2960586009 | |||
| 1447 | 2960593524 | |||
| 1448 | 2960602387 | |||
| 1449 | 2960609000 | |||
| 1450 | 2960616763 | |||
| 1451 | 2960623102 | |||
| 1452 | 2960630975 | |||
| 1453 | 2960636897 | |||
| 1454 | 2960639647 | |||
| 1455 | 2960652512 | |||
| 1456 | 2960655266 | |||
| 1457 | 2960666651 | |||
| 1458 | 2960673108 | |||
| 1459 | 2960677294 | |||
| 1460 | 2960686306 | |||
| 1461 | 2960693515 | |||
| 1462 | 2960700508 | |||
| 1463 | 2964611278 | |||
| 1464 | 2964621253 | |||
| 1465 | 2964626449 | |||
| 1466 | 2964635555 | |||
| 1467 | 2964641218 | |||
| 1468 | 2964647065 | |||
| 1469 | 2964655518 | |||
| 1470 | 2964661947 | |||
| 1471 | 2964670116 | |||
| 1472 | 2964677219 | |||
| 1473 | 2964684937 | |||
| 1474 | 2964691771 | |||
| 1475 | 2964698502 | |||
| 1476 | 2964703426 | |||
| 1477 | 2964710555 | |||
| 1478 | 2964713692 | |||
| 1479 | 2964721086 | |||
| 1480 | 2967671048 | |||
| 1481 | 2967672372 | |||
| 1482 | 2967683408 | |||
| 1483 | 2967692234 | |||
| 1484 | 2967694496 | |||
| 1485 | 2967702496 | |||
| 1486 | 2967714194 | |||
| 1487 | 2967718843 | |||
| 1488 | 2967726171 | |||
| 1489 | 2967729651 | |||
| 1490 | 2967739543 | |||
| 1491 | 2967745159 | |||
| 1492 | 2967754770 | |||
| 1493 | 2967762227 | |||
| 1494 | 2967766739 | |||
| 1495 | 2967775199 | |||
| 1496 | 2967782608 | |||
| 1497 | 2970026362 | |||
| 1498 | 2970033121 | |||
| 1499 | 2970034148 | |||
| 1500 | 2970046970 | |||
| 1501 | 2970051795 | |||
| 1502 | 2970060506 | |||
| 1503 | 2970062281 | |||
| 1504 | 2970069231 | |||
| 1505 | 2970079547 | |||
| 1506 | 2970086677 | |||
| 1507 | 2970091738 | |||
| 1508 | 2970102539 | |||
| 1509 | 2970107857 | |||
| 1510 | 2970115556 | |||
| 1511 | 2970120782 | |||
| 1512 | 2970128519 | |||
| 1513 | 2970129814 | |||
| 1514 | 2970143451 | |||
| 1515 | 2970149811 | |||
| 1516 | 2970156336 | |||
| 1517 | 2970158341 | |||
| 1518 | 2970167607 | |||
| 1519 | 2970173588 | |||
| 1520 | 2970178667 | |||
| 1521 | 2970190747 | |||
| 1522 | 2970198216 | |||
| 1523 | 2977520502 | |||
| 1524 | 2977530225 | |||
| 1525 | 2977532345 | |||
| 1526 | 2977541447 | |||
| 1527 | 2977551372 | |||
| 1528 | 2977557499 | |||
| 1529 | 2977559958 | |||
| 1530 | 2977569829 | |||
| 1531 | 2977578819 | |||
| 1532 | 2977583943 | |||
| 1533 | 2978974443 | |||
| 1534 | 2979094523 | |||
| 1535 | 2979098094 | |||
| 1536 | 2979103765 | |||
| 1537 | 2984511669 | |||
| 1538 | 2984521970 | |||
| 1539 | 2984541268 | |||
| 1540 | 2984589781 | |||
| 1541 | 2984603546 | |||
| 1542 | 2989353401 | |||
| 1543 | 2989775906 | |||
| 1544 | 2996898883 | |||
| 1545 | 3003933078 | |||
| 1546 | 643825412 | |||
| 1547 | 648741354 | |||
| 1548 | 650740402 | |||
| 1549 | 8001845412 | |||
| 1550 | 8003571464 | |||
| 1551 | 8003993241 | |||
| 1552 | 8004000498 | |||
| 1553 | 8024489488 | |||
| 1554 | 8045865491 | |||
| 1555 | 8054462017 | |||
| 1556 | 8054562913 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7m4w-assembly1.cif.gz_N | a. baumannii ribosome-eravacycline complex: empty 70s | 0.9375 | 3 | 120 |
| 6v3b-assembly1.cif.gz_N | cryo-em structure of the acinetobacter baumannii ribosome: 70s in empty state | 0.9344 | 3 | 120 |
| 7unw-assembly1.cif.gz_Q | pseudomonas aeruginosa 70s ribosome initiation complex bound to if2-gdpcp (structure ii-b) | 0.9337 | 5 | 120 |
| 7jt1-assembly1.cif.gz_o | 70s ribosome stalled on long mrna with arfb-1 and arfb-2 bound (+9-iii) | 0.933 | 3 | 120 |
| 7m4w-assembly1.cif.gz_N | a. baumannii ribosome-eravacycline complex: empty 70s | 0.9297 | 3 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4pecO00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.9397 | 3 | 120 | 3.30.420.100 |
| 4pecO00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.932 | 3 | 120 | 3.30.420.100 |
| 6ddga01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.9307 | 28 | 120 | 3.30.420.100 |
| 5xymO01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.9266 | 24 | 120 | 3.30.420.100 |
| 5zetP01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.9258 | 25 | 120 | 3.30.420.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-H6SSI5-F1-model_v4 | Large ribosomal subunit protein uL18 | 0.9939 | 1 | 120 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-A0A212LCP1-F1-model_v4 | Large ribosomal subunit protein uL18 | 0.9921 | 8 | 120 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-A0A848Z4C8-F1-model_v4 | Large ribosomal subunit protein uL18 | 0.9918 | 1 | 120 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-A0A7Y8MQ85-F1-model_v4 | Large ribosomal subunit protein uL18 | 0.9917 | 1 | 120 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-A0A2A4TGW2-F1-model_v4 | Large ribosomal subunit protein uL18 | 0.9912 | 1 | 120 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |