F480435

General Info

Members Datasets Scaffolds Average Seq Length
778 602 1556 116

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0007127|Ga0501034_0007127_2893_3264
Length 123
Sequence MKDKWTRHSYRTERTRDRVRETTINNGRPRLTVHRSLKYIYAQVVDDANGKTLAYASSLEKALNSGKGKSNKNVDAAKKVGEAIAKKAIAAGVKQVAFDRGGNIYHGRVKALAEAARAGGLEF

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
62 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
79 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
80 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
81 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
82 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
115 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
118 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
119 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
122 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
126 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
135 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
136 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
138 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
139 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
151 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
152 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
155 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
156 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
157 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
158 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
159 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
160 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
161 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
162 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
163 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
164 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
165 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
166 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
167 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
168 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
169 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
170 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
171 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
172 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
173 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
177 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
183 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
199 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
200 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
203 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
204 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
205 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
216 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
217 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
247 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
248 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
249 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
250 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
251 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
254 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
255 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
258 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
259 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
264 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
265 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
266 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
267 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
270 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
271 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
272 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
273 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
274 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
275 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
276 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
277 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
292 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
293 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
294 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
295 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
296 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
297 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
298 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
299 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
300 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
301 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
302 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
303 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
304 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
305 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
306 2516143018 Ensifer sp. BR816 Isolate Nodule
307 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
308 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
309 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
310 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
311 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
312 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
313 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
314 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
315 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
316 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
317 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
318 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
319 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
320 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
321 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
322 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
323 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
324 2643221557 Ensifer sp. Root558 Isolate Unclassified
325 2643221568 Rhizobium sp. Root564 Isolate Unclassified
326 2643221582 Rhizobium sp. Root651 Isolate Unclassified
327 2643221591 Devosia sp. Root685 Isolate Unclassified
328 2643221610 Ensifer sp. Root74 Isolate Unclassified
329 2643221618 Ensifer sp. Root231 Isolate Unclassified
330 2643221626 Ensifer sp. Root31 Isolate Unclassified
331 2643221629 Devosia sp. Root105 Isolate Unclassified
332 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
333 2643221655 Ensifer sp. Root1252 Isolate Unclassified
334 2643221659 Ensifer sp. Root127 Isolate Unclassified
335 2643221662 Devosia sp. Root413D1 Isolate Unclassified
336 2643221668 Ensifer sp. Root423 Isolate Unclassified
337 2643221674 Devosia sp. Root436 Isolate Unclassified
338 2643221675 Ensifer sp. Root1298 Isolate Unclassified
339 2643221680 Ensifer sp. Root1312 Isolate Unclassified
340 2643221693 Rhizobium sp. Root491 Isolate Unclassified
341 2643221698 Ensifer sp. Root142 Isolate Unclassified
342 2643221712 Ensifer sp. Root258 Isolate Unclassified
343 2643221718 Rhizobium sp. Root268 Isolate Unclassified
344 2643221723 Ensifer sp. Root278 Isolate Unclassified
345 2643221726 Ensifer sp. Root954 Isolate Unclassified
346 2643221734 Bosea sp. Root670 Isolate Unclassified
347 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
348 2751185800 Brucella pituitosa AA2 Isolate Unclassified
349 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
350 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
351 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
352 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
353 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
354 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
355 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
356 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
357 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
358 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
359 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
360 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
361 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
362 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
363 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
364 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
365 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
366 2818991467 Bosea vestrisii 3192 Isolate Unclassified
367 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
368 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
369 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
370 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
371 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
372 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
373 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
374 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
375 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
376 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
377 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
378 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
379 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
380 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
381 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
382 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
383 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
384 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
385 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
386 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
387 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
388 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
389 2844163670 Ensifer sp. 1H6 Isolate Unclassified
390 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
391 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
392 2854911287 Brucella lupini LUP21 Isolate Unclassified
393 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
394 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
395 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
396 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
397 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
398 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
399 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
400 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
401 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
402 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
403 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
404 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
405 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
406 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
407 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
408 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
409 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
410 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
411 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
412 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
413 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
414 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
415 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
416 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
417 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
418 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
419 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
420 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
421 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
422 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
423 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
424 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
425 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
426 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
427 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
428 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
429 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
430 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
431 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
432 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
433 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
434 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
435 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
436 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
437 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
438 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
439 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
440 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
441 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
442 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
443 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
444 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
445 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
446 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
447 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
448 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
449 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
450 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
451 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
452 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
453 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
454 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
455 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
456 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
457 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
458 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
459 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
460 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
461 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
462 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
463 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
464 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
465 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
466 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
467 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
468 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
469 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
470 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
471 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
472 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
473 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
474 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
475 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
476 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
477 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
478 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
479 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
480 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
481 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
482 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
483 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
484 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
485 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
486 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
487 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
488 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
489 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
490 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
491 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
492 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
493 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
494 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
495 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
496 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
497 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
498 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
499 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
500 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
501 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
502 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
503 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
504 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
505 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
506 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
507 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
508 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
509 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
510 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
511 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
512 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
513 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
514 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
515 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
516 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
517 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
518 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
519 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
520 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
521 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
522 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
523 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
524 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
525 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
526 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
527 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
528 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
529 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
530 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
531 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
532 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
533 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
534 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
535 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
536 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
537 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
538 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
539 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
540 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
541 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
542 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
543 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
544 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
545 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
546 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
547 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
548 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
549 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
550 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
551 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
552 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
553 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
554 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
555 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
556 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
557 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
558 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
559 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
560 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
561 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
562 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
563 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
564 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
565 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
566 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
567 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
568 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
569 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
570 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
571 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
572 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
573 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
574 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
575 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
576 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
577 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
578 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
579 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
580 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
581 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
582 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
583 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
584 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
585 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
586 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
587 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
588 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
589 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
590 2996893221 Rhizobium sp. R635 Isolate Nodule
591 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
592 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
593 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
594 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
595 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
596 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
597 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
598 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
599 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
600 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
601 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
602 8054558443 Rhizobium alarense TRM95111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 51.54
Metatranscriptomes 8.35
Isolates 40.1

Biome Distribution

Category Percentage (%)
Aerial Root 0.64
Bulb 0
Endosphere 8.48
Nodule 29.69
Rhizoplane 3.73
Rhizosphere 45.63
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0007127 3300049571 Bacteria 11926
2 JGI24740J21852_10002133 3300001979 Bacteria 9037
3 JGI24740J21852_10038834 3300001979 Bacteria 1457
4 JGI25158J39367_1001134 3300002739 Bacteria 4832
5 JGI25152J39213_1036488 3300002773 Bacteria 719
6 JGI25159J45721_1001742 3300002987 Bacteria 8761
7 JGI25151J46595_10000038 3300003187 Bacteria 180430
8 JGI25151J46595_10033134 3300003187 Bacteria 1994
9 JGI25165J46597_1013643 3300003214 Bacteria 1115
10 JGI25160J50197_1002401 3300003354 Bacteria 8731
11 JGI25160J50197_1023262 3300003354 Bacteria 1793
12 JGI25161J50226_1002372 3300003374 Bacteria 4860
13 Ga0006562J51391_1004293 3300003578 Bacteria 16914
14 Ga0006562J51391_1024742 3300003578 Bacteria 1660
15 Ga0055526_1003723 3300003771 Bacteria 9520
16 Ga0055526_1006649 3300003771 Bacteria 6207
17 Ga0055526_1007926 3300003771 Bacteria 5404
18 Ga0055526_1011996 3300003771 Bacteria 3831
19 Ga0055526_1012008 3300003771 Bacteria 3828
20 Ga0055524_1006440 3300003775 Bacteria 5089
21 Ga0055524_1073072 3300003775 Bacteria 652
22 Ga0055536_1001886 3300003781 Bacteria 12178
23 Ga0055536_1002273 3300003781 Bacteria 10907
24 Ga0055528_1067071 3300003790 Bacteria 658
25 Ga0055530_10024067 3300003791 Bacteria 1736
26 Ga0055531_10002421 3300003794 Bacteria 12498
27 Ga0055531_10017723 3300003794 Bacteria 2987
28 Ga0055543_1000856 3300004625 Bacteria 14666
29 Ga0058863_11693745 3300004799 Bacteria 807
30 Ga0065165_1002620 3300005262 Bacteria 14666
31 Ga0070683_100320604 3300005329 Bacteria 1475
32 Ga0070683_101890700 3300005329 Bacteria 574
33 Ga0070683_102389569 3300005329 Bacteria 507
34 Ga0068869_100104915 3300005334 Bacteria 2143
35 Ga0070666_11467565 3300005335 Bacteria 510
36 Ga0070680_100019894 3300005336 Bacteria 5323
37 Ga0070680_101866482 3300005336 Bacteria 521
38 Ga0070682_100023836 3300005337 Bacteria 3637
39 Ga0070660_100440227 3300005339 Bacteria 1081
40 Ga0070691_10009880 3300005341 Bacteria 4347
41 Ga0070661_101186508 3300005344 Bacteria 638
42 Ga0070692_10781994 3300005345 Bacteria 650
43 Ga0070668_101925805 3300005347 Bacteria 545
44 Ga0070673_101480685 3300005364 Bacteria 640
45 Ga0070688_100380571 3300005365 Bacteria 1040
46 Ga0070659_101249388 3300005366 Bacteria 658
47 Ga0070703_10308472 3300005406 Bacteria 662
48 Ga0070705_100091317 3300005440 Bacteria 1898
49 Ga0070694_100222560 3300005444 Bacteria 1416
50 Ga0070663_100136781 3300005455 Bacteria 1866
51 Ga0070663_101742180 3300005455 Bacteria 558
52 Ga0070678_100021594 3300005456 Bacteria 4249
53 Ga0070681_10007102 3300005458 Bacteria 10905
54 Ga0070679_100035523 3300005530 Bacteria 4945
55 Ga0070684_101563992 3300005535 Bacteria 622
56 Ga0068853_100006917 3300005539 Bacteria 9054
57 Ga0070695_100090950 3300005545 Bacteria 2037
58 Ga0070696_100006293 3300005546 Bacteria 7950
59 Ga0070693_100011024 3300005547 Bacteria 4545
60 Ga0070665_102502843 3300005548 Bacteria 518
61 Ga0070704_100332501 3300005549 Bacteria 1277
62 Ga0070664_100068199 3300005564 Bacteria 3041
63 Ga0068857_100128196 3300005577 Bacteria 2287
64 Ga0068857_101469202 3300005577 Bacteria 664
65 Ga0070702_100213515 3300005615 Bacteria 1286
66 Ga0068852_101644606 3300005616 Bacteria 665
67 Ga0068864_102115899 3300005618 Bacteria 569
68 Ga0068870_10799251 3300005840 Bacteria 659
69 Ga0068860_100163395 3300005843 Bacteria 2148
70 Ga0075365_10382100 3300006038 Bacteria 993
71 Ga0075365_11043898 3300006038 Bacteria 576
72 Ga0075364_11060089 3300006051 Bacteria 551
73 Ga0075362_10232402 3300006177 Bacteria 903
74 Ga0075362_10479714 3300006177 Bacteria 634
75 Ga0075369_10079325 3300006186 Bacteria 1454
76 Ga0075370_10579154 3300006353 Bacteria 679
77 Ga0075431_101356955 3300006847 Bacteria 671
78 Ga0068865_100456060 3300006881 Bacteria 1058
79 Ga0079104_1037364 3300006946 Bacteria 1157
80 Ga0099826_10165412 3300006948 Bacteria 1248
81 Ga0105243_10014127 3300009148 Bacteria 6039
82 Ga0105242_10178320 3300009176 Bacteria 1873
83 Ga0105237_10016531 3300009545 Bacteria 7666
84 Ga0105238_10215115 3300009551 Bacteria 1898
85 Ga0105238_11112508 3300009551 Bacteria 813
86 Ga0105239_10608275 3300010375 Bacteria 1247
87 Ga0157370_10420619 3300013104 Bacteria 1229
88 Ga0157369_10087882 3300013105 Bacteria 3319
89 Ga0171462_1042 3300013250 Bacteria 66199
90 Ga0157372_10469158 3300013307 Bacteria 1467
91 Ga0157375_10341498 3300013308 Bacteria 1663
92 Ga0163163_10751432 3300014325 Bacteria 1039
93 Ga0157380_12868643 3300014326 Bacteria 548
94 Ga0157379_10273185 3300014968 Bacteria 1537
95 Ga0157379_10642369 3300014968 Bacteria 993
96 Ga0157376_10492824 3300014969 Bacteria 1203
97 Ga0206353_11755279 3300020082 Bacteria 585
98 Ga0214542_1023288 3300021321 Bacteria 3746
99 Ga0214543_1005345 3300021327 Bacteria 23734
100 Ga0213872_10012804 3300021361 Bacteria 3938
101 Ga0213872_10103949 3300021361 Bacteria 1264
102 Ga0213872_10183657 3300021361 Bacteria 902
103 Ga0209436_100747 3300025208 Bacteria 13472
104 Ga0209673_1037691 3300025273 Bacteria 1417
105 Ga0209130_1000007 3300025284 Bacteria 591584
106 Ga0209130_1008921 3300025284 Bacteria 2908
107 Ga0209675_1002527 3300025291 Bacteria 9311
108 Ga0209676_1001545 3300025292 Bacteria 20721
109 Ga0209676_1028639 3300025292 Bacteria 1730
110 Ga0209025_1000014 3300025294 Bacteria 865448
111 Ga0209025_1000303 3300025294 Bacteria 110086
112 Ga0209025_1179903 3300025294 Bacteria 544
113 Ga0209564_1000140 3300025295 Bacteria 179856
114 Ga0209564_1002872 3300025295 Bacteria 12632
115 Ga0209564_1003215 3300025295 Bacteria 11464
116 Ga0209050_1002103 3300025298 Bacteria 18193
117 Ga0209256_1000108 3300025299 Bacteria 185884
118 Ga0209256_1000540 3300025299 Bacteria 54759
119 Ga0207426_1000064 3300025302 Bacteria 358276
120 Ga0209051_1002149 3300025303 Bacteria 14647
121 Ga0209257_1000817 3300025304 Bacteria 45150
122 Ga0209257_1061703 3300025304 Bacteria 1016
123 Ga0207688_10483414 3300025901 Bacteria 774
124 Ga0207699_10775565 3300025906 Bacteria 704
125 Ga0207643_10882990 3300025908 Bacteria 579
126 Ga0207654_10065182 3300025911 Bacteria 2144
127 Ga0207707_10017730 3300025912 Bacteria 6211
128 Ga0207671_10301103 3300025914 Bacteria 1267
129 Ga0207660_10003004 3300025917 Bacteria 11039
130 Ga0207660_11379492 3300025917 Bacteria 571
131 Ga0207652_10232689 3300025921 Bacteria 1661
132 Ga0207690_10008933 3300025932 Bacteria 5948
133 Ga0207686_10481845 3300025934 Bacteria 959
134 Ga0207709_10018685 3300025935 Bacteria 3887
135 Ga0207689_10101680 3300025942 Bacteria 2361
136 Ga0207679_10196515 3300025945 Bacteria 1682
137 Ga0207667_10128005 3300025949 Bacteria 2615
138 Ga0207658_10055258 3300025986 Bacteria 2942
139 Ga0207639_11069964 3300026041 Bacteria 756
140 Ga0207678_10000118 3300026067 Bacteria 65608
141 Ga0207674_10135964 3300026116 Bacteria 2420
142 Ga0207675_102134487 3300026118 Bacteria 576
143 Ga0207683_10026403 3300026121 Bacteria 5012
144 Ga0207698_10074815 3300026142 Bacteria 2703
145 Ga0209282_1086341 3300027666 Bacteria 1659
146 Ga0209974_10092975 3300027876 Bacteria 1047
147 Ga0209974_10099296 3300027876 Bacteria 1016
148 Ga0268264_10075388 3300028381 Bacteria 2869
149 Ga0265319_1072110 3300028563 Bacteria 1106
150 Ga0265334_10134553 3300028573 Bacteria 878
151 Ga0265318_10009217 3300028577 Bacteria 4353
152 Ga0307515_10017924 3300028794 Bacteria 12859
153 Ga0265320_10061498 3300031240 Bacteria 1790
154 Ga0265331_10063094 3300031250 Bacteria 1746
155 Ga0307513_10402061 3300031456 Bacteria 1104
156 Ga0307408_100504141 3300031548 Bacteria 1060
157 Ga0316579_10255456 3300031691 Bacteria 848
158 Ga0265342_10111276 3300031712 Bacteria 1550
159 Ga0307405_10055833 3300031731 Bacteria 2474
160 Ga0307410_10470776 3300031852 Bacteria 1029
161 Ga0307412_10758338 3300031911 Bacteria 838
162 Ga0307416_100606726 3300032002 Bacteria 1175
163 Ga0307414_10139116 3300032004 Bacteria 1898
164 Ga0307414_10746594 3300032004 Bacteria 889
165 Ga0307411_10326731 3300032005 Bacteria 1241
166 Ga0307415_100903696 3300032126 Bacteria 814
167 Ga0373948_0190212 3300034817 Bacteria 531
168 Ga0373934_0049988 3300035086 Bacteria 1656
169 Ga0373936_0210250 3300035113 Bacteria 861
170 Ga0373939_0066937 3300035114 Bacteria 1159
171 Ga0373953_0264496 3300035117 Bacteria 748
172 Ga0373957_0037891 3300035120 Bacteria 1803
173 Ga0373955_0045569 3300035172 Bacteria 2367
174 Ga0373924_0513905 3300035410 Bacteria 538
175 Ga0373931_0019779 3300035691 Bacteria 3364
176 Ga0373933_0127218 3300035724 Bacteria 1599
177 Ga0316584_0827847 3300036712 Bacteria 627
178 Ga0395899_0181581 3300037312 Bacteria 1477
179 Ga0395900_0300836 3300037418 Bacteria 1590
180 Ga0395900_0439171 3300037418 Bacteria 1263
181 Ga0395898_0007760 3300037466 Bacteria 11394
182 Ga0395898_0509502 3300037466 Bacteria 1144
183 Ga0395905_0032064 3300037471 Bacteria 4942
184 Ga0395901_0102929 3300038443 Bacteria 2996
185 Ga0395901_1974174 3300038443 Bacteria 530
186 Ga0400483_002645 3300039062 Bacteria 1458
187 Ga0400483_032695 3300039062 Bacteria 3006
188 Ga0400489_86969 3300039093 Bacteria 10581
189 Ga0237816_03981 3300039145 Bacteria 1048
190 Ga0436361_0002743 3300039447 Bacteria 628
191 Ga0436361_0291348 3300039447 Bacteria 1687
192 Ga0436361_0925804 3300039447 Bacteria 732
193 Ga0436361_1086504 3300039447 Bacteria 2345
194 Ga0436362_0680415 3300039453 Bacteria 872
195 Ga0439436_0051371 3300041404 Bacteria 1164
196 Ga0439453_0043502 3300041408 Bacteria 888
197 Ga0439466_0062082 3300041411 Bacteria 1202
198 Ga0439466_0090356 3300041411 Bacteria 960
199 Ga0439465_0114390 3300041413 Bacteria 942
200 Ga0439465_0189032 3300041413 Bacteria 747
201 Ga0439465_0232320 3300041413 Bacteria 678
202 Ga0451789_1140541 3300041443 Bacteria 1097
203 Ga0451791_1659963 3300041451 Bacteria 583
204 Ga0451797_1119904 3300041453 Bacteria 734
205 Ga0451800_1262250 3300041459 Bacteria 657
206 Ga0451841_1428859 3300041498 Bacteria 783
207 Ga0451855_1035573 3300041511 Bacteria 645
208 Ga0439442_040365 3300042002 Bacteria 980
209 Ga0439445_0014796 3300042004 Bacteria 1904
210 Ga0439432_159318 3300042006 Bacteria 661
211 Ga0439449_0006732 3300042007 Bacteria 4386
212 Ga0439452_028778 3300042010 Bacteria 1383
213 Ga0439434_0022899 3300042435 Bacteria 1879
214 Ga0466965_0043824 3300044683 Bacteria 2210
215 Ga0466965_0205491 3300044683 Bacteria 1046
216 Ga0466965_0353017 3300044683 Bacteria 806
217 Ga0466968_0039813 3300044735 Bacteria 1979
218 Ga0495617_130347 3300046452 Bacteria 807
219 Ga0495651_0137565 3300046462 Bacteria 1775
220 Ga0495653_0956443 3300046463 Bacteria 508
221 Ga0495639_0567609 3300046475 Bacteria 582
222 Ga0495585_0262220 3300046492 Bacteria 859
223 Ga0495608_0103481 3300046511 Bacteria 1835
224 Ga0495652_0168520 3300046529 Bacteria 1692
225 Ga0495587_0020378 3300046536 Bacteria 4094
226 Ga0495667_0460271 3300046559 Bacteria 799
227 Ga0495657_0117764 3300046675 Bacteria 1676
228 Ga0495599_0298978 3300046678 Bacteria 972
229 Ga0495670_0530728 3300046691 Bacteria 640
230 Ga0495680_0258167 3300047322 Bacteria 1233
231 Ga0495675_0040498 3300047444 Bacteria 2969
232 Ga0496100_0316414 3300048903 Bacteria 1171
233 Ga0496101_0250750 3300048904 Bacteria 1379
234 Ga0496102_0021900 3300048905 Bacteria 5658
235 Ga0496102_0622502 3300048905 Bacteria 1002
236 Ga0496102_1516812 3300048905 Bacteria 589
237 Ga0496102_1792465 3300048905 Bacteria 531
238 Ga0496103_0005971 3300048906 Bacteria 7283
239 Ga0496104_0017664 3300048907 Bacteria 6502
240 Ga0496104_0038871 3300048907 Bacteria 4454
241 Ga0496104_1101570 3300048907 Bacteria 698
242 Ga0496105_0180037 3300048908 Bacteria 1731
243 Ga0496106_0004608 3300048909 Bacteria 10225
244 Ga0496107_0008725 3300048910 Bacteria 7023
245 Ga0496110_0355217 3300048913 Bacteria 1335
246 Ga0496114_0381187 3300048917 Bacteria 1248
247 Ga0496114_1518847 3300048917 Bacteria 558
248 Ga0496115_0001671 3300048918 Bacteria 15949
249 Ga0496115_0999984 3300048918 Bacteria 639
250 Ga0496116_0083743 3300048919 Bacteria 1967
251 Ga0496116_0121347 3300048919 Bacteria 1512
252 Ga0496116_0369072 3300048919 Bacteria 649
253 Ga0496117_0085746 3300048920 Bacteria 2049
254 Ga0496117_0115516 3300048920 Bacteria 1661
255 Ga0496117_0280764 3300048920 Bacteria 892
256 Ga0496119_0276186 3300048922 Bacteria 837
257 Ga0496121_0018961 3300048924 Bacteria 6903
258 Ga0496121_0058894 3300048924 Bacteria 3171
259 Ga0496121_0473270 3300048924 Bacteria 802
260 Ga0496122_0019871 3300048925 Bacteria 6109
261 Ga0496122_0344328 3300048925 Bacteria 781
262 Ga0496123_0008564 3300048926 Bacteria 9374
263 Ga0496123_0073670 3300048926 Bacteria 2117
264 Ga0496124_0326832 3300048927 Bacteria 1095
265 Ga0496125_0000815 3300048928 Bacteria 50702
266 Ga0496125_0053349 3300048928 Bacteria 3315
267 Ga0496125_0155181 3300048928 Bacteria 1565
268 Ga0496125_0410546 3300048928 Bacteria 788
269 Ga0496126_0036822 3300048929 Bacteria 4572
270 Ga0496126_0269663 3300048929 Bacteria 1413
271 Ga0501306_000444 3300049127 Bacteria 3135
272 Ga0501306_001033 3300049127 Bacteria 2464
273 Ga0501306_004298 3300049127 Bacteria 1590
274 Ga0501306_007899 3300049127 Bacteria 1284
275 Ga0501308_064523 3300049128 Bacteria 559
276 Ga0501309_004872 3300049129 Bacteria 1579
277 Ga0501309_022451 3300049129 Bacteria 893
278 Ga0501310_001976 3300049130 Bacteria 1910
279 Ga0501310_015362 3300049130 Bacteria 908
280 Ga0501310_063217 3300049130 Bacteria 555
281 Ga0501341_05883 3300049131 Bacteria 743
282 Ga0501304_000523 3300049160 Bacteria 2043
283 Ga0501305_009509 3300049161 Bacteria 1279
284 Ga0501305_089282 3300049161 Bacteria 562
285 Ga0501307_026867 3300049162 Bacteria 780
286 Ga0501307_040231 3300049162 Bacteria 677
287 Ga0501307_079477 3300049162 Bacteria 534
288 Ga0501294_026713 3300049517 Bacteria 654
289 Ga0501303_037340 3300049526 Bacteria 593
290 Ga0501311_006601 3300049527 Bacteria 1311
291 Ga0501311_050333 3300049527 Bacteria 652
292 Ga0501311_100954 3300049527 Bacteria 511
293 Ga0501312_002690 3300049528 Bacteria 1941
294 Ga0501314_000486 3300049530 Bacteria 2489
295 Ga0501314_002564 3300049530 Bacteria 1414
296 Ga0501314_002648 3300049530 Bacteria 1399
297 Ga0501315_000060 3300049531 Bacteria 4828
298 Ga0501315_040696 3300049531 Bacteria 702
299 Ga0501315_053140 3300049531 Bacteria 640
300 Ga0501315_103836 3300049531 Bacteria 505
301 Ga0501316_000132 3300049532 Bacteria 3939
302 Ga0501316_051721 3300049532 Bacteria 593
303 Ga0501317_000084 3300049533 Bacteria 4633
304 Ga0501318_008515 3300049534 Bacteria 1098
305 Ga0501319_002038 3300049535 Bacteria 1246
306 Ga0501320_005669 3300049536 Bacteria 1146
307 Ga0501320_007634 3300049536 Bacteria 1045
308 Ga0501320_016479 3300049536 Bacteria 818
309 Ga0501321_033209 3300049537 Bacteria 698
310 Ga0501322_018829 3300049538 Bacteria 594
311 Ga0501323_005178 3300049539 Bacteria 1415
312 Ga0501325_003833 3300049541 Bacteria 1119
313 Ga0501326_04357 3300049542 Bacteria 749
314 Ga0501332_01776 3300049548 Bacteria 1163
315 Ga0501335_000789 3300049551 Bacteria 2207
316 Ga0501031_0000651 3300049568 Bacteria 20547
317 Ga0501031_0004402 3300049568 Bacteria 9129
318 Ga0501032_0000111 3300049569 Bacteria 69802
319 Ga0501032_0006160 3300049569 Bacteria 8827
320 Ga0501032_0014074 3300049569 Bacteria 5674
321 Ga0501032_0173231 3300049569 Bacteria 1414
322 Ga0501032_0320313 3300049569 Bacteria 1001
323 Ga0501032_0345929 3300049569 Bacteria 958
324 Ga0501032_0491575 3300049569 Bacteria 784
325 Ga0501033_0007122 3300049570 Bacteria 8728
326 Ga0501033_0010287 3300049570 Bacteria 7177
327 Ga0501033_0080471 3300049570 Bacteria 2390
328 Ga0501033_0194969 3300049570 Bacteria 1448
329 Ga0501033_0341631 3300049570 Bacteria 1049
330 Ga0501033_0387415 3300049570 Bacteria 976
331 Ga0501033_0857555 3300049570 Bacteria 612
332 Ga0501034_0000208 3300049571 Bacteria 111739
333 Ga0501034_0004897 3300049571 Bacteria 14760
334 Ga0501034_0009019 3300049571 Bacteria 10475
335 Ga0501034_0009460 3300049571 Bacteria 10201
336 Ga0501034_0030885 3300049571 Bacteria 5444
337 Ga0501034_0053012 3300049571 Bacteria 4086
338 Ga0501034_0069393 3300049571 Bacteria 3535
339 Ga0501034_1117733 3300049571 Bacteria 668
340 Ga0501034_1231203 3300049571 Bacteria 627
341 Ga0501036_0002605 3300049572 Bacteria 14223
342 Ga0501036_0074242 3300049572 Bacteria 2876
343 Ga0501036_0087845 3300049572 Bacteria 2628
344 Ga0501036_0194494 3300049572 Bacteria 1706
345 Ga0501036_0454935 3300049572 Bacteria 1066
346 Ga0501036_0862776 3300049572 Bacteria 744
347 Ga0501036_1209638 3300049572 Bacteria 616
348 Ga0501037_0000131 3300049573 Bacteria 69802
349 Ga0501037_0007990 3300049573 Bacteria 7753
350 Ga0501037_0061483 3300049573 Bacteria 2738
351 Ga0501037_0094809 3300049573 Bacteria 2158
352 Ga0501037_0135567 3300049573 Bacteria 1763
353 Ga0501037_0183612 3300049573 Bacteria 1483
354 Ga0501037_0338366 3300049573 Bacteria 1040
355 Ga0501037_0841677 3300049573 Bacteria 604
356 Ga0501038_0000109 3300049574 Bacteria 69802
357 Ga0501038_0009962 3300049574 Bacteria 8704
358 Ga0501038_0047294 3300049574 Bacteria 3727
359 Ga0501038_0213052 3300049574 Bacteria 1544
360 Ga0501038_0655218 3300049574 Bacteria 790
361 Ga0501038_0813200 3300049574 Bacteria 694
362 Ga0501039_0000072 3300049575 Bacteria 76673
363 Ga0501039_0002279 3300049575 Bacteria 14235
364 Ga0501039_0765045 3300049575 Bacteria 754
365 Ga0501040_0046602 3300049576 Bacteria 2959
366 Ga0501040_0300420 3300049576 Bacteria 1148
367 Ga0501042_0724963 3300049578 Bacteria 723
368 Ga0501043_0015219 3300049579 Bacteria 6023
369 Ga0501043_0128759 3300049579 Bacteria 1984
370 Ga0501043_0195389 3300049579 Bacteria 1572
371 Ga0501046_0004977 3300049580 Bacteria 11926
372 Ga0501046_0016665 3300049580 Bacteria 6147
373 Ga0501046_0528686 3300049580 Bacteria 842
374 Ga0501047_0001212 3300049581 Bacteria 25586
375 Ga0501047_0017299 3300049581 Bacteria 6904
376 Ga0501047_0058328 3300049581 Bacteria 3729
377 Ga0501047_0317813 3300049581 Bacteria 1397
378 Ga0501047_0380412 3300049581 Bacteria 1246
379 Ga0501047_0682282 3300049581 Bacteria 845
380 Ga0501047_1205785 3300049581 Bacteria 570
381 Ga0501048_0000501 3300049582 Bacteria 27413
382 Ga0501048_0166830 3300049582 Bacteria 1559
383 Ga0501067_0001102 3300049583 Bacteria 14576
384 Ga0501067_0021386 3300049583 Bacteria 3580
385 Ga0501069_0584467 3300049585 Bacteria 670
386 Ga0501070_0015591 3300049586 Bacteria 6390
387 Ga0501070_0016943 3300049586 Bacteria 6115
388 Ga0501070_0110480 3300049586 Bacteria 2272
389 Ga0501070_0363567 3300049586 Bacteria 1174
390 Ga0501070_0487433 3300049586 Bacteria 991
391 Ga0501070_1114929 3300049586 Bacteria 608
392 Ga0501071_0650932 3300049587 Bacteria 811
393 Ga0501072_0596597 3300049588 Bacteria 871
394 Ga0501073_0025762 3300049589 Bacteria 4214
395 Ga0501073_0091635 3300049589 Bacteria 2113
396 Ga0501073_0208047 3300049589 Bacteria 1352
397 Ga0501073_0713502 3300049589 Bacteria 692
398 Ga0501073_0960866 3300049589 Bacteria 588
399 Ga0501074_0886865 3300049590 Bacteria 628
400 Ga0501076_1206125 3300049592 Bacteria 623
401 Ga0501252_088693 3300049682 Bacteria 521
402 Ga0501257_101426 3300049686 Bacteria 756
403 Ga0501080_0000005 3300049742 Bacteria 176271
404 Ga0501080_0141993 3300049742 Bacteria 2220
405 Ga0501083_0197166 3300049744 Bacteria 1314
406 Ga0501083_0597580 3300049744 Bacteria 718
407 Ga0501083_1164584 3300049744 Bacteria 502
408 Ga0501263_026500 3300049760 Bacteria 802
409 Ga0501280_003866 3300049776 Bacteria 2252
410 Ga0501035_0000049 3300049822 Bacteria 145684
411 Ga0501035_0000347 3300049822 Bacteria 53369
412 Ga0501035_0009004 3300049822 Bacteria 9284
413 Ga0501035_0112268 3300049822 Bacteria 2388
414 Ga0501035_0591111 3300049822 Bacteria 905
415 Ga0501035_1098899 3300049822 Bacteria 621
416 Ga0501044_0000030 3300049823 Bacteria 173442
417 Ga0501044_0000234 3300049823 Bacteria 69802
418 Ga0501044_0022577 3300049823 Bacteria 6704
419 Ga0501044_0050656 3300049823 Bacteria 4283
420 Ga0501044_0062595 3300049823 Bacteria 3803
421 Ga0501044_0141730 3300049823 Bacteria 2392
422 Ga0501044_0737439 3300049823 Bacteria 868
423 Ga0501044_0876789 3300049823 Bacteria 773
424 Ga0501044_1115511 3300049823 Bacteria 658
425 Ga0501044_1164998 3300049823 Bacteria 639
426 Ga0501044_1203502 3300049823 Bacteria 625
427 Ga0501044_1404140 3300049823 Bacteria 564
428 Ga0501045_0262165 3300049824 Bacteria 1286
429 nmdc:mga0yw44_31343_c1 3300050492 Bacteria 2023
430 nmdc:mga0k408_304127_c1 3300050493 Bacteria 952
431 nmdc:mga07m45_52036_c1 3300050496 Bacteria 2311
432 nmdc:mga0sz30_69529_c1 3300050516 Bacteria 1514
433 Ga0495612_0061025 3300053078 Bacteria 1561
434 Ga0495619_1165051 3300053085 Bacteria 511
435 Ga0500595_071600 3300053119 Bacteria 1027
436 Ga0500608_136998 3300053122 Bacteria 1090
437 Ga0500618_115134 3300053125 Bacteria 608
438 Ga0500559_0144555 3300053136 Bacteria 1115
439 Ga0500559_0471422 3300053136 Bacteria 579
440 Ga0500616_0009749 3300053153 Bacteria 5803
441 Ga0500616_0011972 3300053153 Bacteria 5096
442 Ga0500616_0019860 3300053153 Bacteria 3782
443 Ga0500627_0074523 3300053158 Bacteria 1507
444 Ga0500627_0141891 3300053158 Bacteria 1085
445 Ga0500634_0000031 3300053161 Bacteria 75547
446 Ga0501084_0807405 3300054114 Bacteria 790
447 Ga0587084_021570 3300059477 Bacteria 967
448 Ga0587066_200630 3300059490 Bacteria 525
449 Ga0587077_000009 3300059493 Bacteria 7681
450 Ga0587077_001192 3300059493 Bacteria 2699
451 Ga0587077_026576 3300059493 Bacteria 1070
452 Ga0587077_186543 3300059493 Bacteria 565
453 Ga0587080_021206 3300059503 Bacteria 1067
454 Ga0587089_002504 3300059509 Bacteria 1873
455 Ga0587090_014809 3300059510 Bacteria 1145
456 Ga0587106_001821 3300059605 Bacteria 1981
457 Ga0587125_000201 3300059607 Bacteria 2966
458 Ga0587101_003354 3300059623 Bacteria 1619
459 Ga0587101_058421 3300059623 Bacteria 683
460 Ga0587109_032265 3300059624 Bacteria 1000
461 Ga0587062_001650 3300059639 Bacteria 1979
462 Ga0587076_001067 3300059645 Bacteria 2654
463 Ga0587079_001202 3300059647 Bacteria 2808
464 Ga0587111_0000152 3300060346 Bacteria 5041
465 Ga0501082_0021073 3300060353 Bacteria 5621
466 Ga0501082_1059422 3300060353 Bacteria 709
467 2510308402 2510065057 Bacteria 6649661
468 2511501273 2511231052 Bacteria 6974333
469 2512532698 2512047086 Bacteria 6850303
470 2512971973 2512875026 Bacteria 6861065
471 2513587135 2513237086 Bacteria 7265287
472 2513594036 2513237087 Bacteria 5817514
473 2513607082 2513237089 Bacteria 6553624
474 2513620836 2513237091 Bacteria 6900273
475 2513886845 2513237140 Bacteria 7076289
476 2513906986 2513237143 Bacteria 6664116
477 2513909598 2513237144 Bacteria 7530820
478 2513987843 2513237156 Bacteria 6402557
479 2514008878 2513237160 Bacteria 6650282
480 2515613333 2515154107 Bacteria 6795637
481 2516209151 2516143018 Bacteria 6951533
482 2516892555 2516653046 Bacteria 6989037
483 2517569367 2517487022 Bacteria 7227575
484 2524454330 2524023207 Bacteria 6813453
485 2537874336 2537561587 Bacteria 5425293
486 2551678253 2551306084 Bacteria 8942552
487 2551687644 2551306085 Bacteria 7347181
488 2551728469 2551306091 Bacteria 7086830
489 2551730900 2551306091 Bacteria 7086830
490 2551742268 2551306093 Bacteria 7064773
491 2554248079 2554235003 Bacteria 5877155
492 2559295196 2558860242 Bacteria 5568029
493 2599333506 2599185156 Bacteria 5403036
494 2599601516 2599185210 Bacteria 5624189
495 2599721230 2599185236 Bacteria 6875203
496 2600192217 2599185352 Bacteria 7228948
497 2600375485 2600254933 Bacteria 4750527
498 2601612145 2600255279 Bacteria 5605316
499 2601749071 2600255308 Bacteria 5611129
500 2643808297 2643221557 Bacteria 7184309
501 2643857821 2643221568 Bacteria 5187270
502 2643919618 2643221582 Bacteria 5804683
503 2643963604 2643221591 Bacteria 4397626
504 2644068117 2643221610 Bacteria 7480339
505 2644108034 2643221618 Bacteria 7717186
506 2644150544 2643221626 Bacteria 8069654
507 2644165887 2643221629 Bacteria 5850260
508 2644207704 2643221637 Bacteria 5345260
509 2644310100 2643221655 Bacteria 7722067
510 2644335306 2643221659 Bacteria 7890716
511 2644347103 2643221662 Bacteria 5851492
512 2644379287 2643221668 Bacteria 7306521
513 2644410388 2643221674 Bacteria 3919126
514 2644419061 2643221675 Bacteria 7473456
515 2644450420 2643221680 Bacteria 7473610
516 2644520159 2643221693 Bacteria 5513853
517 2644544821 2643221698 Bacteria 7756764
518 2644617148 2643221712 Bacteria 7729434
519 2644654489 2643221718 Bacteria 5345506
520 2644677794 2643221723 Bacteria 7095460
521 2644687285 2643221726 Bacteria 7455827
522 2644735423 2643221734 Bacteria 5365412
523 2657686412 2657244999 Bacteria 5946535
524 2753359561 2751185800 Bacteria 5467370
525 2753460133 2751185821 Bacteria 6189929
526 2758641822 2758568016 Bacteria 5645291
527 2776913092 2775507049 Bacteria 6284736
528 2792624838 2791355091 Bacteria 6135441
529 2792630872 2791355092 Bacteria 6248105
530 2792642402 2791355094 Bacteria 7011481
531 2793282380 2791355253 Bacteria 5171699
532 2802719380 2802428858 Bacteria 6636079
533 2802723059 2802428859 Bacteria 6667919
534 2802734756 2802428860 Bacteria 6525526
535 2802741296 2802428861 Bacteria 6534206
536 2802745045 2802428862 Bacteria 6633353
537 2802751480 2802428863 Bacteria 6410669
538 2804751748 2802429268 Bacteria 6094027
539 2808985086 2808606387 Bacteria 5697198
540 2819559514 2818991439 Bacteria 6907412
541 2819683813 2818991461 Bacteria 7026071
542 2819720936 2818991467 Bacteria 5893227
543 2821124588 2821123053 Bacteria 7836056
544 2828310162 2828305725 Bacteria 4916900
545 2837653705 2837651117 Bacteria 3772164
546 2838079222 2838074704 Bacteria 6785777
547 2838675949 2838675328 Bacteria 4909118
548 2838714831 2838714209 Bacteria 5525906
549 2838721368 2838719591 Bacteria 5523910
550 2838725591 2838724970 Bacteria 4908691
551 2838742443 2838736955 Bacteria 5760694
552 2841846400 2841840854 Bacteria 5761912
553 2841848335 2841846520 Bacteria 5345850
554 2841859110 2841859092 Bacteria 5436171
555 2842125635 2842124991 Bacteria 5346824
556 2842130844 2842130223 Bacteria 4909145
557 2842146122 2842140634 Bacteria 5759631
558 2842153986 2842152218 Bacteria 4908957
559 2842171075 2842170452 Bacteria 5525737
560 2842177606 2842175837 Bacteria 4908771
561 2842187940 2842187318 Bacteria 5524014
562 2842212251 2842211629 Bacteria 5523832
563 2842226130 2842224351 Bacteria 5524473
564 2842515894 2842515876 Bacteria 5436280
565 2844169509 2844163670 Bacteria 7266046
566 2847418402 2847417321 Bacteria 6913799
567 2848993381 2848992105 Bacteria 6810864
568 2854912153 2854911287 Bacteria 5582813
569 2854919416 2854916844 Bacteria 5725939
570 2855831625 2855825444 Bacteria 6785811
571 2855840743 2855839649 Bacteria 7135830
572 2855873433 2855872281 Bacteria 6964271
573 2857532169 2857531043 Bacteria 6754041
574 2858801270 2858800743 Bacteria 6603254
575 2896386893 2896384573 Bacteria 7700774
576 2899794871 2899792073 Bacteria 4926588
577 2899807792 2899803654 Bacteria 5577784
578 2899848092 2899845264 Bacteria 5672268
579 2913301776 2913295892 Bacteria 6333755
580 2915985667 2915980308 Bacteria 6624279
581 2915991802 2915986958 Bacteria 6739310
582 2916000605 2915993759 Bacteria 7016183
583 2916007563 2916000859 Bacteria 6865702
584 2916008881 2916007675 Bacteria 6898660
585 2916018774 2916014648 Bacteria 6946486
586 2916026382 2916021584 Bacteria 6854472
587 2916034651 2916028427 Bacteria 6748433
588 2916040632 2916035215 Bacteria 6755766
589 2916048200 2916041962 Bacteria 6820487
590 2916054389 2916048683 Bacteria 6543552
591 2916060798 2916055098 Bacteria 6758838
592 2916068168 2916061851 Bacteria 6737736
593 2916075016 2916068649 Bacteria 6943657
594 2916079907 2916076590 Bacteria 6596108
595 2917699281 2917699015 Bacteria 7043791
596 2919114920 2919114240 Bacteria 5700270
597 2919167992 2919166419 Bacteria 4952238
598 2920824108 2920822456 Bacteria 6897201
599 2921208183 2921201388 Bacteria 6926299
600 2921209424 2921208531 Bacteria 6745326
601 2921242266 2921237296 Bacteria 6876710
602 2921248073 2921244191 Bacteria 6568419
603 2921256123 2921250672 Bacteria 6677771
604 2921263459 2921257292 Bacteria 6808382
605 2921270090 2921263974 Bacteria 6864552
606 2921285908 2921282425 Bacteria 6826397
607 2921296757 2921289301 Bacteria 7316391
608 2921299126 2921296804 Bacteria 7176999
609 2924147668 2924144063 Bacteria 6883928
610 2924157725 2924150972 Bacteria 7169444
611 2924165050 2924158325 Bacteria 7188855
612 2924172870 2924165586 Bacteria 7260590
613 2924179189 2924172951 Bacteria 6749356
614 2924184584 2924179722 Bacteria 6843264
615 2924192968 2924186466 Bacteria 6876637
616 2924199578 2924193448 Bacteria 6955718
617 2924204254 2924200457 Bacteria 6757188
618 2924213328 2924207177 Bacteria 6917007
619 2924221991 2924221636 Bacteria 7113495
620 2924233677 2924228884 Bacteria 6633132
621 2926755886 2926754445 Bacteria 5964435
622 2926762984 2926760298 Bacteria 5505990
623 2929140704 2929138655 Bacteria 5810547
624 2933008631 2933006813 Bacteria 4912075
625 2933011730 2933011516 Bacteria 5439334
626 2933596766 2933594066 Bacteria 5594265
627 2937001412 2936996657 Bacteria 6298727
628 2937008152 2937002841 Bacteria 6934057
629 2937015640 2937009748 Bacteria 6746052
630 2937019600 2937016420 Bacteria 6782579
631 2937028369 2937023124 Bacteria 6815156
632 2937034849 2937029754 Bacteria 6424026
633 2937040791 2937036028 Bacteria 6846469
634 2937049358 2937042894 Bacteria 6741576
635 2937056390 2937049772 Bacteria 6757901
636 2937060869 2937056579 Bacteria 7107896
637 2937069363 2937063883 Bacteria 7199456
638 2937076553 2937071275 Bacteria 6984483
639 2937079344 2937078374 Bacteria 6610289
640 2937088449 2937084907 Bacteria 6618516
641 2937096831 2937091812 Bacteria 6979387
642 2937105920 2937098957 Bacteria 7249374
643 2937113064 2937106411 Bacteria 6947143
644 2937118556 2937113482 Bacteria 6505872
645 2937125238 2937119839 Bacteria 6597547
646 2937129969 2937126314 Bacteria 6771275
647 2941499945 2941499720 Bacteria 7599444
648 2957377131 2957375807 Bacteria 6425588
649 2957385711 2957382221 Bacteria 6737050
650 2957388834 2957388812 Bacteria 6778072
651 2957401724 2957395598 Bacteria 6822399
652 2957406440 2957402308 Bacteria 6741770
653 2957414199 2957408893 Bacteria 6558585
654 2957418167 2957415311 Bacteria 6991633
655 2957429132 2957422303 Bacteria 7172205
656 2957435561 2957430029 Bacteria 7022557
657 2957443035 2957437181 Bacteria 6568994
658 2957449774 2957443900 Bacteria 6869977
659 2957453197 2957450854 Bacteria 6765715
660 2957464197 2957457609 Bacteria 6967680
661 2957468115 2957464669 Bacteria 6568877
662 2957477674 2957471148 Bacteria 6797643
663 2957483693 2957478035 Bacteria 6756658
664 2957491290 2957484790 Bacteria 6703082
665 2957496673 2957491536 Bacteria 6695180
666 2957504891 2957498199 Bacteria 7126688
667 2957512931 2957505466 Bacteria 7253085
668 2960586009 2960584000 Bacteria 6864594
669 2960593524 2960591022 Bacteria 6622873
670 2960602387 2960597568 Bacteria 6550735
671 2960609000 2960603979 Bacteria 6898737
672 2960616763 2960610863 Bacteria 6691244
673 2960623102 2960617483 Bacteria 6727748
674 2960630975 2960624210 Bacteria 6875384
675 2960636897 2960631154 Bacteria 6732508
676 2960639647 2960637947 Bacteria 7296468
677 2960652512 2960645483 Bacteria 7211087
678 2960655266 2960652885 Bacteria 7083688
679 2960666651 2960660292 Bacteria 7041660
680 2960673108 2960667422 Bacteria 6763020
681 2960677294 2960674078 Bacteria 6609048
682 2960686306 2960680706 Bacteria 6624464
683 2960693515 2960687367 Bacteria 6535474
684 2960700508 2960693952 Bacteria 6749742
685 2964611278 2964607997 Bacteria 7101408
686 2964621253 2964615318 Bacteria 6809089
687 2964626449 2964621998 Bacteria 6834995
688 2964635555 2964628898 Bacteria 7083044
689 2964641218 2964636051 Bacteria 7091832
690 2964647065 2964643177 Bacteria 6820887
691 2964655518 2964649959 Bacteria 6675118
692 2964661947 2964656573 Bacteria 7100150
693 2964670116 2964663802 Bacteria 7019362
694 2964677219 2964670856 Bacteria 6851364
695 2964684937 2964678106 Bacteria 6792020
696 2964691771 2964685014 Bacteria 6839111
697 2964698502 2964691889 Bacteria 6802758
698 2964703426 2964698721 Bacteria 6765331
699 2964710555 2964705432 Bacteria 7114648
700 2964713692 2964712639 Bacteria 6695970
701 2964721086 2964719344 Bacteria 7286602
702 2967671048 2967664464 Bacteria 6948836
703 2967672372 2967671571 Bacteria 7021409
704 2967683408 2967678726 Bacteria 7264382
705 2967692234 2967686174 Bacteria 6678622
706 2967694496 2967693043 Bacteria 6804451
707 2967702496 2967699805 Bacteria 6854538
708 2967714194 2967706974 Bacteria 7186053
709 2967718843 2967714385 Bacteria 7000047
710 2967726171 2967721400 Bacteria 7073753
711 2967729651 2967728569 Bacteria 6641507
712 2967739543 2967735183 Bacteria 6827012
713 2967745159 2967742019 Bacteria 6794534
714 2967754770 2967748971 Bacteria 6733771
715 2967762227 2967755722 Bacteria 6814706
716 2967766739 2967762386 Bacteria 6923502
717 2967775199 2967769361 Bacteria 6587838
718 2967782608 2967775926 Bacteria 6738189
719 2970026362 2970019648 Bacteria 7072033
720 2970033121 2970026789 Bacteria 6785236
721 2970034148 2970033650 Bacteria 7118744
722 2970046970 2970040964 Bacteria 6731123
723 2970051795 2970047711 Bacteria 7088379
724 2970060506 2970054988 Bacteria 6611507
725 2970062281 2970061556 Bacteria 7099761
726 2970069231 2970068827 Bacteria 7123112
727 2970079547 2970076120 Bacteria 6697332
728 2970086677 2970082768 Bacteria 6183754
729 2970091738 2970088815 Bacteria 6933825
730 2970102539 2970095765 Bacteria 6936963
731 2970107857 2970102677 Bacteria 6812532
732 2970115556 2970109326 Bacteria 6863976
733 2970120782 2970116247 Bacteria 6501857
734 2970128519 2970122695 Bacteria 6625855
735 2970129814 2970129317 Bacteria 6806560
736 2970143451 2970136068 Bacteria 7207982
737 2970149811 2970143518 Bacteria 6446480
738 2970156336 2970149975 Bacteria 6779706
739 2970158341 2970156795 Bacteria 7168044
740 2970167607 2970164137 Bacteria 6861252
741 2970173588 2970170962 Bacteria 6876229
742 2970178667 2970177841 Bacteria 6768001
743 2970190747 2970184632 Bacteria 7054431
744 2970198216 2970191845 Bacteria 7032787
745 2977520502 2977516862 Bacteria 6940108
746 2977530225 2977523885 Bacteria 6960446
747 2977532345 2977530762 Bacteria 6951399
748 2977541447 2977537788 Bacteria 6929320
749 2977551372 2977544691 Bacteria 6875412
750 2977557499 2977551784 Bacteria 7125765
751 2977559958 2977558990 Bacteria 6863948
752 2977569829 2977565890 Bacteria 6901543
753 2977578819 2977572785 Bacteria 6763888
754 2977583943 2977579622 Bacteria 6772100
755 2978974443 2978969890 Bacteria 5400756
756 2979094523 2979089926 Bacteria 5670289
757 2979098094 2979095461 Bacteria 5669583
758 2979103765 2979100975 Bacteria 5423623
759 2984511669 2984509177 Bacteria 5274802
760 2984521970 2984518228 Bacteria 5277463
761 2984541268 2984537506 Bacteria 5277481
762 2984589781 2984587000 Bacteria 5263363
763 2984603546 2984601300 Bacteria 5455244
764 2989353401 2989349275 Bacteria 6349068
765 2989775906 2989771324 Bacteria 5605128
766 2996898883 2996893221 Bacteria 5823108
767 3003933078 3003930520 Bacteria 5667563
768 643825412 643692032 Bacteria 6891900
769 648741354 648276728 Bacteria 6968865
770 650740402 650716007 Bacteria 5573770
771 8001845412 8001845381 Bacteria 5804942
772 8003571464 8003570095 Bacteria 5747666
773 8003993241 8003992118 Bacteria 7266902
774 8004000498 8003999396 Bacteria 7063185
775 8024489488 8024486573 Bacteria 6540512
776 8045865491 8045864390 Bacteria 5043873
777 8054462017 8054460903 Bacteria 4872905
778 8054562913 8054558443 Bacteria 5204801
779 Ga0501034_0007127
780 JGI24740J21852_10002133
781 JGI24740J21852_10038834
782 JGI25158J39367_1001134
783 JGI25152J39213_1036488
784 JGI25159J45721_1001742
785 JGI25151J46595_10000038
786 JGI25151J46595_10033134
787 JGI25165J46597_1013643
788 JGI25160J50197_1002401
789 JGI25160J50197_1023262
790 JGI25161J50226_1002372
791 Ga0006562J51391_1004293
792 Ga0006562J51391_1024742
793 Ga0055526_1003723
794 Ga0055526_1006649
795 Ga0055526_1007926
796 Ga0055526_1011996
797 Ga0055526_1012008
798 Ga0055524_1006440
799 Ga0055524_1073072
800 Ga0055536_1001886
801 Ga0055536_1002273
802 Ga0055528_1067071
803 Ga0055530_10024067
804 Ga0055531_10002421
805 Ga0055531_10017723
806 Ga0055543_1000856
807 Ga0058863_11693745
808 Ga0065165_1002620
809 Ga0070683_100320604
810 Ga0070683_101890700
811 Ga0070683_102389569
812 Ga0068869_100104915
813 Ga0070666_11467565
814 Ga0070680_100019894
815 Ga0070680_101866482
816 Ga0070682_100023836
817 Ga0070660_100440227
818 Ga0070691_10009880
819 Ga0070661_101186508
820 Ga0070692_10781994
821 Ga0070668_101925805
822 Ga0070673_101480685
823 Ga0070688_100380571
824 Ga0070659_101249388
825 Ga0070703_10308472
826 Ga0070705_100091317
827 Ga0070694_100222560
828 Ga0070663_100136781
829 Ga0070663_101742180
830 Ga0070678_100021594
831 Ga0070681_10007102
832 Ga0070679_100035523
833 Ga0070684_101563992
834 Ga0068853_100006917
835 Ga0070695_100090950
836 Ga0070696_100006293
837 Ga0070693_100011024
838 Ga0070665_102502843
839 Ga0070704_100332501
840 Ga0070664_100068199
841 Ga0068857_100128196
842 Ga0068857_101469202
843 Ga0070702_100213515
844 Ga0068852_101644606
845 Ga0068864_102115899
846 Ga0068870_10799251
847 Ga0068860_100163395
848 Ga0075365_10382100
849 Ga0075365_11043898
850 Ga0075364_11060089
851 Ga0075362_10232402
852 Ga0075362_10479714
853 Ga0075369_10079325
854 Ga0075370_10579154
855 Ga0075431_101356955
856 Ga0068865_100456060
857 Ga0079104_1037364
858 Ga0099826_10165412
859 Ga0105243_10014127
860 Ga0105242_10178320
861 Ga0105237_10016531
862 Ga0105238_10215115
863 Ga0105238_11112508
864 Ga0105239_10608275
865 Ga0157370_10420619
866 Ga0157369_10087882
867 Ga0171462_1042
868 Ga0157372_10469158
869 Ga0157375_10341498
870 Ga0163163_10751432
871 Ga0157380_12868643
872 Ga0157379_10273185
873 Ga0157379_10642369
874 Ga0157376_10492824
875 Ga0206353_11755279
876 Ga0214542_1023288
877 Ga0214543_1005345
878 Ga0213872_10012804
879 Ga0213872_10103949
880 Ga0213872_10183657
881 Ga0209436_100747
882 Ga0209673_1037691
883 Ga0209130_1000007
884 Ga0209130_1008921
885 Ga0209675_1002527
886 Ga0209676_1001545
887 Ga0209676_1028639
888 Ga0209025_1000014
889 Ga0209025_1000303
890 Ga0209025_1179903
891 Ga0209564_1000140
892 Ga0209564_1002872
893 Ga0209564_1003215
894 Ga0209050_1002103
895 Ga0209256_1000108
896 Ga0209256_1000540
897 Ga0207426_1000064
898 Ga0209051_1002149
899 Ga0209257_1000817
900 Ga0209257_1061703
901 Ga0207688_10483414
902 Ga0207699_10775565
903 Ga0207643_10882990
904 Ga0207654_10065182
905 Ga0207707_10017730
906 Ga0207671_10301103
907 Ga0207660_10003004
908 Ga0207660_11379492
909 Ga0207652_10232689
910 Ga0207690_10008933
911 Ga0207686_10481845
912 Ga0207709_10018685
913 Ga0207689_10101680
914 Ga0207679_10196515
915 Ga0207667_10128005
916 Ga0207658_10055258
917 Ga0207639_11069964
918 Ga0207678_10000118
919 Ga0207674_10135964
920 Ga0207675_102134487
921 Ga0207683_10026403
922 Ga0207698_10074815
923 Ga0209282_1086341
924 Ga0209974_10092975
925 Ga0209974_10099296
926 Ga0268264_10075388
927 Ga0265319_1072110
928 Ga0265334_10134553
929 Ga0265318_10009217
930 Ga0307515_10017924
931 Ga0265320_10061498
932 Ga0265331_10063094
933 Ga0307513_10402061
934 Ga0307408_100504141
935 Ga0316579_10255456
936 Ga0265342_10111276
937 Ga0307405_10055833
938 Ga0307410_10470776
939 Ga0307412_10758338
940 Ga0307416_100606726
941 Ga0307414_10139116
942 Ga0307414_10746594
943 Ga0307411_10326731
944 Ga0307415_100903696
945 Ga0373948_0190212
946 Ga0373934_0049988
947 Ga0373936_0210250
948 Ga0373939_0066937
949 Ga0373953_0264496
950 Ga0373957_0037891
951 Ga0373955_0045569
952 Ga0373924_0513905
953 Ga0373931_0019779
954 Ga0373933_0127218
955 Ga0316584_0827847
956 Ga0395899_0181581
957 Ga0395900_0300836
958 Ga0395900_0439171
959 Ga0395898_0007760
960 Ga0395898_0509502
961 Ga0395905_0032064
962 Ga0395901_0102929
963 Ga0395901_1974174
964 Ga0400483_002645
965 Ga0400483_032695
966 Ga0400489_86969
967 Ga0237816_03981
968 Ga0436361_0002743
969 Ga0436361_0291348
970 Ga0436361_0925804
971 Ga0436361_1086504
972 Ga0436362_0680415
973 Ga0439436_0051371
974 Ga0439453_0043502
975 Ga0439466_0062082
976 Ga0439466_0090356
977 Ga0439465_0114390
978 Ga0439465_0189032
979 Ga0439465_0232320
980 Ga0451789_1140541
981 Ga0451791_1659963
982 Ga0451797_1119904
983 Ga0451800_1262250
984 Ga0451841_1428859
985 Ga0451855_1035573
986 Ga0439442_040365
987 Ga0439445_0014796
988 Ga0439432_159318
989 Ga0439449_0006732
990 Ga0439452_028778
991 Ga0439434_0022899
992 Ga0466965_0043824
993 Ga0466965_0205491
994 Ga0466965_0353017
995 Ga0466968_0039813
996 Ga0495617_130347
997 Ga0495651_0137565
998 Ga0495653_0956443
999 Ga0495639_0567609
1000 Ga0495585_0262220
1001 Ga0495608_0103481
1002 Ga0495652_0168520
1003 Ga0495587_0020378
1004 Ga0495667_0460271
1005 Ga0495657_0117764
1006 Ga0495599_0298978
1007 Ga0495670_0530728
1008 Ga0495680_0258167
1009 Ga0495675_0040498
1010 Ga0496100_0316414
1011 Ga0496101_0250750
1012 Ga0496102_0021900
1013 Ga0496102_0622502
1014 Ga0496102_1516812
1015 Ga0496102_1792465
1016 Ga0496103_0005971
1017 Ga0496104_0017664
1018 Ga0496104_0038871
1019 Ga0496104_1101570
1020 Ga0496105_0180037
1021 Ga0496106_0004608
1022 Ga0496107_0008725
1023 Ga0496110_0355217
1024 Ga0496114_0381187
1025 Ga0496114_1518847
1026 Ga0496115_0001671
1027 Ga0496115_0999984
1028 Ga0496116_0083743
1029 Ga0496116_0121347
1030 Ga0496116_0369072
1031 Ga0496117_0085746
1032 Ga0496117_0115516
1033 Ga0496117_0280764
1034 Ga0496119_0276186
1035 Ga0496121_0018961
1036 Ga0496121_0058894
1037 Ga0496121_0473270
1038 Ga0496122_0019871
1039 Ga0496122_0344328
1040 Ga0496123_0008564
1041 Ga0496123_0073670
1042 Ga0496124_0326832
1043 Ga0496125_0000815
1044 Ga0496125_0053349
1045 Ga0496125_0155181
1046 Ga0496125_0410546
1047 Ga0496126_0036822
1048 Ga0496126_0269663
1049 Ga0501306_000444
1050 Ga0501306_001033
1051 Ga0501306_004298
1052 Ga0501306_007899
1053 Ga0501308_064523
1054 Ga0501309_004872
1055 Ga0501309_022451
1056 Ga0501310_001976
1057 Ga0501310_015362
1058 Ga0501310_063217
1059 Ga0501341_05883
1060 Ga0501304_000523
1061 Ga0501305_009509
1062 Ga0501305_089282
1063 Ga0501307_026867
1064 Ga0501307_040231
1065 Ga0501307_079477
1066 Ga0501294_026713
1067 Ga0501303_037340
1068 Ga0501311_006601
1069 Ga0501311_050333
1070 Ga0501311_100954
1071 Ga0501312_002690
1072 Ga0501314_000486
1073 Ga0501314_002564
1074 Ga0501314_002648
1075 Ga0501315_000060
1076 Ga0501315_040696
1077 Ga0501315_053140
1078 Ga0501315_103836
1079 Ga0501316_000132
1080 Ga0501316_051721
1081 Ga0501317_000084
1082 Ga0501318_008515
1083 Ga0501319_002038
1084 Ga0501320_005669
1085 Ga0501320_007634
1086 Ga0501320_016479
1087 Ga0501321_033209
1088 Ga0501322_018829
1089 Ga0501323_005178
1090 Ga0501325_003833
1091 Ga0501326_04357
1092 Ga0501332_01776
1093 Ga0501335_000789
1094 Ga0501031_0000651
1095 Ga0501031_0004402
1096 Ga0501032_0000111
1097 Ga0501032_0006160
1098 Ga0501032_0014074
1099 Ga0501032_0173231
1100 Ga0501032_0320313
1101 Ga0501032_0345929
1102 Ga0501032_0491575
1103 Ga0501033_0007122
1104 Ga0501033_0010287
1105 Ga0501033_0080471
1106 Ga0501033_0194969
1107 Ga0501033_0341631
1108 Ga0501033_0387415
1109 Ga0501033_0857555
1110 Ga0501034_0000208
1111 Ga0501034_0004897
1112 Ga0501034_0009019
1113 Ga0501034_0009460
1114 Ga0501034_0030885
1115 Ga0501034_0053012
1116 Ga0501034_0069393
1117 Ga0501034_1117733
1118 Ga0501034_1231203
1119 Ga0501036_0002605
1120 Ga0501036_0074242
1121 Ga0501036_0087845
1122 Ga0501036_0194494
1123 Ga0501036_0454935
1124 Ga0501036_0862776
1125 Ga0501036_1209638
1126 Ga0501037_0000131
1127 Ga0501037_0007990
1128 Ga0501037_0061483
1129 Ga0501037_0094809
1130 Ga0501037_0135567
1131 Ga0501037_0183612
1132 Ga0501037_0338366
1133 Ga0501037_0841677
1134 Ga0501038_0000109
1135 Ga0501038_0009962
1136 Ga0501038_0047294
1137 Ga0501038_0213052
1138 Ga0501038_0655218
1139 Ga0501038_0813200
1140 Ga0501039_0000072
1141 Ga0501039_0002279
1142 Ga0501039_0765045
1143 Ga0501040_0046602
1144 Ga0501040_0300420
1145 Ga0501042_0724963
1146 Ga0501043_0015219
1147 Ga0501043_0128759
1148 Ga0501043_0195389
1149 Ga0501046_0004977
1150 Ga0501046_0016665
1151 Ga0501046_0528686
1152 Ga0501047_0001212
1153 Ga0501047_0017299
1154 Ga0501047_0058328
1155 Ga0501047_0317813
1156 Ga0501047_0380412
1157 Ga0501047_0682282
1158 Ga0501047_1205785
1159 Ga0501048_0000501
1160 Ga0501048_0166830
1161 Ga0501067_0001102
1162 Ga0501067_0021386
1163 Ga0501069_0584467
1164 Ga0501070_0015591
1165 Ga0501070_0016943
1166 Ga0501070_0110480
1167 Ga0501070_0363567
1168 Ga0501070_0487433
1169 Ga0501070_1114929
1170 Ga0501071_0650932
1171 Ga0501072_0596597
1172 Ga0501073_0025762
1173 Ga0501073_0091635
1174 Ga0501073_0208047
1175 Ga0501073_0713502
1176 Ga0501073_0960866
1177 Ga0501074_0886865
1178 Ga0501076_1206125
1179 Ga0501252_088693
1180 Ga0501257_101426
1181 Ga0501080_0000005
1182 Ga0501080_0141993
1183 Ga0501083_0197166
1184 Ga0501083_0597580
1185 Ga0501083_1164584
1186 Ga0501263_026500
1187 Ga0501280_003866
1188 Ga0501035_0000049
1189 Ga0501035_0000347
1190 Ga0501035_0009004
1191 Ga0501035_0112268
1192 Ga0501035_0591111
1193 Ga0501035_1098899
1194 Ga0501044_0000030
1195 Ga0501044_0000234
1196 Ga0501044_0022577
1197 Ga0501044_0050656
1198 Ga0501044_0062595
1199 Ga0501044_0141730
1200 Ga0501044_0737439
1201 Ga0501044_0876789
1202 Ga0501044_1115511
1203 Ga0501044_1164998
1204 Ga0501044_1203502
1205 Ga0501044_1404140
1206 Ga0501045_0262165
1207 nmdc:mga0yw44_31343_c1
1208 nmdc:mga0k408_304127_c1
1209 nmdc:mga07m45_52036_c1
1210 nmdc:mga0sz30_69529_c1
1211 Ga0495612_0061025
1212 Ga0495619_1165051
1213 Ga0500595_071600
1214 Ga0500608_136998
1215 Ga0500618_115134
1216 Ga0500559_0144555
1217 Ga0500559_0471422
1218 Ga0500616_0009749
1219 Ga0500616_0011972
1220 Ga0500616_0019860
1221 Ga0500627_0074523
1222 Ga0500627_0141891
1223 Ga0500634_0000031
1224 Ga0501084_0807405
1225 Ga0587084_021570
1226 Ga0587066_200630
1227 Ga0587077_000009
1228 Ga0587077_001192
1229 Ga0587077_026576
1230 Ga0587077_186543
1231 Ga0587080_021206
1232 Ga0587089_002504
1233 Ga0587090_014809
1234 Ga0587106_001821
1235 Ga0587125_000201
1236 Ga0587101_003354
1237 Ga0587101_058421
1238 Ga0587109_032265
1239 Ga0587062_001650
1240 Ga0587076_001067
1241 Ga0587079_001202
1242 Ga0587111_0000152
1243 Ga0501082_0021073
1244 Ga0501082_1059422
1245 2510308402
1246 2511501273
1247 2512532698
1248 2512971973
1249 2513587135
1250 2513594036
1251 2513607082
1252 2513620836
1253 2513886845
1254 2513906986
1255 2513909598
1256 2513987843
1257 2514008878
1258 2515613333
1259 2516209151
1260 2516892555
1261 2517569367
1262 2524454330
1263 2537874336
1264 2551678253
1265 2551687644
1266 2551728469
1267 2551730900
1268 2551742268
1269 2554248079
1270 2559295196
1271 2599333506
1272 2599601516
1273 2599721230
1274 2600192217
1275 2600375485
1276 2601612145
1277 2601749071
1278 2643808297
1279 2643857821
1280 2643919618
1281 2643963604
1282 2644068117
1283 2644108034
1284 2644150544
1285 2644165887
1286 2644207704
1287 2644310100
1288 2644335306
1289 2644347103
1290 2644379287
1291 2644410388
1292 2644419061
1293 2644450420
1294 2644520159
1295 2644544821
1296 2644617148
1297 2644654489
1298 2644677794
1299 2644687285
1300 2644735423
1301 2657686412
1302 2753359561
1303 2753460133
1304 2758641822
1305 2776913092
1306 2792624838
1307 2792630872
1308 2792642402
1309 2793282380
1310 2802719380
1311 2802723059
1312 2802734756
1313 2802741296
1314 2802745045
1315 2802751480
1316 2804751748
1317 2808985086
1318 2819559514
1319 2819683813
1320 2819720936
1321 2821124588
1322 2828310162
1323 2837653705
1324 2838079222
1325 2838675949
1326 2838714831
1327 2838721368
1328 2838725591
1329 2838742443
1330 2841846400
1331 2841848335
1332 2841859110
1333 2842125635
1334 2842130844
1335 2842146122
1336 2842153986
1337 2842171075
1338 2842177606
1339 2842187940
1340 2842212251
1341 2842226130
1342 2842515894
1343 2844169509
1344 2847418402
1345 2848993381
1346 2854912153
1347 2854919416
1348 2855831625
1349 2855840743
1350 2855873433
1351 2857532169
1352 2858801270
1353 2896386893
1354 2899794871
1355 2899807792
1356 2899848092
1357 2913301776
1358 2915985667
1359 2915991802
1360 2916000605
1361 2916007563
1362 2916008881
1363 2916018774
1364 2916026382
1365 2916034651
1366 2916040632
1367 2916048200
1368 2916054389
1369 2916060798
1370 2916068168
1371 2916075016
1372 2916079907
1373 2917699281
1374 2919114920
1375 2919167992
1376 2920824108
1377 2921208183
1378 2921209424
1379 2921242266
1380 2921248073
1381 2921256123
1382 2921263459
1383 2921270090
1384 2921285908
1385 2921296757
1386 2921299126
1387 2924147668
1388 2924157725
1389 2924165050
1390 2924172870
1391 2924179189
1392 2924184584
1393 2924192968
1394 2924199578
1395 2924204254
1396 2924213328
1397 2924221991
1398 2924233677
1399 2926755886
1400 2926762984
1401 2929140704
1402 2933008631
1403 2933011730
1404 2933596766
1405 2937001412
1406 2937008152
1407 2937015640
1408 2937019600
1409 2937028369
1410 2937034849
1411 2937040791
1412 2937049358
1413 2937056390
1414 2937060869
1415 2937069363
1416 2937076553
1417 2937079344
1418 2937088449
1419 2937096831
1420 2937105920
1421 2937113064
1422 2937118556
1423 2937125238
1424 2937129969
1425 2941499945
1426 2957377131
1427 2957385711
1428 2957388834
1429 2957401724
1430 2957406440
1431 2957414199
1432 2957418167
1433 2957429132
1434 2957435561
1435 2957443035
1436 2957449774
1437 2957453197
1438 2957464197
1439 2957468115
1440 2957477674
1441 2957483693
1442 2957491290
1443 2957496673
1444 2957504891
1445 2957512931
1446 2960586009
1447 2960593524
1448 2960602387
1449 2960609000
1450 2960616763
1451 2960623102
1452 2960630975
1453 2960636897
1454 2960639647
1455 2960652512
1456 2960655266
1457 2960666651
1458 2960673108
1459 2960677294
1460 2960686306
1461 2960693515
1462 2960700508
1463 2964611278
1464 2964621253
1465 2964626449
1466 2964635555
1467 2964641218
1468 2964647065
1469 2964655518
1470 2964661947
1471 2964670116
1472 2964677219
1473 2964684937
1474 2964691771
1475 2964698502
1476 2964703426
1477 2964710555
1478 2964713692
1479 2964721086
1480 2967671048
1481 2967672372
1482 2967683408
1483 2967692234
1484 2967694496
1485 2967702496
1486 2967714194
1487 2967718843
1488 2967726171
1489 2967729651
1490 2967739543
1491 2967745159
1492 2967754770
1493 2967762227
1494 2967766739
1495 2967775199
1496 2967782608
1497 2970026362
1498 2970033121
1499 2970034148
1500 2970046970
1501 2970051795
1502 2970060506
1503 2970062281
1504 2970069231
1505 2970079547
1506 2970086677
1507 2970091738
1508 2970102539
1509 2970107857
1510 2970115556
1511 2970120782
1512 2970128519
1513 2970129814
1514 2970143451
1515 2970149811
1516 2970156336
1517 2970158341
1518 2970167607
1519 2970173588
1520 2970178667
1521 2970190747
1522 2970198216
1523 2977520502
1524 2977530225
1525 2977532345
1526 2977541447
1527 2977551372
1528 2977557499
1529 2977559958
1530 2977569829
1531 2977578819
1532 2977583943
1533 2978974443
1534 2979094523
1535 2979098094
1536 2979103765
1537 2984511669
1538 2984521970
1539 2984541268
1540 2984589781
1541 2984603546
1542 2989353401
1543 2989775906
1544 2996898883
1545 3003933078
1546 643825412
1547 648741354
1548 650740402
1549 8001845412
1550 8003571464
1551 8003993241
1552 8004000498
1553 8024489488
1554 8045865491
1555 8054462017
1556 8054562913

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00861

Ribosomal_L18p

Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast

2

123

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7m4w-assembly1.cif.gz_N a. baumannii ribosome-eravacycline complex: empty 70s 0.9375 3 120
6v3b-assembly1.cif.gz_N cryo-em structure of the acinetobacter baumannii ribosome: 70s in empty state 0.9344 3 120
7unw-assembly1.cif.gz_Q pseudomonas aeruginosa 70s ribosome initiation complex bound to if2-gdpcp (structure ii-b) 0.9337 5 120
7jt1-assembly1.cif.gz_o 70s ribosome stalled on long mrna with arfb-1 and arfb-2 bound (+9-iii) 0.933 3 120
7m4w-assembly1.cif.gz_N a. baumannii ribosome-eravacycline complex: empty 70s 0.9297 3 120
ID Description Score Start End Superfamily
4pecO00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9397 3 120 3.30.420.100
4pecO00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.932 3 120 3.30.420.100
6ddga01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9307 28 120 3.30.420.100
5xymO01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9266 24 120 3.30.420.100
5zetP01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9258 25 120 3.30.420.100
ID Description Score Start End GO Terms
AF-H6SSI5-F1-model_v4 Large ribosomal subunit protein uL18 0.9939 1 120 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A212LCP1-F1-model_v4 Large ribosomal subunit protein uL18 0.9921 8 120 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A848Z4C8-F1-model_v4 Large ribosomal subunit protein uL18 0.9918 1 120 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A7Y8MQ85-F1-model_v4 Large ribosomal subunit protein uL18 0.9917 1 120 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A2A4TGW2-F1-model_v4 Large ribosomal subunit protein uL18 0.9912 1 120 GO:0003735
GO:0006412
GO:0008097
GO:0022625

Map