F480443
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 778 | 427 | 760 | 219 |
Family's Representative Sequence
| Representative Sequence | 3300059491|Ga0587070_002891|Ga0587070_002891_896_1699 |
| Length | 267 |
| Sequence | VQFQIQIVDTHESLKTRVNTDFPADGLQINRTLLMHGIFLSPINSQENKMSLRINDVAPNFTARTTQGTIDFHTWIGDQWAILFSHPKDFTPVCTTELGYMARIEPEFTRRNAKLIGLSIDPVENHDKWVADIEETQGATVKYPMIGDTDLAVAKLYNMLPAEEGGTSEGRTAATNATVRSVFIIGPDKRIKLMLTYPMTTGRNFDEILRALDSMQLTAKHKVATPANWKQGEDVIITPAVSNEEAEKTFPGFKTIKPYLRTTKQPV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 2 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 3 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 4 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 5 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 6 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 7 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 8 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 9 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 10 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 11 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 12 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 13 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 14 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 15 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 16 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 17 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 18 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 19 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 20 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 21 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 22 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 23 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 24 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 25 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 26 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 27 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 36 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 37 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 38 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 39 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 40 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 41 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 42 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 43 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 49 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 52 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 62 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 81 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 83 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 84 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 85 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 87 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 88 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 89 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 90 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 93 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 94 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 95 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 96 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 97 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 98 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 101 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 102 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 103 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 104 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 105 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 107 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 108 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 109 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 121 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 122 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 137 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 145 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 147 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 205 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 206 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 209 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 210 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 214 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 215 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 216 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 217 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 220 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 222 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 223 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 224 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 225 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 226 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 227 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 229 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 230 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 231 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 232 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 233 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 234 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 235 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 236 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 237 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 238 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 239 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 240 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 242 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 243 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 245 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 246 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 248 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 251 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 253 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 254 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 255 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 256 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 257 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 258 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 259 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 260 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 261 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 262 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 264 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 265 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 266 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 267 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 268 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 269 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 270 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 271 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 272 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 273 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 274 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 275 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 276 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 277 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 278 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 279 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 280 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 281 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 282 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 283 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 360 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 361 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 364 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 365 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 366 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 367 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 368 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 369 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 370 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 374 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 377 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 378 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 379 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 380 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 381 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 382 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 383 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 386 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 387 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 390 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 391 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 392 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 393 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 394 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 395 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 396 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 397 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 398 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 399 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 400 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 401 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.8 |
| Metatranscriptomes | 4.88 |
| Isolates | 2.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.35 |
| Nodule | 1.29 |
| Rhizoplane | 0.9 |
| Rhizosphere | 74.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1000411 | 3300002705 | Bacteria | 26753 |
| 2 | JGI25156J39149_1014030 | 3300002705 | Bacteria | 1670 |
| 3 | JGI25154J39366_1003427 | 3300002738 | Bacteria | 3334 |
| 4 | JGI25157J39369_1000052 | 3300002741 | Bacteria | 110463 |
| 5 | JGI25164J39214_1005845 | 3300002772 | Bacteria | 1315 |
| 6 | JGI25152J39213_1000446 | 3300002773 | Bacteria | 24511 |
| 7 | JGI25152J39213_1001630 | 3300002773 | Bacteria | 9362 |
| 8 | JGI25150J39212_1002460 | 3300002774 | Bacteria | 4595 |
| 9 | JGI25150J39212_1006219 | 3300002774 | Bacteria | 2484 |
| 10 | JGI25150J39212_1007122 | 3300002774 | Bacteria | 2266 |
| 11 | JGI25150J39212_1025271 | 3300002774 | Bacteria | 869 |
| 12 | JGI25159J45721_1002937 | 3300002987 | Bacteria | 6211 |
| 13 | JGI25153J46596_10000279 | 3300003215 | Bacteria | 39072 |
| 14 | Ga0055539_1000234 | 3300003752 | Bacteria | 38255 |
| 15 | Ga0055539_1001493 | 3300003752 | Bacteria | 4301 |
| 16 | Ga0055533_1000053 | 3300003756 | Bacteria | 199478 |
| 17 | Ga0055525_1000013 | 3300003759 | Bacteria | 440870 |
| 18 | Ga0055525_1001043 | 3300003759 | Bacteria | 7189 |
| 19 | Ga0055535_1000727 | 3300003761 | Bacteria | 24943 |
| 20 | Ga0055529_1000015 | 3300003763 | Bacteria | 366950 |
| 21 | Ga0055529_1000653 | 3300003763 | Bacteria | 24939 |
| 22 | Ga0055526_1000280 | 3300003771 | Bacteria | 43010 |
| 23 | Ga0055526_1002177 | 3300003771 | Bacteria | 13437 |
| 24 | Ga0055526_1005508 | 3300003771 | Bacteria | 7255 |
| 25 | Ga0055537_1000143 | 3300003773 | Bacteria | 53762 |
| 26 | Ga0055537_1001454 | 3300003773 | Bacteria | 9219 |
| 27 | Ga0055524_1000061 | 3300003775 | Bacteria | 135241 |
| 28 | Ga0055524_1000157 | 3300003775 | Bacteria | 79002 |
| 29 | Ga0055524_1003621 | 3300003775 | Bacteria | 7440 |
| 30 | Ga0055524_1005836 | 3300003775 | Bacteria | 5434 |
| 31 | Ga0055524_1006771 | 3300003775 | Bacteria | 4945 |
| 32 | Ga0055524_1011138 | 3300003775 | Bacteria | 3534 |
| 33 | Ga0055534_1000308 | 3300003784 | Bacteria | 32899 |
| 34 | Ga0055534_1000712 | 3300003784 | Bacteria | 16284 |
| 35 | Ga0055528_1000430 | 3300003790 | Bacteria | 33765 |
| 36 | Ga0055530_10000524 | 3300003791 | Bacteria | 33249 |
| 37 | Ga0055530_10000645 | 3300003791 | Bacteria | 30022 |
| 38 | Ga0055540_1000026 | 3300003792 | Bacteria | 189071 |
| 39 | Ga0055531_10001224 | 3300003794 | Bacteria | 19583 |
| 40 | Ga0055531_10003738 | 3300003794 | Bacteria | 9559 |
| 41 | Ga0055531_10009114 | 3300003794 | Bacteria | 5117 |
| 42 | Ga0055543_1001250 | 3300004625 | Bacteria | 10529 |
| 43 | Ga0055543_1010209 | 3300004625 | Bacteria | 1979 |
| 44 | Ga0065165_1000241 | 3300005262 | Bacteria | 93644 |
| 45 | Ga0065165_1000268 | 3300005262 | Bacteria | 89520 |
| 46 | Ga0065165_1000498 | 3300005262 | Bacteria | 60773 |
| 47 | Ga0065712_10350414 | 3300005290 | Bacteria | 788 |
| 48 | Ga0065707_10003061 | 3300005295 | Bacteria | 7358 |
| 49 | Ga0065707_10032055 | 3300005295 | Bacteria | 1065 |
| 50 | Ga0070658_10072234 | 3300005327 | Bacteria | 2827 |
| 51 | Ga0070658_10256953 | 3300005327 | Bacteria | 1483 |
| 52 | Ga0070658_10299480 | 3300005327 | Bacteria | 1371 |
| 53 | Ga0070658_10670810 | 3300005327 | Bacteria | 900 |
| 54 | Ga0070658_10673660 | 3300005327 | Bacteria | 898 |
| 55 | Ga0070676_10039630 | 3300005328 | Bacteria | 2725 |
| 56 | Ga0070676_10061249 | 3300005328 | Bacteria | 2237 |
| 57 | Ga0070690_100023202 | 3300005330 | Bacteria | 3804 |
| 58 | Ga0070690_100265886 | 3300005330 | Bacteria | 1218 |
| 59 | Ga0070670_100003146 | 3300005331 | Bacteria | 13648 |
| 60 | Ga0070670_100603262 | 3300005331 | Bacteria | 982 |
| 61 | Ga0068869_100002141 | 3300005334 | Bacteria | 11868 |
| 62 | Ga0068869_100048099 | 3300005334 | Bacteria | 3082 |
| 63 | Ga0068869_100175546 | 3300005334 | Bacteria | 1676 |
| 64 | Ga0070680_100056543 | 3300005336 | Bacteria | 3207 |
| 65 | Ga0070680_100173735 | 3300005336 | Bacteria | 1814 |
| 66 | Ga0070682_100034077 | 3300005337 | Bacteria | 3098 |
| 67 | Ga0068868_100143840 | 3300005338 | Bacteria | 1960 |
| 68 | Ga0070660_100018170 | 3300005339 | Bacteria | 5133 |
| 69 | Ga0070660_100187089 | 3300005339 | Bacteria | 1677 |
| 70 | Ga0070691_10155511 | 3300005341 | Bacteria | 1175 |
| 71 | Ga0070687_100392502 | 3300005343 | Bacteria | 908 |
| 72 | Ga0070668_100048017 | 3300005347 | Bacteria | 3283 |
| 73 | Ga0070669_100005491 | 3300005353 | Bacteria | 9153 |
| 74 | Ga0070669_100087500 | 3300005353 | Bacteria | 2330 |
| 75 | Ga0070669_100165396 | 3300005353 | Bacteria | 1721 |
| 76 | Ga0070669_100219175 | 3300005353 | Bacteria | 1504 |
| 77 | Ga0070675_100000072 | 3300005354 | Bacteria | 58324 |
| 78 | Ga0070675_100061753 | 3300005354 | Bacteria | 3095 |
| 79 | Ga0070671_100039005 | 3300005355 | Bacteria | 3943 |
| 80 | Ga0070671_100055959 | 3300005355 | Bacteria | 3282 |
| 81 | Ga0070671_100245284 | 3300005355 | Bacteria | 1521 |
| 82 | Ga0070674_100010657 | 3300005356 | Bacteria | 5569 |
| 83 | Ga0070674_100054836 | 3300005356 | Bacteria | 2758 |
| 84 | Ga0070674_100135474 | 3300005356 | Bacteria | 1841 |
| 85 | Ga0070673_100000785 | 3300005364 | Bacteria | 17673 |
| 86 | Ga0070673_100213740 | 3300005364 | Bacteria | 1667 |
| 87 | Ga0070673_100629416 | 3300005364 | Bacteria | 981 |
| 88 | Ga0070688_100259659 | 3300005365 | Bacteria | 1240 |
| 89 | Ga0070659_100018413 | 3300005366 | Bacteria | 5271 |
| 90 | Ga0070659_100053173 | 3300005366 | Bacteria | 3187 |
| 91 | Ga0070659_100080967 | 3300005366 | Bacteria | 2593 |
| 92 | Ga0070667_100108890 | 3300005367 | Bacteria | 2401 |
| 93 | Ga0070714_100065790 | 3300005435 | Bacteria | 3123 |
| 94 | Ga0070701_10040182 | 3300005438 | Bacteria | 2377 |
| 95 | Ga0070701_10300472 | 3300005438 | Bacteria | 987 |
| 96 | Ga0070678_100018675 | 3300005456 | Bacteria | 4499 |
| 97 | Ga0070678_100066923 | 3300005456 | Bacteria | 2672 |
| 98 | Ga0070678_100130258 | 3300005456 | Bacteria | 1997 |
| 99 | Ga0070678_100309326 | 3300005456 | Bacteria | 1346 |
| 100 | Ga0070662_100019823 | 3300005457 | Bacteria | 4573 |
| 101 | Ga0070662_100081326 | 3300005457 | Bacteria | 2413 |
| 102 | Ga0070681_10198329 | 3300005458 | Bacteria | 1926 |
| 103 | Ga0070681_10766076 | 3300005458 | Bacteria | 882 |
| 104 | Ga0068867_100003414 | 3300005459 | Bacteria | 11183 |
| 105 | Ga0068867_100004430 | 3300005459 | Bacteria | 9872 |
| 106 | Ga0068867_100006335 | 3300005459 | Bacteria | 8372 |
| 107 | Ga0068867_100088266 | 3300005459 | Bacteria | 2349 |
| 108 | Ga0068867_100172756 | 3300005459 | Bacteria | 1713 |
| 109 | Ga0070699_100022397 | 3300005518 | Bacteria | 5444 |
| 110 | Ga0070679_100035375 | 3300005530 | Bacteria | 4955 |
| 111 | Ga0070684_100158031 | 3300005535 | Bacteria | 2056 |
| 112 | Ga0070697_100687163 | 3300005536 | Bacteria | 902 |
| 113 | Ga0068853_100090736 | 3300005539 | Bacteria | 2686 |
| 114 | Ga0068853_100562867 | 3300005539 | Bacteria | 1080 |
| 115 | Ga0070672_100000977 | 3300005543 | Bacteria | 17279 |
| 116 | Ga0070672_100221642 | 3300005543 | Bacteria | 1587 |
| 117 | Ga0070672_100237621 | 3300005543 | Bacteria | 1532 |
| 118 | Ga0070672_100764405 | 3300005543 | Bacteria | 849 |
| 119 | Ga0070686_100033563 | 3300005544 | Bacteria | 3155 |
| 120 | Ga0070695_100187004 | 3300005545 | Bacteria | 1471 |
| 121 | Ga0070693_100047005 | 3300005547 | Bacteria | 2454 |
| 122 | Ga0070665_100059416 | 3300005548 | Bacteria | 3832 |
| 123 | Ga0070665_100292191 | 3300005548 | Bacteria | 1632 |
| 124 | Ga0068855_100007935 | 3300005563 | Bacteria | 12827 |
| 125 | Ga0068855_100029432 | 3300005563 | Bacteria | 6565 |
| 126 | Ga0068855_100590336 | 3300005563 | Bacteria | 1199 |
| 127 | Ga0070664_100205710 | 3300005564 | Bacteria | 1758 |
| 128 | Ga0068857_100001467 | 3300005577 | Bacteria | 18753 |
| 129 | Ga0068857_100075039 | 3300005577 | Bacteria | 3014 |
| 130 | Ga0068854_100021390 | 3300005578 | Bacteria | 4390 |
| 131 | Ga0068854_100163393 | 3300005578 | Bacteria | 1726 |
| 132 | Ga0068856_100007649 | 3300005614 | Bacteria | 10544 |
| 133 | Ga0070702_100307034 | 3300005615 | Bacteria | 1100 |
| 134 | Ga0068852_100362082 | 3300005616 | Bacteria | 1419 |
| 135 | Ga0068852_100790507 | 3300005616 | Bacteria | 963 |
| 136 | Ga0068859_100091484 | 3300005617 | Bacteria | 3093 |
| 137 | Ga0068864_100001546 | 3300005618 | Bacteria | 18969 |
| 138 | Ga0068866_10000430 | 3300005718 | Bacteria | 19430 |
| 139 | Ga0068866_10021411 | 3300005718 | Bacteria | 2978 |
| 140 | Ga0068861_100003155 | 3300005719 | Bacteria | 10900 |
| 141 | Ga0068861_100523520 | 3300005719 | Bacteria | 1076 |
| 142 | Ga0068863_100158772 | 3300005841 | Bacteria | 2165 |
| 143 | Ga0068858_100086090 | 3300005842 | Bacteria | 2923 |
| 144 | Ga0068860_100002904 | 3300005843 | Bacteria | 17746 |
| 145 | Ga0068860_100102547 | 3300005843 | Bacteria | 2730 |
| 146 | Ga0068860_100204943 | 3300005843 | Bacteria | 1912 |
| 147 | Ga0068862_100018548 | 3300005844 | Bacteria | 5796 |
| 148 | Ga0068862_100344778 | 3300005844 | Bacteria | 1380 |
| 149 | Ga0075364_10137789 | 3300006051 | Bacteria | 1640 |
| 150 | Ga0075362_10002903 | 3300006177 | Bacteria | 5868 |
| 151 | Ga0075367_10010462 | 3300006178 | Bacteria | 4874 |
| 152 | Ga0075366_10001896 | 3300006195 | Bacteria | 10558 |
| 153 | Ga0075366_10004969 | 3300006195 | Bacteria | 7174 |
| 154 | Ga0075366_10005657 | 3300006195 | Bacteria | 6777 |
| 155 | Ga0075366_10011710 | 3300006195 | Bacteria | 4957 |
| 156 | Ga0075366_10030492 | 3300006195 | Bacteria | 3170 |
| 157 | Ga0075366_10034154 | 3300006195 | Bacteria | 2996 |
| 158 | Ga0075366_10034881 | 3300006195 | Bacteria | 2965 |
| 159 | Ga0097621_100302867 | 3300006237 | Bacteria | 1412 |
| 160 | Ga0097621_100343135 | 3300006237 | Bacteria | 1326 |
| 161 | Ga0075370_10000577 | 3300006353 | Bacteria | 14108 |
| 162 | Ga0075370_10002114 | 3300006353 | Bacteria | 9064 |
| 163 | Ga0075370_10026890 | 3300006353 | Bacteria | 3189 |
| 164 | Ga0075370_10027005 | 3300006353 | Bacteria | 3183 |
| 165 | Ga0068871_100175685 | 3300006358 | Bacteria | 1838 |
| 166 | Ga0068871_100665355 | 3300006358 | Bacteria | 952 |
| 167 | Ga0075430_100085982 | 3300006846 | Bacteria | 2632 |
| 168 | Ga0075431_100002911 | 3300006847 | Bacteria | 16568 |
| 169 | Ga0068865_100390618 | 3300006881 | Bacteria | 1137 |
| 170 | Ga0097620_100091482 | 3300006931 | Bacteria | 3093 |
| 171 | Ga0099824_1035904 | 3300006942 | Bacteria | 1477 |
| 172 | Ga0099823_1000009 | 3300006944 | Bacteria | 99451 |
| 173 | Ga0079104_1000093 | 3300006946 | Bacteria | 130633 |
| 174 | Ga0079104_1043049 | 3300006946 | Bacteria | 1042 |
| 175 | Ga0099795_10159958 | 3300007788 | Bacteria | 929 |
| 176 | Ga0105240_10003357 | 3300009093 | Bacteria | 24898 |
| 177 | Ga0105240_10011396 | 3300009093 | Bacteria | 12386 |
| 178 | Ga0105240_10020177 | 3300009093 | Bacteria | 8897 |
| 179 | Ga0105240_10050940 | 3300009093 | Bacteria | 5214 |
| 180 | Ga0105240_10059526 | 3300009093 | Bacteria | 4766 |
| 181 | Ga0111539_10091684 | 3300009094 | Bacteria | 3570 |
| 182 | Ga0105245_10029752 | 3300009098 | Bacteria | 4828 |
| 183 | Ga0105243_10001906 | 3300009148 | Bacteria | 17788 |
| 184 | Ga0105243_10057702 | 3300009148 | Bacteria | 3092 |
| 185 | Ga0105243_10102221 | 3300009148 | Bacteria | 2381 |
| 186 | Ga0105243_10170483 | 3300009148 | Bacteria | 1884 |
| 187 | Ga0105243_10364324 | 3300009148 | Bacteria | 1331 |
| 188 | Ga0105243_10781506 | 3300009148 | Bacteria | 939 |
| 189 | Ga0105242_10006750 | 3300009176 | Bacteria | 8850 |
| 190 | Ga0105242_10474007 | 3300009176 | Bacteria | 1185 |
| 191 | Ga0105248_10015504 | 3300009177 | Bacteria | 8402 |
| 192 | Ga0105248_10423968 | 3300009177 | Bacteria | 1498 |
| 193 | Ga0105237_10002251 | 3300009545 | Bacteria | 24020 |
| 194 | Ga0105237_10031465 | 3300009545 | Bacteria | 5380 |
| 195 | Ga0105237_10333668 | 3300009545 | Bacteria | 1521 |
| 196 | Ga0105238_10083823 | 3300009551 | Bacteria | 3177 |
| 197 | Ga0105249_10005323 | 3300009553 | Bacteria | 11104 |
| 198 | Ga0105249_10024181 | 3300009553 | Bacteria | 5459 |
| 199 | Ga0105249_10029171 | 3300009553 | Bacteria | 4982 |
| 200 | Ga0105239_10002342 | 3300010375 | Bacteria | 24158 |
| 201 | Ga0105239_10021943 | 3300010375 | Bacteria | 7038 |
| 202 | Ga0105239_10025127 | 3300010375 | Bacteria | 6561 |
| 203 | Ga0105239_10061489 | 3300010375 | Bacteria | 4122 |
| 204 | Ga0105239_10065176 | 3300010375 | Bacteria | 4000 |
| 205 | Ga0105239_10089281 | 3300010375 | Bacteria | 3399 |
| 206 | Ga0105239_11135333 | 3300010375 | Bacteria | 900 |
| 207 | Ga0157319_1000005 | 3300012497 | Bacteria | 372810 |
| 208 | Ga0157327_1002797 | 3300012512 | Bacteria | 1235 |
| 209 | Ga0157373_10030622 | 3300013100 | Bacteria | 3872 |
| 210 | Ga0157373_10170000 | 3300013100 | Bacteria | 1534 |
| 211 | Ga0157369_10054582 | 3300013105 | Bacteria | 4315 |
| 212 | Ga0157369_10477878 | 3300013105 | Bacteria | 1290 |
| 213 | Ga0157374_10021548 | 3300013296 | Bacteria | 5736 |
| 214 | Ga0157378_10001111 | 3300013297 | Bacteria | 24480 |
| 215 | Ga0157378_10029548 | 3300013297 | Bacteria | 4840 |
| 216 | Ga0157378_10568832 | 3300013297 | Bacteria | 1141 |
| 217 | Ga0163162_10082200 | 3300013306 | Bacteria | 3293 |
| 218 | Ga0163162_10244961 | 3300013306 | Bacteria | 1924 |
| 219 | Ga0163162_10958433 | 3300013306 | Bacteria | 966 |
| 220 | Ga0157372_10262240 | 3300013307 | Bacteria | 2006 |
| 221 | Ga0157375_10068867 | 3300013308 | Bacteria | 3542 |
| 222 | Ga0157375_10108223 | 3300013308 | Bacteria | 2874 |
| 223 | Ga0157375_10192986 | 3300013308 | Bacteria | 2192 |
| 224 | Ga0157380_10046225 | 3300014326 | Bacteria | 3418 |
| 225 | Ga0157380_10312297 | 3300014326 | Bacteria | 1453 |
| 226 | Ga0157379_10008561 | 3300014968 | Bacteria | 8902 |
| 227 | Ga0157379_10011067 | 3300014968 | Bacteria | 7864 |
| 228 | Ga0157379_10036083 | 3300014968 | Bacteria | 4409 |
| 229 | Ga0157379_10239194 | 3300014968 | Bacteria | 1647 |
| 230 | Ga0157376_10396404 | 3300014969 | Bacteria | 1333 |
| 231 | Ga0182005_1043544 | 3300015265 | Bacteria | 1220 |
| 232 | Ga0163161_10075781 | 3300017792 | Bacteria | 2469 |
| 233 | Ga0206351_10127825 | 3300020077 | Bacteria | 757 |
| 234 | Ga0206350_11556907 | 3300020080 | Bacteria | 883 |
| 235 | Ga0213872_10000026 | 3300021361 | Bacteria | 149852 |
| 236 | Ga0213872_10000033 | 3300021361 | Bacteria | 135667 |
| 237 | Ga0213872_10000160 | 3300021361 | Bacteria | 61551 |
| 238 | Ga0213872_10021539 | 3300021361 | Bacteria | 2968 |
| 239 | Ga0209674_100039 | 3300025226 | Bacteria | 402292 |
| 240 | Ga0209672_110257 | 3300025228 | Bacteria | 1275 |
| 241 | Ga0209563_100025 | 3300025230 | Bacteria | 596456 |
| 242 | Ga0209563_100080 | 3300025230 | Bacteria | 199504 |
| 243 | Ga0207427_100466 | 3300025231 | Bacteria | 22197 |
| 244 | Ga0209258_100189 | 3300025242 | Bacteria | 128268 |
| 245 | Ga0209258_100222 | 3300025242 | Bacteria | 107982 |
| 246 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 247 | Ga0207425_1000441 | 3300025245 | Bacteria | 27232 |
| 248 | Ga0207425_1000795 | 3300025245 | Bacteria | 16102 |
| 249 | Ga0207425_1026227 | 3300025245 | Bacteria | 1197 |
| 250 | Ga0209646_1000076 | 3300025246 | Bacteria | 212891 |
| 251 | Ga0209646_1024723 | 3300025246 | Bacteria | 844 |
| 252 | Ga0209026_1000011 | 3300025250 | Bacteria | 507291 |
| 253 | Ga0209026_1005603 | 3300025250 | Bacteria | 3323 |
| 254 | Ga0209677_100086 | 3300025253 | Bacteria | 112759 |
| 255 | Ga0209677_100399 | 3300025253 | Bacteria | 26179 |
| 256 | Ga0209759_1000034 | 3300025256 | Bacteria | 271209 |
| 257 | Ga0209759_1004758 | 3300025256 | Bacteria | 4962 |
| 258 | Ga0209759_1011716 | 3300025256 | Bacteria | 2473 |
| 259 | Ga0209129_1000001 | 3300025258 | Bacteria | 1452436 |
| 260 | Ga0209129_1000027 | 3300025258 | Bacteria | 409587 |
| 261 | Ga0209565_1000009 | 3300025263 | Bacteria | 751701 |
| 262 | Ga0209565_1001648 | 3300025263 | Bacteria | 9367 |
| 263 | Ga0209565_1005823 | 3300025263 | Bacteria | 3537 |
| 264 | Ga0209565_1017728 | 3300025263 | Bacteria | 1555 |
| 265 | Ga0209455_1000031 | 3300025272 | Bacteria | 519952 |
| 266 | Ga0209455_1000092 | 3300025272 | Bacteria | 220516 |
| 267 | Ga0209673_1000019 | 3300025273 | Bacteria | 449094 |
| 268 | Ga0209673_1005892 | 3300025273 | Bacteria | 6059 |
| 269 | Ga0209130_1000143 | 3300025284 | Bacteria | 114072 |
| 270 | Ga0209675_1000028 | 3300025291 | Bacteria | 281253 |
| 271 | Ga0209675_1006223 | 3300025291 | Bacteria | 4833 |
| 272 | Ga0209675_1018481 | 3300025291 | Bacteria | 1950 |
| 273 | Ga0209025_1005287 | 3300025294 | Bacteria | 10605 |
| 274 | Ga0209564_1000058 | 3300025295 | Bacteria | 332955 |
| 275 | Ga0209564_1000139 | 3300025295 | Bacteria | 180328 |
| 276 | Ga0209564_1000178 | 3300025295 | Bacteria | 151982 |
| 277 | Ga0209758_1000052 | 3300025297 | Bacteria | 338962 |
| 278 | Ga0209758_1000116 | 3300025297 | Bacteria | 198356 |
| 279 | Ga0209758_1002821 | 3300025297 | Bacteria | 16907 |
| 280 | Ga0209050_1000228 | 3300025298 | Bacteria | 123537 |
| 281 | Ga0209050_1000271 | 3300025298 | Bacteria | 110802 |
| 282 | Ga0209050_1002329 | 3300025298 | Bacteria | 16699 |
| 283 | Ga0209050_1003009 | 3300025298 | Bacteria | 13085 |
| 284 | Ga0209050_1014479 | 3300025298 | Bacteria | 3391 |
| 285 | Ga0209256_1000030 | 3300025299 | Bacteria | 414828 |
| 286 | Ga0209256_1000093 | 3300025299 | Bacteria | 209318 |
| 287 | Ga0209256_1000177 | 3300025299 | Bacteria | 125603 |
| 288 | Ga0209256_1000297 | 3300025299 | Bacteria | 86973 |
| 289 | Ga0209256_1001157 | 3300025299 | Bacteria | 29830 |
| 290 | Ga0209256_1002481 | 3300025299 | Bacteria | 14959 |
| 291 | Ga0209256_1012712 | 3300025299 | Bacteria | 3190 |
| 292 | Ga0209256_1056153 | 3300025299 | Bacteria | 933 |
| 293 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 294 | Ga0209051_1000845 | 3300025303 | Bacteria | 31409 |
| 295 | Ga0209051_1002272 | 3300025303 | Bacteria | 14079 |
| 296 | Ga0209051_1002487 | 3300025303 | Bacteria | 13147 |
| 297 | Ga0209051_1064372 | 3300025303 | Bacteria | 1136 |
| 298 | Ga0209257_1000021 | 3300025304 | Bacteria | 771986 |
| 299 | Ga0209257_1000347 | 3300025304 | Bacteria | 95122 |
| 300 | Ga0209257_1000423 | 3300025304 | Bacteria | 81354 |
| 301 | Ga0209257_1003909 | 3300025304 | Bacteria | 12125 |
| 302 | Ga0207697_10005999 | 3300025315 | Bacteria | 5563 |
| 303 | Ga0207682_10002371 | 3300025893 | Bacteria | 8480 |
| 304 | Ga0207642_10000630 | 3300025899 | Bacteria | 10802 |
| 305 | Ga0207642_10080456 | 3300025899 | Bacteria | 1580 |
| 306 | Ga0207680_10070242 | 3300025903 | Bacteria | 2167 |
| 307 | Ga0207645_10001065 | 3300025907 | Bacteria | 22694 |
| 308 | Ga0207705_10037405 | 3300025909 | Bacteria | 3473 |
| 309 | Ga0207705_10356187 | 3300025909 | Bacteria | 1128 |
| 310 | Ga0207705_10362684 | 3300025909 | Bacteria | 1117 |
| 311 | Ga0207705_10363767 | 3300025909 | Bacteria | 1116 |
| 312 | Ga0207705_10398202 | 3300025909 | Bacteria | 1065 |
| 313 | Ga0207705_10478678 | 3300025909 | Bacteria | 966 |
| 314 | Ga0207684_10065282 | 3300025910 | Bacteria | 3090 |
| 315 | Ga0207695_10010875 | 3300025913 | Bacteria | 11080 |
| 316 | Ga0207695_10037384 | 3300025913 | Bacteria | 5238 |
| 317 | Ga0207695_10088248 | 3300025913 | Bacteria | 3122 |
| 318 | Ga0207695_10095759 | 3300025913 | Bacteria | 2971 |
| 319 | Ga0207695_10109182 | 3300025913 | Bacteria | 2749 |
| 320 | Ga0207671_10012208 | 3300025914 | Bacteria | 6927 |
| 321 | Ga0207671_10012547 | 3300025914 | Bacteria | 6805 |
| 322 | Ga0207671_10061608 | 3300025914 | Bacteria | 2784 |
| 323 | Ga0207660_10303898 | 3300025917 | Bacteria | 1271 |
| 324 | Ga0207662_10413945 | 3300025918 | Bacteria | 916 |
| 325 | Ga0207657_10003079 | 3300025919 | Bacteria | 17838 |
| 326 | Ga0207657_10024490 | 3300025919 | Bacteria | 5585 |
| 327 | Ga0207657_10168314 | 3300025919 | Bacteria | 1777 |
| 328 | Ga0207657_10181957 | 3300025919 | Bacteria | 1699 |
| 329 | Ga0207652_10282471 | 3300025921 | Bacteria | 1497 |
| 330 | Ga0207681_10034332 | 3300025923 | Bacteria | 3334 |
| 331 | Ga0207681_10035725 | 3300025923 | Bacteria | 3276 |
| 332 | Ga0207681_10040907 | 3300025923 | Bacteria | 3087 |
| 333 | Ga0207694_10020846 | 3300025924 | Bacteria | 4962 |
| 334 | Ga0207694_10112742 | 3300025924 | Bacteria | 2164 |
| 335 | Ga0207694_10725086 | 3300025924 | Bacteria | 839 |
| 336 | Ga0207650_10002045 | 3300025925 | Bacteria | 14115 |
| 337 | Ga0207659_10000081 | 3300025926 | Bacteria | 58985 |
| 338 | Ga0207687_10683519 | 3300025927 | Bacteria | 870 |
| 339 | Ga0207644_10002484 | 3300025931 | Bacteria | 11874 |
| 340 | Ga0207644_10104152 | 3300025931 | Bacteria | 2136 |
| 341 | Ga0207644_10110673 | 3300025931 | Bacteria | 2076 |
| 342 | Ga0207644_10172656 | 3300025931 | Bacteria | 1689 |
| 343 | Ga0207690_10061464 | 3300025932 | Bacteria | 2554 |
| 344 | Ga0207690_10064048 | 3300025932 | Bacteria | 2509 |
| 345 | Ga0207690_10089746 | 3300025932 | Bacteria | 2168 |
| 346 | Ga0207690_10369425 | 3300025932 | Bacteria | 1138 |
| 347 | Ga0207706_10000573 | 3300025933 | Bacteria | 39137 |
| 348 | Ga0207706_10001143 | 3300025933 | Bacteria | 27029 |
| 349 | Ga0207686_10000819 | 3300025934 | Bacteria | 19016 |
| 350 | Ga0207709_10024546 | 3300025935 | Bacteria | 3443 |
| 351 | Ga0207709_10036379 | 3300025935 | Bacteria | 2917 |
| 352 | Ga0207709_10076677 | 3300025935 | Bacteria | 2140 |
| 353 | Ga0207709_10134166 | 3300025935 | Bacteria | 1692 |
| 354 | Ga0207709_10870874 | 3300025935 | Bacteria | 731 |
| 355 | Ga0207669_10011691 | 3300025937 | Bacteria | 4283 |
| 356 | Ga0207669_10221304 | 3300025937 | Bacteria | 1389 |
| 357 | Ga0207704_10028880 | 3300025938 | Bacteria | 3084 |
| 358 | Ga0207704_10029777 | 3300025938 | Bacteria | 3050 |
| 359 | Ga0207704_10175310 | 3300025938 | Bacteria | 1543 |
| 360 | Ga0207704_10187161 | 3300025938 | Bacteria | 1502 |
| 361 | Ga0207691_10000330 | 3300025940 | Bacteria | 47260 |
| 362 | Ga0207691_10048904 | 3300025940 | Bacteria | 3875 |
| 363 | Ga0207691_10116936 | 3300025940 | Bacteria | 2366 |
| 364 | Ga0207691_10195782 | 3300025940 | Bacteria | 1761 |
| 365 | Ga0207691_10297188 | 3300025940 | Bacteria | 1388 |
| 366 | Ga0207691_10919888 | 3300025940 | Bacteria | 732 |
| 367 | Ga0207711_10002273 | 3300025941 | Bacteria | 17244 |
| 368 | Ga0207689_10001898 | 3300025942 | Bacteria | 19753 |
| 369 | Ga0207689_10029679 | 3300025942 | Bacteria | 4564 |
| 370 | Ga0207689_10687375 | 3300025942 | Bacteria | 863 |
| 371 | Ga0207679_10177723 | 3300025945 | Bacteria | 1758 |
| 372 | Ga0207667_10004373 | 3300025949 | Bacteria | 17299 |
| 373 | Ga0207667_10358448 | 3300025949 | Bacteria | 1487 |
| 374 | Ga0207651_10019150 | 3300025960 | Bacteria | 4093 |
| 375 | Ga0207651_10152989 | 3300025960 | Bacteria | 1798 |
| 376 | Ga0207651_10785426 | 3300025960 | Bacteria | 843 |
| 377 | Ga0207712_10002233 | 3300025961 | Bacteria | 12603 |
| 378 | Ga0207712_10036422 | 3300025961 | Bacteria | 3351 |
| 379 | Ga0207712_10363097 | 3300025961 | Bacteria | 1207 |
| 380 | Ga0207712_10628789 | 3300025961 | Bacteria | 931 |
| 381 | Ga0207668_10197801 | 3300025972 | Bacteria | 1598 |
| 382 | Ga0207640_10002317 | 3300025981 | Bacteria | 10231 |
| 383 | Ga0207640_10161612 | 3300025981 | Bacteria | 1658 |
| 384 | Ga0207703_10094321 | 3300026035 | Bacteria | 2523 |
| 385 | Ga0207639_10032301 | 3300026041 | Bacteria | 3852 |
| 386 | Ga0207639_10378033 | 3300026041 | Bacteria | 1271 |
| 387 | Ga0207708_10119063 | 3300026075 | Bacteria | 2057 |
| 388 | Ga0207708_10185253 | 3300026075 | Bacteria | 1654 |
| 389 | Ga0207702_10000392 | 3300026078 | Bacteria | 49946 |
| 390 | Ga0207702_10764720 | 3300026078 | Bacteria | 954 |
| 391 | Ga0207648_10000837 | 3300026089 | Bacteria | 34674 |
| 392 | Ga0207648_10000925 | 3300026089 | Bacteria | 33055 |
| 393 | Ga0207648_10009629 | 3300026089 | Bacteria | 9240 |
| 394 | Ga0207648_10069520 | 3300026089 | Bacteria | 3068 |
| 395 | Ga0207676_10019848 | 3300026095 | Bacteria | 4909 |
| 396 | Ga0207676_10040854 | 3300026095 | Bacteria | 3557 |
| 397 | Ga0207674_10007715 | 3300026116 | Bacteria | 12523 |
| 398 | Ga0207674_10093737 | 3300026116 | Bacteria | 2990 |
| 399 | Ga0207675_100001504 | 3300026118 | Bacteria | 23354 |
| 400 | Ga0207675_100026361 | 3300026118 | Bacteria | 5410 |
| 401 | Ga0207675_100160311 | 3300026118 | Bacteria | 2145 |
| 402 | Ga0207683_10082420 | 3300026121 | Bacteria | 2858 |
| 403 | Ga0207683_10138720 | 3300026121 | Bacteria | 2190 |
| 404 | Ga0207698_10119560 | 3300026142 | Bacteria | 2227 |
| 405 | Ga0209281_1000084 | 3300027111 | Bacteria | 254215 |
| 406 | Ga0209389_1004076 | 3300027296 | Bacteria | 12023 |
| 407 | Ga0209970_1003044 | 3300027614 | Bacteria | 2825 |
| 408 | Ga0209974_10031442 | 3300027876 | Bacteria | 1757 |
| 409 | Ga0265354_1001675 | 3300028016 | Bacteria | 3072 |
| 410 | Ga0265355_1006476 | 3300028036 | Bacteria | 916 |
| 411 | Ga0268266_10725721 | 3300028379 | Bacteria | 958 |
| 412 | Ga0268265_10024928 | 3300028380 | Bacteria | 4239 |
| 413 | Ga0268265_10111076 | 3300028380 | Bacteria | 2238 |
| 414 | Ga0268265_10402721 | 3300028380 | Bacteria | 1265 |
| 415 | Ga0268264_10009151 | 3300028381 | Bacteria | 8210 |
| 416 | Ga0268264_10155190 | 3300028381 | Bacteria | 2057 |
| 417 | Ga0268264_10588861 | 3300028381 | Bacteria | 1095 |
| 418 | Ga0265318_10002705 | 3300028577 | Bacteria | 9300 |
| 419 | Ga0307517_10385540 | 3300028786 | Bacteria | 747 |
| 420 | Ga0307515_10000020 | 3300028794 | Bacteria | 411735 |
| 421 | Ga0307515_10000101 | 3300028794 | Bacteria | 199593 |
| 422 | Ga0307515_10002116 | 3300028794 | Bacteria | 43530 |
| 423 | Ga0307515_10002349 | 3300028794 | Bacteria | 41308 |
| 424 | Ga0307515_10136546 | 3300028794 | Bacteria | 2662 |
| 425 | Ga0307515_10145995 | 3300028794 | Bacteria | 2505 |
| 426 | Ga0307511_10138460 | 3300030521 | Bacteria | 1440 |
| 427 | Ga0265760_10000085 | 3300031090 | Bacteria | 23936 |
| 428 | Ga0265332_10007049 | 3300031238 | Bacteria | 5089 |
| 429 | Ga0265320_10032256 | 3300031240 | Bacteria | 2684 |
| 430 | Ga0265320_10057468 | 3300031240 | Bacteria | 1866 |
| 431 | Ga0265329_10025103 | 3300031242 | Bacteria | 1974 |
| 432 | Ga0265331_10001855 | 3300031250 | Bacteria | 14921 |
| 433 | Ga0265327_10000311 | 3300031251 | Bacteria | 93995 |
| 434 | Ga0265327_10000746 | 3300031251 | Bacteria | 50605 |
| 435 | Ga0265316_10132005 | 3300031344 | Bacteria | 1880 |
| 436 | Ga0307513_10055948 | 3300031456 | Bacteria | 4217 |
| 437 | Ga0307513_10271380 | 3300031456 | Bacteria | 1479 |
| 438 | Ga0307509_10256664 | 3300031507 | Bacteria | 1527 |
| 439 | Ga0307408_100000098 | 3300031548 | Bacteria | 95689 |
| 440 | Ga0307408_100000099 | 3300031548 | Bacteria | 95526 |
| 441 | Ga0307408_100005262 | 3300031548 | Bacteria | 8669 |
| 442 | Ga0307408_100049249 | 3300031548 | Bacteria | 3025 |
| 443 | Ga0307408_100049951 | 3300031548 | Bacteria | 3005 |
| 444 | Ga0307408_100478010 | 3300031548 | Bacteria | 1086 |
| 445 | Ga0307408_100558421 | 3300031548 | Bacteria | 1011 |
| 446 | Ga0307408_100621489 | 3300031548 | Bacteria | 962 |
| 447 | Ga0265314_10000947 | 3300031711 | Bacteria | 34148 |
| 448 | Ga0307516_10000405 | 3300031730 | Bacteria | 56495 |
| 449 | Ga0307516_10002516 | 3300031730 | Bacteria | 24408 |
| 450 | Ga0307405_10238888 | 3300031731 | Bacteria | 1344 |
| 451 | Ga0307405_10304352 | 3300031731 | Bacteria | 1211 |
| 452 | Ga0307410_10036794 | 3300031852 | Bacteria | 3191 |
| 453 | Ga0307410_10051824 | 3300031852 | Bacteria | 2768 |
| 454 | Ga0307406_10010909 | 3300031901 | Bacteria | 5139 |
| 455 | Ga0307406_10016612 | 3300031901 | Bacteria | 4282 |
| 456 | Ga0307407_10356298 | 3300031903 | Bacteria | 1038 |
| 457 | Ga0307412_10026971 | 3300031911 | Bacteria | 3577 |
| 458 | Ga0307412_10032653 | 3300031911 | Bacteria | 3301 |
| 459 | Ga0307409_100804370 | 3300031995 | Bacteria | 948 |
| 460 | Ga0307416_100017128 | 3300032002 | Bacteria | 5058 |
| 461 | Ga0307416_100030133 | 3300032002 | Bacteria | 4067 |
| 462 | Ga0307416_100720995 | 3300032002 | Bacteria | 1088 |
| 463 | Ga0307414_10028351 | 3300032004 | Bacteria | 3631 |
| 464 | Ga0307411_10000301 | 3300032005 | Bacteria | 16473 |
| 465 | Ga0307411_10021264 | 3300032005 | Bacteria | 3792 |
| 466 | Ga0307411_10027072 | 3300032005 | Bacteria | 3463 |
| 467 | Ga0307411_10083154 | 3300032005 | Bacteria | 2210 |
| 468 | Ga0307411_10414543 | 3300032005 | Bacteria | 1117 |
| 469 | Ga0307415_100065489 | 3300032126 | Bacteria | 2532 |
| 470 | Ga0307510_10027809 | 3300033180 | Bacteria | 6469 |
| 471 | Ga0307510_10171624 | 3300033180 | Bacteria | 1747 |
| 472 | Ga0373959_0003495 | 3300034820 | Bacteria | 2505 |
| 473 | Ga0373940_0007581 | 3300035088 | Bacteria | 2453 |
| 474 | Ga0373944_0162151 | 3300035089 | Bacteria | 793 |
| 475 | Ga0373951_0012083 | 3300035091 | Bacteria | 1942 |
| 476 | Ga0373939_0000006 | 3300035114 | Bacteria | 78721 |
| 477 | Ga0373939_0076758 | 3300035114 | Bacteria | 1101 |
| 478 | Ga0373960_0001743 | 3300035121 | Bacteria | 4872 |
| 479 | Ga0373946_0183911 | 3300035171 | Bacteria | 993 |
| 480 | Ga0373962_0055727 | 3300035242 | Bacteria | 1149 |
| 481 | Ga0373931_0000353 | 3300035691 | Bacteria | 18867 |
| 482 | Ga0373935_0183497 | 3300035692 | Bacteria | 1438 |
| 483 | Ga0373927_0021580 | 3300035695 | Bacteria | 4220 |
| 484 | Ga0373925_0017082 | 3300037068 | Bacteria | 5253 |
| 485 | Ga0373925_0035301 | 3300037068 | Bacteria | 3688 |
| 486 | Ga0395899_0008516 | 3300037312 | Bacteria | 7898 |
| 487 | Ga0395899_0172226 | 3300037312 | Bacteria | 1524 |
| 488 | Ga0395900_0331778 | 3300037418 | Bacteria | 1499 |
| 489 | Ga0395898_0220647 | 3300037466 | Bacteria | 1808 |
| 490 | Ga0395898_0254895 | 3300037466 | Bacteria | 1673 |
| 491 | Ga0395898_0403315 | 3300037466 | Bacteria | 1304 |
| 492 | Ga0395905_0008204 | 3300037471 | Bacteria | 10315 |
| 493 | Ga0395905_0023105 | 3300037471 | Bacteria | 5878 |
| 494 | Ga0395905_0027487 | 3300037471 | Bacteria | 5365 |
| 495 | Ga0395905_0073435 | 3300037471 | Bacteria | 3206 |
| 496 | Ga0395905_0127109 | 3300037471 | Bacteria | 2397 |
| 497 | Ga0395905_0146033 | 3300037471 | Bacteria | 2225 |
| 498 | Ga0395901_0002301 | 3300038443 | Bacteria | 19466 |
| 499 | Ga0395901_0115759 | 3300038443 | Bacteria | 2816 |
| 500 | Ga0436361_0147565 | 3300039447 | Bacteria | 50932 |
| 501 | Ga0436361_0237057 | 3300039447 | Bacteria | 1309 |
| 502 | Ga0436361_0287447 | 3300039447 | Bacteria | 113524 |
| 503 | Ga0436361_0601867 | 3300039447 | Bacteria | 31361 |
| 504 | Ga0439436_0001618 | 3300041404 | Bacteria | 6553 |
| 505 | Ga0439436_0002563 | 3300041404 | Bacteria | 5463 |
| 506 | Ga0439436_0036358 | 3300041404 | Bacteria | 1421 |
| 507 | Ga0439447_005664 | 3300041407 | Bacteria | 4136 |
| 508 | Ga0439466_0063517 | 3300041411 | Bacteria | 1185 |
| 509 | Ga0439465_0003102 | 3300041413 | Bacteria | 5436 |
| 510 | Ga0439465_0117790 | 3300041413 | Bacteria | 929 |
| 511 | Ga0451800_1277621 | 3300041459 | Bacteria | 1061 |
| 512 | Ga0451853_3953217 | 3300041512 | Bacteria | 959 |
| 513 | Ga0439445_0000407 | 3300042004 | Bacteria | 8691 |
| 514 | Ga0439449_0002680 | 3300042007 | Bacteria | 6936 |
| 515 | Ga0439455_0068922 | 3300042012 | Bacteria | 948 |
| 516 | Ga0450917_004735 | 3300042120 | Bacteria | 1000 |
| 517 | Ga0450923_000481 | 3300042125 | Bacteria | 4380 |
| 518 | Ga0450888_001982 | 3300042126 | Bacteria | 1996 |
| 519 | Ga0450890_034542 | 3300042127 | Bacteria | 730 |
| 520 | Ga0450891_001521 | 3300042129 | Bacteria | 2387 |
| 521 | Ga0450892_000421 | 3300042130 | Bacteria | 5020 |
| 522 | Ga0450889_000380 | 3300042144 | Bacteria | 4930 |
| 523 | Ga0450907_022205 | 3300042146 | Bacteria | 1069 |
| 524 | Ga0439459_0012332 | 3300042438 | Bacteria | 1520 |
| 525 | Ga0450918_000377 | 3300042531 | Bacteria | 9735 |
| 526 | Ga0450918_003844 | 3300042531 | Bacteria | 2766 |
| 527 | Ga0450893_0038466 | 3300042532 | Bacteria | 870 |
| 528 | Ga0451577_0383272 | 3300042876 | Bacteria | 1276 |
| 529 | Ga0451577_0555699 | 3300042876 | Bacteria | 1042 |
| 530 | Ga0466964_0036245 | 3300044706 | Bacteria | 1977 |
| 531 | Ga0466968_0061387 | 3300044735 | Bacteria | 1621 |
| 532 | Ga0451576_0045972 | 3300045051 | Bacteria | 4597 |
| 533 | Ga0466967_0342898 | 3300045976 | Bacteria | 1445 |
| 534 | Ga0495592_0015786 | 3300046454 | Bacteria | 5730 |
| 535 | Ga0495603_0008193 | 3300046455 | Bacteria | 6315 |
| 536 | Ga0495590_0171762 | 3300046457 | Bacteria | 790 |
| 537 | Ga0495629_0000941 | 3300046459 | Bacteria | 23400 |
| 538 | Ga0495629_0003682 | 3300046459 | Bacteria | 11584 |
| 539 | Ga0495638_0023738 | 3300046460 | Bacteria | 4006 |
| 540 | Ga0495653_0000384 | 3300046463 | Bacteria | 35425 |
| 541 | Ga0495653_0000511 | 3300046463 | Bacteria | 29855 |
| 542 | Ga0495653_0051367 | 3300046463 | Bacteria | 3165 |
| 543 | Ga0495650_0053283 | 3300046471 | Bacteria | 1657 |
| 544 | Ga0495580_0000856 | 3300046472 | Bacteria | 26301 |
| 545 | Ga0495580_0001319 | 3300046472 | Bacteria | 21881 |
| 546 | Ga0495580_0372829 | 3300046472 | Bacteria | 965 |
| 547 | Ga0495582_0000503 | 3300046473 | Bacteria | 21408 |
| 548 | Ga0495664_0001241 | 3300046477 | Bacteria | 13343 |
| 549 | Ga0495584_0005887 | 3300046491 | Bacteria | 6461 |
| 550 | Ga0495596_0001182 | 3300046500 | Bacteria | 15270 |
| 551 | Ga0495607_0010930 | 3300046501 | Bacteria | 6072 |
| 552 | Ga0495607_0099440 | 3300046501 | Bacteria | 1560 |
| 553 | Ga0495583_0000258 | 3300046506 | Bacteria | 87863 |
| 554 | Ga0495606_0000101 | 3300046507 | Bacteria | 146752 |
| 555 | Ga0495606_0000161 | 3300046507 | Bacteria | 117607 |
| 556 | Ga0495606_0002471 | 3300046507 | Bacteria | 21403 |
| 557 | Ga0495606_0011920 | 3300046507 | Bacteria | 7031 |
| 558 | Ga0495606_0058610 | 3300046507 | Bacteria | 2474 |
| 559 | Ga0495608_0004822 | 3300046511 | Bacteria | 9641 |
| 560 | Ga0495610_0002012 | 3300046512 | Bacteria | 17381 |
| 561 | Ga0495610_0025351 | 3300046512 | Bacteria | 3184 |
| 562 | Ga0495610_0028675 | 3300046512 | Bacteria | 2940 |
| 563 | Ga0495610_0146791 | 3300046512 | Bacteria | 1010 |
| 564 | Ga0495616_0005117 | 3300046513 | Bacteria | 8147 |
| 565 | Ga0495618_0001270 | 3300046514 | Bacteria | 17095 |
| 566 | Ga0495628_0149979 | 3300046516 | Bacteria | 1776 |
| 567 | Ga0495630_0024889 | 3300046517 | Bacteria | 4425 |
| 568 | Ga0495632_0012258 | 3300046519 | Bacteria | 4949 |
| 569 | Ga0495637_0000699 | 3300046520 | Bacteria | 23092 |
| 570 | Ga0495643_0074698 | 3300046522 | Bacteria | 1775 |
| 571 | Ga0495648_0012677 | 3300046524 | Bacteria | 6267 |
| 572 | Ga0495648_0028518 | 3300046524 | Bacteria | 3717 |
| 573 | Ga0495648_0047169 | 3300046524 | Bacteria | 2665 |
| 574 | Ga0495648_0075085 | 3300046524 | Bacteria | 1945 |
| 575 | Ga0495663_0100707 | 3300046525 | Bacteria | 951 |
| 576 | Ga0495666_0000277 | 3300046526 | Bacteria | 22271 |
| 577 | Ga0495666_0017842 | 3300046526 | Bacteria | 3535 |
| 578 | Ga0495642_0191748 | 3300046528 | Bacteria | 890 |
| 579 | Ga0495652_0015012 | 3300046529 | Bacteria | 6938 |
| 580 | Ga0495652_0062951 | 3300046529 | Bacteria | 3125 |
| 581 | Ga0495654_0000014 | 3300046530 | Bacteria | 312126 |
| 582 | Ga0495654_0194394 | 3300046530 | Bacteria | 872 |
| 583 | Ga0495640_0002781 | 3300046533 | Bacteria | 14073 |
| 584 | Ga0495640_0019898 | 3300046533 | Bacteria | 4951 |
| 585 | Ga0495586_0001730 | 3300046535 | Bacteria | 11912 |
| 586 | Ga0495587_0000929 | 3300046536 | Bacteria | 19286 |
| 587 | Ga0495587_0049911 | 3300046536 | Bacteria | 2476 |
| 588 | Ga0495598_0003493 | 3300046537 | Bacteria | 3345 |
| 589 | Ga0495609_0001696 | 3300046538 | Bacteria | 14298 |
| 590 | Ga0495621_0020833 | 3300046539 | Bacteria | 2155 |
| 591 | Ga0495597_0000172 | 3300046542 | Bacteria | 57536 |
| 592 | Ga0495597_0011037 | 3300046542 | Bacteria | 4391 |
| 593 | Ga0495597_0053754 | 3300046542 | Bacteria | 1770 |
| 594 | Ga0495645_0008320 | 3300046543 | Bacteria | 7240 |
| 595 | Ga0495645_0136815 | 3300046543 | Bacteria | 1713 |
| 596 | Ga0495633_0005718 | 3300046558 | Bacteria | 7515 |
| 597 | Ga0495633_0012243 | 3300046558 | Bacteria | 4574 |
| 598 | Ga0495633_0021952 | 3300046558 | Bacteria | 3185 |
| 599 | Ga0495667_0202054 | 3300046559 | Bacteria | 1272 |
| 600 | Ga0495668_0000684 | 3300046616 | Bacteria | 40835 |
| 601 | Ga0495668_0006025 | 3300046616 | Bacteria | 8041 |
| 602 | Ga0495634_0004651 | 3300046642 | Bacteria | 10689 |
| 603 | Ga0495634_0018150 | 3300046642 | Bacteria | 5012 |
| 604 | Ga0495611_0340235 | 3300046648 | Bacteria | 689 |
| 605 | Ga0495625_0015168 | 3300046660 | Bacteria | 6115 |
| 606 | Ga0495635_0004874 | 3300046663 | Bacteria | 9340 |
| 607 | Ga0495635_0036315 | 3300046663 | Bacteria | 3416 |
| 608 | Ga0495659_0003984 | 3300046664 | Bacteria | 4675 |
| 609 | Ga0495661_0013760 | 3300046665 | Bacteria | 5428 |
| 610 | Ga0495661_0022967 | 3300046665 | Bacteria | 4054 |
| 611 | Ga0495661_0034543 | 3300046665 | Bacteria | 3181 |
| 612 | Ga0495661_0035672 | 3300046665 | Bacteria | 3118 |
| 613 | Ga0495588_0119838 | 3300046674 | Bacteria | 1387 |
| 614 | Ga0495599_0001289 | 3300046678 | Bacteria | 14231 |
| 615 | Ga0495599_0198320 | 3300046678 | Bacteria | 1233 |
| 616 | Ga0495623_0014147 | 3300046679 | Bacteria | 5168 |
| 617 | Ga0495623_0073646 | 3300046679 | Bacteria | 2123 |
| 618 | Ga0495646_0005054 | 3300046680 | Bacteria | 8316 |
| 619 | Ga0495646_0012497 | 3300046680 | Bacteria | 5397 |
| 620 | Ga0495669_0000453 | 3300046684 | Bacteria | 19290 |
| 621 | Ga0495669_0029841 | 3300046684 | Bacteria | 2393 |
| 622 | Ga0495613_0015748 | 3300046689 | Bacteria | 5628 |
| 623 | Ga0495624_0002063 | 3300046690 | Bacteria | 15308 |
| 624 | Ga0495624_0067058 | 3300046690 | Bacteria | 2239 |
| 625 | Ga0495649_0001048 | 3300046694 | Bacteria | 21684 |
| 626 | Ga0495649_0006112 | 3300046694 | Bacteria | 7526 |
| 627 | Ga0495649_0008449 | 3300046694 | Bacteria | 6194 |
| 628 | Ga0495649_0011217 | 3300046694 | Bacteria | 5267 |
| 629 | Ga0495589_0011552 | 3300046794 | Bacteria | 4584 |
| 630 | Ga0495589_0107721 | 3300046794 | Bacteria | 1346 |
| 631 | Ga0495600_0071877 | 3300046809 | Bacteria | 2260 |
| 632 | Ga0495660_0022202 | 3300046810 | Bacteria | 3626 |
| 633 | Ga0495660_0117143 | 3300046810 | Bacteria | 1352 |
| 634 | Ga0495660_0206962 | 3300046810 | Bacteria | 933 |
| 635 | Ga0495581_0000088 | 3300047315 | Bacteria | 37592 |
| 636 | Ga0495604_0010429 | 3300047317 | Bacteria | 7361 |
| 637 | Ga0495604_0033888 | 3300047317 | Bacteria | 4041 |
| 638 | Ga0495636_0004548 | 3300047318 | Bacteria | 5434 |
| 639 | Ga0495674_0021023 | 3300047319 | Bacteria | 6038 |
| 640 | Ga0495674_0043522 | 3300047319 | Bacteria | 3996 |
| 641 | Ga0495674_0047875 | 3300047319 | Bacteria | 3787 |
| 642 | Ga0495672_0000400 | 3300047320 | Bacteria | 52696 |
| 643 | Ga0495676_0023216 | 3300047321 | Bacteria | 5386 |
| 644 | Ga0495676_0079930 | 3300047321 | Bacteria | 2484 |
| 645 | Ga0495676_0094469 | 3300047321 | Bacteria | 2227 |
| 646 | Ga0495680_0015198 | 3300047322 | Bacteria | 6647 |
| 647 | Ga0495680_0401871 | 3300047322 | Bacteria | 946 |
| 648 | Ga0495683_0045692 | 3300047323 | Bacteria | 2200 |
| 649 | Ga0495687_000128 | 3300047443 | Bacteria | 116626 |
| 650 | Ga0495687_001059 | 3300047443 | Bacteria | 27223 |
| 651 | Ga0495687_003727 | 3300047443 | Bacteria | 10810 |
| 652 | Ga0495677_0006066 | 3300047445 | Bacteria | 4569 |
| 653 | Ga0495677_0021727 | 3300047445 | Bacteria | 2326 |
| 654 | Ga0495679_000374 | 3300047446 | Bacteria | 34258 |
| 655 | Ga0495679_000724 | 3300047446 | Bacteria | 21200 |
| 656 | Ga0495679_013957 | 3300047446 | Bacteria | 2995 |
| 657 | Ga0495673_0040614 | 3300047469 | Bacteria | 2100 |
| 658 | Ga0495681_0010735 | 3300047470 | Bacteria | 5520 |
| 659 | Ga0495686_0001150 | 3300047472 | Bacteria | 31074 |
| 660 | Ga0495686_0004786 | 3300047472 | Bacteria | 10936 |
| 661 | Ga0495686_0008011 | 3300047472 | Bacteria | 7832 |
| 662 | Ga0495686_0010321 | 3300047472 | Bacteria | 6651 |
| 663 | Ga0495593_0000523 | 3300047673 | Bacteria | 21761 |
| 664 | Ga0495593_0003554 | 3300047673 | Bacteria | 9325 |
| 665 | Ga0495602_0018152 | 3300048088 | Bacteria | 7036 |
| 666 | Ga0495602_0100904 | 3300048088 | Bacteria | 2368 |
| 667 | Ga0495614_0001008 | 3300048089 | Bacteria | 12020 |
| 668 | Ga0495614_0019842 | 3300048089 | Bacteria | 2908 |
| 669 | Ga0495626_0094944 | 3300048091 | Bacteria | 1307 |
| 670 | Ga0496100_0489473 | 3300048903 | Bacteria | 947 |
| 671 | Ga0496102_0008917 | 3300048905 | Bacteria | 8606 |
| 672 | Ga0496102_0541693 | 3300048905 | Bacteria | 1087 |
| 673 | Ga0496108_0068954 | 3300048911 | Bacteria | 2984 |
| 674 | Ga0496109_0135001 | 3300048912 | Bacteria | 2305 |
| 675 | Ga0496114_0116017 | 3300048917 | Bacteria | 2298 |
| 676 | Ga0496117_0166489 | 3300048920 | Bacteria | 1285 |
| 677 | Ga0496121_0001461 | 3300048924 | Bacteria | 39903 |
| 678 | Ga0496121_0002415 | 3300048924 | Bacteria | 28634 |
| 679 | Ga0496122_0346328 | 3300048925 | Bacteria | 778 |
| 680 | Ga0496123_0022900 | 3300048926 | Bacteria | 4798 |
| 681 | Ga0496124_0000504 | 3300048927 | Bacteria | 67117 |
| 682 | Ga0496124_0052327 | 3300048927 | Bacteria | 3469 |
| 683 | Ga0496126_0167233 | 3300048929 | Bacteria | 1876 |
| 684 | Ga0496126_0283081 | 3300048929 | Bacteria | 1373 |
| 685 | Ga0501308_004493 | 3300049128 | Bacteria | 1347 |
| 686 | Ga0501304_007572 | 3300049160 | Bacteria | 899 |
| 687 | Ga0495678_039510 | 3300049459 | Bacteria | 1903 |
| 688 | Ga0501298_017759 | 3300049521 | Bacteria | 1301 |
| 689 | Ga0501047_0077908 | 3300049581 | Bacteria | 3188 |
| 690 | Ga0501074_0043068 | 3300049590 | Bacteria | 3267 |
| 691 | Ga0501201_003743 | 3300049651 | Bacteria | 1401 |
| 692 | Ga0501211_000888 | 3300049658 | Bacteria | 3132 |
| 693 | Ga0501222_004907 | 3300049662 | Bacteria | 1816 |
| 694 | Ga0501222_013028 | 3300049662 | Bacteria | 1095 |
| 695 | Ga0501235_021459 | 3300049669 | Bacteria | 1436 |
| 696 | Ga0501235_089692 | 3300049669 | Bacteria | 741 |
| 697 | Ga0501249_029641 | 3300049679 | Bacteria | 1217 |
| 698 | Ga0501225_0019671 | 3300049705 | Bacteria | 1868 |
| 699 | Ga0501229_004772 | 3300049706 | Bacteria | 1650 |
| 700 | Ga0501080_0018366 | 3300049742 | Bacteria | 6473 |
| 701 | Ga0501083_0037769 | 3300049744 | Bacteria | 3287 |
| 702 | nmdc:mga0k408_10040_c1 | 3300050493 | Bacteria | 5113 |
| 703 | nmdc:mga0k408_125019_c1 | 3300050493 | Bacteria | 1525 |
| 704 | nmdc:mga0k408_134465_c1 | 3300050493 | Bacteria | 1469 |
| 705 | nmdc:mga0k408_211940_c1 | 3300050493 | Bacteria | 1157 |
| 706 | nmdc:mga0k408_35348_c1 | 3300050493 | Bacteria | 2866 |
| 707 | nmdc:mga07m45_1126_c1 | 3300050496 | Bacteria | 11984 |
| 708 | nmdc:mga07m45_1728_c1 | 3300050496 | Bacteria | 10066 |
| 709 | nmdc:mga07m45_29149_c1 | 3300050496 | Bacteria | 3050 |
| 710 | nmdc:mga07m45_49721_c1 | 3300050496 | Bacteria | 2361 |
| 711 | nmdc:mga07m45_8512_c1 | 3300050496 | Bacteria | 5278 |
| 712 | nmdc:mga06r32_180618_c1 | 3300050510 | Bacteria | 2096 |
| 713 | nmdc:mga06r32_21694_c1 | 3300050510 | Bacteria | 5931 |
| 714 | nmdc:mga08y16_79385_c1 | 3300050511 | Bacteria | 3420 |
| 715 | Ga0500578_0059104 | 3300053086 | Bacteria | 2450 |
| 716 | Ga0500644_0002846 | 3300053088 | Bacteria | 4299 |
| 717 | Ga0500644_0009670 | 3300053088 | Bacteria | 2587 |
| 718 | Ga0500651_0078727 | 3300053093 | Bacteria | 2044 |
| 719 | Ga0500562_004854 | 3300053108 | Bacteria | 3386 |
| 720 | Ga0500594_0002404 | 3300053118 | Bacteria | 4076 |
| 721 | Ga0500618_000088 | 3300053125 | Bacteria | 74892 |
| 722 | Ga0500658_0009111 | 3300053134 | Bacteria | 3664 |
| 723 | Ga0500559_0000116 | 3300053136 | Bacteria | 63080 |
| 724 | Ga0500586_002812 | 3300053145 | Bacteria | 4004 |
| 725 | Ga0500622_0007450 | 3300053156 | Bacteria | 6216 |
| 726 | Ga0500636_0138371 | 3300053177 | Bacteria | 1350 |
| 727 | Ga0500645_002844 | 3300053730 | Bacteria | 7448 |
| 728 | Ga0587084_018055 | 3300059477 | Bacteria | 1025 |
| 729 | Ga0587066_019879 | 3300059490 | Bacteria | 1097 |
| 730 | Ga0587066_020499 | 3300059490 | Bacteria | 1087 |
| 731 | Ga0587070_002891 | 3300059491 | Bacteria | 2004 |
| 732 | Ga0587070_012877 | 3300059491 | Bacteria | 1280 |
| 733 | Ga0587073_0061179 | 3300059492 | Bacteria | 883 |
| 734 | Ga0587077_004383 | 3300059493 | Bacteria | 1851 |
| 735 | Ga0587082_023797 | 3300059504 | Bacteria | 1018 |
| 736 | Ga0587083_0039397 | 3300059505 | Bacteria | 982 |
| 737 | Ga0587085_039329 | 3300059506 | Bacteria | 817 |
| 738 | Ga0587086_003813 | 3300059507 | Bacteria | 1541 |
| 739 | Ga0587088_033941 | 3300059508 | Bacteria | 928 |
| 740 | Ga0587089_015701 | 3300059509 | Bacteria | 1002 |
| 741 | Ga0587090_007350 | 3300059510 | Bacteria | 1444 |
| 742 | Ga0587090_010781 | 3300059510 | Bacteria | 1273 |
| 743 | Ga0587091_005471 | 3300059511 | Bacteria | 1732 |
| 744 | Ga0587092_003332 | 3300059512 | Bacteria | 1817 |
| 745 | Ga0587092_003665 | 3300059512 | Bacteria | 1768 |
| 746 | Ga0587106_017599 | 3300059605 | Bacteria | 1024 |
| 747 | Ga0587109_042119 | 3300059624 | Bacteria | 909 |
| 748 | Ga0587062_000926 | 3300059639 | Bacteria | 2310 |
| 749 | Ga0587068_003167 | 3300059641 | Bacteria | 2074 |
| 750 | Ga0587072_007303 | 3300059643 | Bacteria | 1714 |
| 751 | Ga0587072_028833 | 3300059643 | Bacteria | 1026 |
| 752 | Ga0587075_022753 | 3300059644 | Bacteria | 944 |
| 753 | Ga0587076_005159 | 3300059645 | Bacteria | 1676 |
| 754 | Ga0587078_015160 | 3300059646 | Bacteria | 927 |
| 755 | Ga0587078_019490 | 3300059646 | Bacteria | 847 |
| 756 | Ga0587079_034545 | 3300059647 | Bacteria | 990 |
| 757 | Ga0587108_010658 | 3300059653 | Bacteria | 774 |
| 758 | Ga0587124_007228 | 3300059660 | Bacteria | 931 |
| 759 | Ga0587071_046836 | 3300060344 | Bacteria | 883 |
| 760 | Ga0587111_0003486 | 3300060346 | Bacteria | 2241 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300020077 | Ga0206351_10127825 | Ga0206351_101278251 | 209 |
| 2 | 3300020080 | Ga0206350_11556907 | Ga0206350_115569071 | 209 |
| 3 | iso_pu_bacteria | 2510065045 | 2510248451 | 214 |
| 4 | iso_pu_bacteria | 2512047030 | 2512349548 | 214 |
| 5 | iso_pu_bacteria | 2515154122 | 2515684261 | 214 |
| 6 | iso_pu_bacteria | 2643221544 | 2643746368 | 214 |
| 7 | iso_pu_bacteria | 2643221585 | 2643933154 | 214 |
| 8 | iso_pu_bacteria | 2643221592 | 2643969464 | 214 |
| 9 | iso_pu_bacteria | 2643221625 | 2644143764 | 214 |
| 10 | iso_pu_bacteria | 2643221639 | 2644217299 | 214 |
| 11 | iso_pu_bacteria | 2643221644 | 2644245722 | 214 |
| 12 | iso_pu_bacteria | 2643221648 | 2644276530 | 214 |
| 13 | iso_pu_bacteria | 2643221656 | 2644314403 | 214 |
| 14 | iso_pu_bacteria | 2718217991 | 2719643122 | 214 |
| 15 | iso_pu_bacteria | 2842733646 | 2842733873 | 214 |
| 16 | iso_pu_bacteria | 2857564685 | 2857569722 | 214 |
| 17 | iso_pu_bacteria | 2885192300 | 2885193399 | 214 |
| 18 | iso_pu_bacteria | 2885270888 | 2885273507 | 214 |
| 19 | iso_pu_bacteria | 2886848708 | 2886854090 | 214 |
| 20 | iso_pu_bacteria | 2902682994 | 2902687509 | 214 |
| 21 | 3300005327 | Ga0070658_10072234 | Ga0070658_100722343 | 216 |
| 22 | 3300005339 | Ga0070660_100018170 | Ga0070660_1000181702 | 216 |
| 23 | 3300005366 | Ga0070659_100053173 | Ga0070659_1000531732 | 216 |
| 24 | 3300005548 | Ga0070665_100059416 | Ga0070665_1000594162 | 216 |
| 25 | 3300005563 | Ga0068855_100590336 | Ga0068855_1005903362 | 216 |
| 26 | 3300006846 | Ga0075430_100085982 | Ga0075430_1000859823 | 216 |
| 27 | 3300013105 | Ga0157369_10477878 | Ga0157369_104778782 | 216 |
| 28 | 3300013296 | Ga0157374_10021548 | Ga0157374_100215482 | 216 |
| 29 | 3300025909 | Ga0207705_10037405 | Ga0207705_100374052 | 216 |
| 30 | 3300025919 | Ga0207657_10003079 | Ga0207657_100030798 | 216 |
| 31 | 3300025932 | Ga0207690_10061464 | Ga0207690_100614642 | 216 |
| 32 | 3300037312 | Ga0395899_0172226 | Ga0395899_0172226_387_1046 | 216 |
| 33 | 3300037471 | Ga0395905_0127109 | Ga0395905_0127109_1335_1994 | 216 |
| 34 | 3300038443 | Ga0395901_0115759 | Ga0395901_0115759_1702_2361 | 216 |
| 35 | 3300041459 | Ga0451800_1277621 | Ga0451800_1277621_204_884 | 216 |
| 36 | 3300050510 | nmdc:mga06r32_180618_c1 | nmdc:mga06r32_180618_c1_1156_1809 | 216 |
| 37 | 3300005295 | Ga0065707_10003061 | Ga0065707_100030618 | 217 |
| 38 | 3300005327 | Ga0070658_10670810 | Ga0070658_106708101 | 217 |
| 39 | 3300005334 | Ga0068869_100048099 | Ga0068869_1000480992 | 217 |
| 40 | 3300005334 | Ga0068869_100175546 | Ga0068869_1001755462 | 217 |
| 41 | 3300005336 | Ga0070680_100056543 | Ga0070680_1000565435 | 217 |
| 42 | 3300005338 | Ga0068868_100143840 | Ga0068868_1001438402 | 217 |
| 43 | 3300005355 | Ga0070671_100039005 | Ga0070671_1000390053 | 217 |
| 44 | 3300005364 | Ga0070673_100629416 | Ga0070673_1006294161 | 217 |
| 45 | 3300005366 | Ga0070659_100018413 | Ga0070659_1000184132 | 217 |
| 46 | 3300005366 | Ga0070659_100080967 | Ga0070659_1000809672 | 217 |
| 47 | 3300005457 | Ga0070662_100019823 | Ga0070662_1000198232 | 217 |
| 48 | 3300005458 | Ga0070681_10198329 | Ga0070681_101983292 | 217 |
| 49 | 3300005577 | Ga0068857_100075039 | Ga0068857_1000750393 | 217 |
| 50 | 3300005618 | Ga0068864_100001546 | Ga0068864_1000015466 | 217 |
| 51 | 3300005841 | Ga0068863_100158772 | Ga0068863_1001587723 | 217 |
| 52 | 3300006051 | Ga0075364_10137789 | Ga0075364_101377892 | 217 |
| 53 | 3300006178 | Ga0075367_10010462 | Ga0075367_100104625 | 217 |
| 54 | 3300006195 | Ga0075366_10030492 | Ga0075366_100304922 | 217 |
| 55 | 3300006353 | Ga0075370_10026890 | Ga0075370_100268902 | 217 |
| 56 | 3300006353 | Ga0075370_10027005 | Ga0075370_100270052 | 217 |
| 57 | 3300006847 | Ga0075431_100002911 | Ga0075431_1000029116 | 217 |
| 58 | 3300007788 | Ga0099795_10159958 | Ga0099795_101599581 | 217 |
| 59 | 3300009545 | Ga0105237_10031465 | Ga0105237_100314655 | 217 |
| 60 | 3300010375 | Ga0105239_10021943 | Ga0105239_100219434 | 217 |
| 61 | 3300010375 | Ga0105239_10025127 | Ga0105239_100251273 | 217 |
| 62 | 3300010375 | Ga0105239_11135333 | Ga0105239_111353331 | 217 |
| 63 | 3300013100 | Ga0157373_10030622 | Ga0157373_100306223 | 217 |
| 64 | 3300013100 | Ga0157373_10170000 | Ga0157373_101700002 | 217 |
| 65 | 3300013297 | Ga0157378_10568832 | Ga0157378_105688321 | 217 |
| 66 | 3300013308 | Ga0157375_10192986 | Ga0157375_101929863 | 217 |
| 67 | 3300025909 | Ga0207705_10356187 | Ga0207705_103561872 | 217 |
| 68 | 3300025909 | Ga0207705_10363767 | Ga0207705_103637671 | 217 |
| 69 | 3300025909 | Ga0207705_10398202 | Ga0207705_103982022 | 217 |
| 70 | 3300025910 | Ga0207684_10065282 | Ga0207684_100652823 | 217 |
| 71 | 3300025914 | Ga0207671_10012547 | Ga0207671_100125475 | 217 |
| 72 | 3300025917 | Ga0207660_10303898 | Ga0207660_103038982 | 217 |
| 73 | 3300025919 | Ga0207657_10168314 | Ga0207657_101683142 | 217 |
| 74 | 3300025931 | Ga0207644_10110673 | Ga0207644_101106732 | 217 |
| 75 | 3300025932 | Ga0207690_10064048 | Ga0207690_100640482 | 217 |
| 76 | 3300025932 | Ga0207690_10089746 | Ga0207690_100897462 | 217 |
| 77 | 3300025933 | Ga0207706_10001143 | Ga0207706_1000114317 | 217 |
| 78 | 3300025942 | Ga0207689_10029679 | Ga0207689_100296792 | 217 |
| 79 | 3300025942 | Ga0207689_10687375 | Ga0207689_106873751 | 217 |
| 80 | 3300025960 | Ga0207651_10785426 | Ga0207651_107854261 | 217 |
| 81 | 3300025961 | Ga0207712_10628789 | Ga0207712_106287892 | 217 |
| 82 | 3300026078 | Ga0207702_10764720 | Ga0207702_107647201 | 217 |
| 83 | 3300026089 | Ga0207648_10069520 | Ga0207648_100695201 | 217 |
| 84 | 3300026095 | Ga0207676_10019848 | Ga0207676_100198483 | 217 |
| 85 | 3300027876 | Ga0209974_10031442 | Ga0209974_100314422 | 217 |
| 86 | 3300028381 | Ga0268264_10155190 | Ga0268264_101551903 | 217 |
| 87 | 3300028786 | Ga0307517_10385540 | Ga0307517_103855401 | 217 |
| 88 | 3300031456 | Ga0307513_10271380 | Ga0307513_102713802 | 217 |
| 89 | 3300031548 | Ga0307408_100558421 | Ga0307408_1005584212 | 217 |
| 90 | 3300031901 | Ga0307406_10016612 | Ga0307406_100166122 | 217 |
| 91 | 3300033180 | Ga0307510_10027809 | Ga0307510_100278092 | 217 |
| 92 | 3300033180 | Ga0307510_10171624 | Ga0307510_101716242 | 217 |
| 93 | 3300035089 | Ga0373944_0162151 | Ga0373944_0162151_62_715 | 217 |
| 94 | 3300035114 | Ga0373939_0076758 | Ga0373939_0076758_278_931 | 217 |
| 95 | 3300035171 | Ga0373946_0183911 | Ga0373946_0183911_173_826 | 217 |
| 96 | 3300035695 | Ga0373927_0021580 | Ga0373927_0021580_1629_2282 | 217 |
| 97 | 3300037068 | Ga0373925_0017082 | Ga0373925_0017082_2819_3472 | 217 |
| 98 | 3300037312 | Ga0395899_0008516 | Ga0395899_0008516_564_1265 | 217 |
| 99 | 3300037418 | Ga0395900_0331778 | Ga0395900_0331778_609_1310 | 217 |
| 100 | 3300037466 | Ga0395898_0220647 | Ga0395898_0220647_908_1609 | 217 |
| 101 | 3300037466 | Ga0395898_0254895 | Ga0395898_0254895_334_996 | 217 |
| 102 | 3300037471 | Ga0395905_0023105 | Ga0395905_0023105_2422_3108 | 217 |
| 103 | 3300037471 | Ga0395905_0146033 | Ga0395905_0146033_1263_1925 | 217 |
| 104 | 3300042012 | Ga0439455_0068922 | Ga0439455_0068922_28_681 | 217 |
| 105 | 3300044706 | Ga0466964_0036245 | Ga0466964_0036245_1050_1754 | 217 |
| 106 | 3300045976 | Ga0466967_0342898 | Ga0466967_0342898_380_1084 | 217 |
| 107 | 3300046512 | Ga0495610_0025351 | Ga0495610_0025351_1022_1678 | 217 |
| 108 | 3300046512 | Ga0495610_0146791 | Ga0495610_0146791_168_821 | 217 |
| 109 | 3300046519 | Ga0495632_0012258 | Ga0495632_0012258_2528_3196 | 217 |
| 110 | 3300046524 | Ga0495648_0047169 | Ga0495648_0047169_346_999 | 217 |
| 111 | 3300046530 | Ga0495654_0194394 | Ga0495654_0194394_144_797 | 217 |
| 112 | 3300046542 | Ga0495597_0011037 | Ga0495597_0011037_2789_3445 | 217 |
| 113 | 3300046542 | Ga0495597_0053754 | Ga0495597_0053754_435_1088 | 217 |
| 114 | 3300046648 | Ga0495611_0340235 | Ga0495611_0340235_21_677 | 217 |
| 115 | 3300046660 | Ga0495625_0015168 | Ga0495625_0015168_4406_5059 | 217 |
| 116 | 3300046694 | Ga0495649_0001048 | Ga0495649_0001048_4909_5565 | 217 |
| 117 | 3300046694 | Ga0495649_0006112 | Ga0495649_0006112_3116_3769 | 217 |
| 118 | 3300046794 | Ga0495589_0107721 | Ga0495589_0107721_632_1300 | 217 |
| 119 | 3300046810 | Ga0495660_0117143 | Ga0495660_0117143_337_990 | 217 |
| 120 | 3300047443 | Ga0495687_000128 | Ga0495687_000128_18264_18920 | 217 |
| 121 | 3300047443 | Ga0495687_001059 | Ga0495687_001059_3662_4315 | 217 |
| 122 | 3300047443 | Ga0495687_003727 | Ga0495687_003727_1257_1910 | 217 |
| 123 | 3300047472 | Ga0495686_0001150 | Ga0495686_0001150_3363_4016 | 217 |
| 124 | 3300048091 | Ga0495626_0094944 | Ga0495626_0094944_174_827 | 217 |
| 125 | 3300049581 | Ga0501047_0077908 | Ga0501047_0077908_2296_2955 | 217 |
| 126 | 3300049669 | Ga0501235_089692 | Ga0501235_089692_43_726 | 217 |
| 127 | 3300049679 | Ga0501249_029641 | Ga0501249_029641_125_808 | 217 |
| 128 | 3300049705 | Ga0501225_0019671 | Ga0501225_0019671_79_762 | 217 |
| 129 | 3300049744 | Ga0501083_0037769 | Ga0501083_0037769_1700_2353 | 217 |
| 130 | 3300050493 | nmdc:mga0k408_125019_c1 | nmdc:mga0k408_125019_c1_444_1097 | 217 |
| 131 | 3300050496 | nmdc:mga07m45_1728_c1 | nmdc:mga07m45_1728_c1_651_1304 | 217 |
| 132 | 3300050496 | nmdc:mga07m45_29149_c1 | nmdc:mga07m45_29149_c1_1229_1882 | 217 |
| 133 | 3300050496 | nmdc:mga07m45_49721_c1 | nmdc:mga07m45_49721_c1_1405_2058 | 217 |
| 134 | 3300050510 | nmdc:mga06r32_21694_c1 | nmdc:mga06r32_21694_c1_2011_2667 | 217 |
| 135 | 3300053086 | Ga0500578_0059104 | Ga0500578_0059104_1370_2026 | 217 |
| 136 | 3300053093 | Ga0500651_0078727 | Ga0500651_0078727_743_1399 | 217 |
| 137 | 3300053118 | Ga0500594_0002404 | Ga0500594_0002404_922_1575 | 217 |
| 138 | 3300053134 | Ga0500658_0009111 | Ga0500658_0009111_2436_3089 | 217 |
| 139 | 3300053136 | Ga0500559_0000116 | Ga0500559_0000116_29568_30221 | 217 |
| 140 | 3300053156 | Ga0500622_0007450 | Ga0500622_0007450_2655_3308 | 217 |
| 141 | 3300053177 | Ga0500636_0138371 | Ga0500636_0138371_667_1320 | 217 |
| 142 | 3300053730 | Ga0500645_002844 | Ga0500645_002844_838_1494 | 217 |
| 143 | 3300059490 | Ga0587066_019879 | Ga0587066_019879_157_858 | 217 |
| 144 | 3300059490 | Ga0587066_020499 | Ga0587066_020499_269_973 | 217 |
| 145 | 3300059491 | Ga0587070_012877 | Ga0587070_012877_308_1012 | 217 |
| 146 | 3300059510 | Ga0587090_007350 | Ga0587090_007350_394_1095 | 217 |
| 147 | 3300059605 | Ga0587106_017599 | Ga0587106_017599_146_850 | 217 |
| 148 | 3300059644 | Ga0587075_022753 | Ga0587075_022753_167_868 | 217 |
| 149 | 3300059646 | Ga0587078_015160 | Ga0587078_015160_103_804 | 217 |
| 150 | 3300002705 | JGI25156J39149_1000411 | JGI25156J39149_100041117 | 218 |
| 151 | 3300002705 | JGI25156J39149_1014030 | JGI25156J39149_10140302 | 218 |
| 152 | 3300002738 | JGI25154J39366_1003427 | JGI25154J39366_10034272 | 218 |
| 153 | 3300002741 | JGI25157J39369_1000052 | JGI25157J39369_100005281 | 218 |
| 154 | 3300002772 | JGI25164J39214_1005845 | JGI25164J39214_10058452 | 218 |
| 155 | 3300002773 | JGI25152J39213_1000446 | JGI25152J39213_100044611 | 218 |
| 156 | 3300002773 | JGI25152J39213_1001630 | JGI25152J39213_10016308 | 218 |
| 157 | 3300002774 | JGI25150J39212_1002460 | JGI25150J39212_10024602 | 218 |
| 158 | 3300002774 | JGI25150J39212_1006219 | JGI25150J39212_10062193 | 218 |
| 159 | 3300002774 | JGI25150J39212_1007122 | JGI25150J39212_10071221 | 218 |
| 160 | 3300002774 | JGI25150J39212_1025271 | JGI25150J39212_10252711 | 218 |
| 161 | 3300002987 | JGI25159J45721_1002937 | JGI25159J45721_10029378 | 218 |
| 162 | 3300003215 | JGI25153J46596_10000279 | JGI25153J46596_1000027919 | 218 |
| 163 | 3300003752 | Ga0055539_1000234 | Ga0055539_100023429 | 218 |
| 164 | 3300003752 | Ga0055539_1001493 | Ga0055539_10014934 | 218 |
| 165 | 3300003756 | Ga0055533_1000053 | Ga0055533_1000053109 | 218 |
| 166 | 3300003759 | Ga0055525_1000013 | Ga0055525_1000013386 | 218 |
| 167 | 3300003759 | Ga0055525_1001043 | Ga0055525_10010433 | 218 |
| 168 | 3300003761 | Ga0055535_1000727 | Ga0055535_100072715 | 218 |
| 169 | 3300003763 | Ga0055529_1000015 | Ga0055529_1000015166 | 218 |
| 170 | 3300003763 | Ga0055529_1000653 | Ga0055529_100065310 | 218 |
| 171 | 3300003771 | Ga0055526_1000280 | Ga0055526_100028038 | 218 |
| 172 | 3300003771 | Ga0055526_1002177 | Ga0055526_100217713 | 218 |
| 173 | 3300003771 | Ga0055526_1005508 | Ga0055526_10055083 | 218 |
| 174 | 3300003773 | Ga0055537_1000143 | Ga0055537_10001435 | 218 |
| 175 | 3300003773 | Ga0055537_1001454 | Ga0055537_10014542 | 218 |
| 176 | 3300003775 | Ga0055524_1000061 | Ga0055524_100006139 | 218 |
| 177 | 3300003775 | Ga0055524_1000157 | Ga0055524_100015734 | 218 |
| 178 | 3300003775 | Ga0055524_1003621 | Ga0055524_10036217 | 218 |
| 179 | 3300003775 | Ga0055524_1005836 | Ga0055524_10058362 | 218 |
| 180 | 3300003775 | Ga0055524_1006771 | Ga0055524_10067715 | 218 |
| 181 | 3300003775 | Ga0055524_1011138 | Ga0055524_10111384 | 218 |
| 182 | 3300003784 | Ga0055534_1000308 | Ga0055534_100030828 | 218 |
| 183 | 3300003784 | Ga0055534_1000712 | Ga0055534_100071212 | 218 |
| 184 | 3300003790 | Ga0055528_1000430 | Ga0055528_100043010 | 218 |
| 185 | 3300003791 | Ga0055530_10000524 | Ga0055530_1000052418 | 218 |
| 186 | 3300003791 | Ga0055530_10000645 | Ga0055530_1000064526 | 218 |
| 187 | 3300003792 | Ga0055540_1000026 | Ga0055540_10000263 | 218 |
| 188 | 3300003794 | Ga0055531_10001224 | Ga0055531_100012243 | 218 |
| 189 | 3300003794 | Ga0055531_10003738 | Ga0055531_100037384 | 218 |
| 190 | 3300003794 | Ga0055531_10009114 | Ga0055531_100091143 | 218 |
| 191 | 3300004625 | Ga0055543_1001250 | Ga0055543_10012508 | 218 |
| 192 | 3300004625 | Ga0055543_1010209 | Ga0055543_10102092 | 218 |
| 193 | 3300005262 | Ga0065165_1000241 | Ga0065165_100024184 | 218 |
| 194 | 3300005262 | Ga0065165_1000268 | Ga0065165_100026849 | 218 |
| 195 | 3300005262 | Ga0065165_1000498 | Ga0065165_100049848 | 218 |
| 196 | 3300005290 | Ga0065712_10350414 | Ga0065712_103504141 | 218 |
| 197 | 3300005295 | Ga0065707_10032055 | Ga0065707_100320551 | 218 |
| 198 | 3300005327 | Ga0070658_10256953 | Ga0070658_102569532 | 218 |
| 199 | 3300005327 | Ga0070658_10299480 | Ga0070658_102994802 | 218 |
| 200 | 3300005327 | Ga0070658_10673660 | Ga0070658_106736602 | 218 |
| 201 | 3300005328 | Ga0070676_10039630 | Ga0070676_100396302 | 218 |
| 202 | 3300005328 | Ga0070676_10061249 | Ga0070676_100612492 | 218 |
| 203 | 3300005330 | Ga0070690_100023202 | Ga0070690_1000232023 | 218 |
| 204 | 3300005330 | Ga0070690_100265886 | Ga0070690_1002658862 | 218 |
| 205 | 3300005331 | Ga0070670_100003146 | Ga0070670_10000314611 | 218 |
| 206 | 3300005331 | Ga0070670_100603262 | Ga0070670_1006032622 | 218 |
| 207 | 3300005334 | Ga0068869_100002141 | Ga0068869_1000021418 | 218 |
| 208 | 3300005336 | Ga0070680_100173735 | Ga0070680_1001737352 | 218 |
| 209 | 3300005337 | Ga0070682_100034077 | Ga0070682_1000340772 | 218 |
| 210 | 3300005339 | Ga0070660_100187089 | Ga0070660_1001870892 | 218 |
| 211 | 3300005341 | Ga0070691_10155511 | Ga0070691_101555111 | 218 |
| 212 | 3300005343 | Ga0070687_100392502 | Ga0070687_1003925022 | 218 |
| 213 | 3300005347 | Ga0070668_100048017 | Ga0070668_1000480173 | 218 |
| 214 | 3300005353 | Ga0070669_100005491 | Ga0070669_1000054913 | 218 |
| 215 | 3300005353 | Ga0070669_100087500 | Ga0070669_1000875002 | 218 |
| 216 | 3300005353 | Ga0070669_100165396 | Ga0070669_1001653962 | 218 |
| 217 | 3300005353 | Ga0070669_100219175 | Ga0070669_1002191752 | 218 |
| 218 | 3300005354 | Ga0070675_100000072 | Ga0070675_10000007233 | 218 |
| 219 | 3300005354 | Ga0070675_100061753 | Ga0070675_1000617531 | 218 |
| 220 | 3300005355 | Ga0070671_100055959 | Ga0070671_1000559594 | 218 |
| 221 | 3300005355 | Ga0070671_100245284 | Ga0070671_1002452842 | 218 |
| 222 | 3300005356 | Ga0070674_100010657 | Ga0070674_1000106572 | 218 |
| 223 | 3300005356 | Ga0070674_100054836 | Ga0070674_1000548362 | 218 |
| 224 | 3300005356 | Ga0070674_100135474 | Ga0070674_1001354742 | 218 |
| 225 | 3300005364 | Ga0070673_100000785 | Ga0070673_1000007853 | 218 |
| 226 | 3300005364 | Ga0070673_100213740 | Ga0070673_1002137402 | 218 |
| 227 | 3300005365 | Ga0070688_100259659 | Ga0070688_1002596592 | 218 |
| 228 | 3300005367 | Ga0070667_100108890 | Ga0070667_1001088902 | 218 |
| 229 | 3300005435 | Ga0070714_100065790 | Ga0070714_1000657901 | 218 |
| 230 | 3300005438 | Ga0070701_10040182 | Ga0070701_100401823 | 218 |
| 231 | 3300005438 | Ga0070701_10300472 | Ga0070701_103004721 | 218 |
| 232 | 3300005456 | Ga0070678_100018675 | Ga0070678_1000186755 | 218 |
| 233 | 3300005456 | Ga0070678_100066923 | Ga0070678_1000669233 | 218 |
| 234 | 3300005456 | Ga0070678_100130258 | Ga0070678_1001302581 | 218 |
| 235 | 3300005456 | Ga0070678_100309326 | Ga0070678_1003093261 | 218 |
| 236 | 3300005457 | Ga0070662_100081326 | Ga0070662_1000813262 | 218 |
| 237 | 3300005458 | Ga0070681_10766076 | Ga0070681_107660761 | 218 |
| 238 | 3300005459 | Ga0068867_100003414 | Ga0068867_1000034148 | 218 |
| 239 | 3300005459 | Ga0068867_100004430 | Ga0068867_1000044303 | 218 |
| 240 | 3300005459 | Ga0068867_100006335 | Ga0068867_1000063355 | 218 |
| 241 | 3300005459 | Ga0068867_100088266 | Ga0068867_1000882662 | 218 |
| 242 | 3300005459 | Ga0068867_100172756 | Ga0068867_1001727562 | 218 |
| 243 | 3300005518 | Ga0070699_100022397 | Ga0070699_1000223972 | 218 |
| 244 | 3300005530 | Ga0070679_100035375 | Ga0070679_1000353754 | 218 |
| 245 | 3300005535 | Ga0070684_100158031 | Ga0070684_1001580312 | 218 |
| 246 | 3300005536 | Ga0070697_100687163 | Ga0070697_1006871631 | 218 |
| 247 | 3300005539 | Ga0068853_100090736 | Ga0068853_1000907363 | 218 |
| 248 | 3300005539 | Ga0068853_100562867 | Ga0068853_1005628671 | 218 |
| 249 | 3300005543 | Ga0070672_100000977 | Ga0070672_1000009778 | 218 |
| 250 | 3300005543 | Ga0070672_100221642 | Ga0070672_1002216423 | 218 |
| 251 | 3300005543 | Ga0070672_100237621 | Ga0070672_1002376212 | 218 |
| 252 | 3300005543 | Ga0070672_100764405 | Ga0070672_1007644051 | 218 |
| 253 | 3300005544 | Ga0070686_100033563 | Ga0070686_1000335631 | 218 |
| 254 | 3300005545 | Ga0070695_100187004 | Ga0070695_1001870042 | 218 |
| 255 | 3300005547 | Ga0070693_100047005 | Ga0070693_1000470053 | 218 |
| 256 | 3300005548 | Ga0070665_100292191 | Ga0070665_1002921912 | 218 |
| 257 | 3300005563 | Ga0068855_100007935 | Ga0068855_1000079358 | 218 |
| 258 | 3300005563 | Ga0068855_100029432 | Ga0068855_1000294321 | 218 |
| 259 | 3300005564 | Ga0070664_100205710 | Ga0070664_1002057101 | 218 |
| 260 | 3300005577 | Ga0068857_100001467 | Ga0068857_10000146714 | 218 |
| 261 | 3300005578 | Ga0068854_100021390 | Ga0068854_1000213902 | 218 |
| 262 | 3300005578 | Ga0068854_100163393 | Ga0068854_1001633932 | 218 |
| 263 | 3300005614 | Ga0068856_100007649 | Ga0068856_1000076496 | 218 |
| 264 | 3300005615 | Ga0070702_100307034 | Ga0070702_1003070341 | 218 |
| 265 | 3300005616 | Ga0068852_100362082 | Ga0068852_1003620821 | 218 |
| 266 | 3300005616 | Ga0068852_100790507 | Ga0068852_1007905072 | 218 |
| 267 | 3300005617 | Ga0068859_100091484 | Ga0068859_1000914843 | 218 |
| 268 | 3300005718 | Ga0068866_10000430 | Ga0068866_100004303 | 218 |
| 269 | 3300005718 | Ga0068866_10021411 | Ga0068866_100214112 | 218 |
| 270 | 3300005719 | Ga0068861_100003155 | Ga0068861_10000315512 | 218 |
| 271 | 3300005719 | Ga0068861_100523520 | Ga0068861_1005235201 | 218 |
| 272 | 3300005842 | Ga0068858_100086090 | Ga0068858_1000860903 | 218 |
| 273 | 3300005843 | Ga0068860_100002904 | Ga0068860_1000029044 | 218 |
| 274 | 3300005843 | Ga0068860_100102547 | Ga0068860_1001025472 | 218 |
| 275 | 3300005843 | Ga0068860_100204943 | Ga0068860_1002049431 | 218 |
| 276 | 3300005844 | Ga0068862_100018548 | Ga0068862_1000185481 | 218 |
| 277 | 3300005844 | Ga0068862_100344778 | Ga0068862_1003447782 | 218 |
| 278 | 3300006177 | Ga0075362_10002903 | Ga0075362_100029034 | 218 |
| 279 | 3300006195 | Ga0075366_10001896 | Ga0075366_100018966 | 218 |
| 280 | 3300006195 | Ga0075366_10004969 | Ga0075366_100049692 | 218 |
| 281 | 3300006195 | Ga0075366_10005657 | Ga0075366_100056572 | 218 |
| 282 | 3300006195 | Ga0075366_10011710 | Ga0075366_100117106 | 218 |
| 283 | 3300006195 | Ga0075366_10034154 | Ga0075366_100341543 | 218 |
| 284 | 3300006195 | Ga0075366_10034881 | Ga0075366_100348813 | 218 |
| 285 | 3300006237 | Ga0097621_100302867 | Ga0097621_1003028671 | 218 |
| 286 | 3300006237 | Ga0097621_100343135 | Ga0097621_1003431352 | 218 |
| 287 | 3300006353 | Ga0075370_10000577 | Ga0075370_1000057713 | 218 |
| 288 | 3300006353 | Ga0075370_10002114 | Ga0075370_100021147 | 218 |
| 289 | 3300006358 | Ga0068871_100175685 | Ga0068871_1001756852 | 218 |
| 290 | 3300006358 | Ga0068871_100665355 | Ga0068871_1006653552 | 218 |
| 291 | 3300006881 | Ga0068865_100390618 | Ga0068865_1003906182 | 218 |
| 292 | 3300006931 | Ga0097620_100091482 | Ga0097620_1000914822 | 218 |
| 293 | 3300006942 | Ga0099824_1035904 | Ga0099824_10359042 | 218 |
| 294 | 3300006944 | Ga0099823_1000009 | Ga0099823_100000918 | 218 |
| 295 | 3300006946 | Ga0079104_1000093 | Ga0079104_100009397 | 218 |
| 296 | 3300006946 | Ga0079104_1043049 | Ga0079104_10430492 | 218 |
| 297 | 3300009093 | Ga0105240_10003357 | Ga0105240_100033571 | 218 |
| 298 | 3300009093 | Ga0105240_10011396 | Ga0105240_100113965 | 218 |
| 299 | 3300009093 | Ga0105240_10020177 | Ga0105240_100201778 | 218 |
| 300 | 3300009093 | Ga0105240_10050940 | Ga0105240_100509404 | 218 |
| 301 | 3300009093 | Ga0105240_10059526 | Ga0105240_100595262 | 218 |
| 302 | 3300009094 | Ga0111539_10091684 | Ga0111539_100916842 | 218 |
| 303 | 3300009098 | Ga0105245_10029752 | Ga0105245_100297524 | 218 |
| 304 | 3300009148 | Ga0105243_10001906 | Ga0105243_100019062 | 218 |
| 305 | 3300009148 | Ga0105243_10057702 | Ga0105243_100577022 | 218 |
| 306 | 3300009148 | Ga0105243_10102221 | Ga0105243_101022211 | 218 |
| 307 | 3300009148 | Ga0105243_10170483 | Ga0105243_101704832 | 218 |
| 308 | 3300009148 | Ga0105243_10364324 | Ga0105243_103643242 | 218 |
| 309 | 3300009148 | Ga0105243_10781506 | Ga0105243_107815061 | 218 |
| 310 | 3300009176 | Ga0105242_10006750 | Ga0105242_100067502 | 218 |
| 311 | 3300009176 | Ga0105242_10474007 | Ga0105242_104740072 | 218 |
| 312 | 3300009177 | Ga0105248_10015504 | Ga0105248_100155042 | 218 |
| 313 | 3300009177 | Ga0105248_10423968 | Ga0105248_104239681 | 218 |
| 314 | 3300009545 | Ga0105237_10002251 | Ga0105237_1000225113 | 218 |
| 315 | 3300009545 | Ga0105237_10333668 | Ga0105237_103336683 | 218 |
| 316 | 3300009551 | Ga0105238_10083823 | Ga0105238_100838233 | 218 |
| 317 | 3300009553 | Ga0105249_10005323 | Ga0105249_1000532310 | 218 |
| 318 | 3300009553 | Ga0105249_10024181 | Ga0105249_100241812 | 218 |
| 319 | 3300009553 | Ga0105249_10029171 | Ga0105249_100291712 | 218 |
| 320 | 3300010375 | Ga0105239_10002342 | Ga0105239_1000234213 | 218 |
| 321 | 3300010375 | Ga0105239_10061489 | Ga0105239_100614892 | 218 |
| 322 | 3300010375 | Ga0105239_10065176 | Ga0105239_100651764 | 218 |
| 323 | 3300010375 | Ga0105239_10089281 | Ga0105239_100892812 | 218 |
| 324 | 3300012497 | Ga0157319_1000005 | Ga0157319_1000005225 | 218 |
| 325 | 3300012512 | Ga0157327_1002797 | Ga0157327_10027971 | 218 |
| 326 | 3300013105 | Ga0157369_10054582 | Ga0157369_100545823 | 218 |
| 327 | 3300013297 | Ga0157378_10001111 | Ga0157378_1000111124 | 218 |
| 328 | 3300013297 | Ga0157378_10029548 | Ga0157378_100295483 | 218 |
| 329 | 3300013306 | Ga0163162_10082200 | Ga0163162_100822002 | 218 |
| 330 | 3300013306 | Ga0163162_10244961 | Ga0163162_102449612 | 218 |
| 331 | 3300013306 | Ga0163162_10958433 | Ga0163162_109584332 | 218 |
| 332 | 3300013307 | Ga0157372_10262240 | Ga0157372_102622404 | 218 |
| 333 | 3300013308 | Ga0157375_10068867 | Ga0157375_100688673 | 218 |
| 334 | 3300013308 | Ga0157375_10108223 | Ga0157375_101082233 | 218 |
| 335 | 3300014326 | Ga0157380_10046225 | Ga0157380_100462253 | 218 |
| 336 | 3300014326 | Ga0157380_10312297 | Ga0157380_103122972 | 218 |
| 337 | 3300014968 | Ga0157379_10008561 | Ga0157379_100085618 | 218 |
| 338 | 3300014968 | Ga0157379_10011067 | Ga0157379_100110675 | 218 |
| 339 | 3300014968 | Ga0157379_10036083 | Ga0157379_100360833 | 218 |
| 340 | 3300014968 | Ga0157379_10239194 | Ga0157379_102391941 | 218 |
| 341 | 3300014969 | Ga0157376_10396404 | Ga0157376_103964041 | 218 |
| 342 | 3300015265 | Ga0182005_1043544 | Ga0182005_10435441 | 218 |
| 343 | 3300017792 | Ga0163161_10075781 | Ga0163161_100757812 | 218 |
| 344 | 3300021361 | Ga0213872_10000026 | Ga0213872_100000266 | 218 |
| 345 | 3300021361 | Ga0213872_10000033 | Ga0213872_10000033126 | 218 |
| 346 | 3300021361 | Ga0213872_10000160 | Ga0213872_100001604 | 218 |
| 347 | 3300021361 | Ga0213872_10021539 | Ga0213872_100215393 | 218 |
| 348 | 3300025226 | Ga0209674_100039 | Ga0209674_10003984 | 218 |
| 349 | 3300025228 | Ga0209672_110257 | Ga0209672_1102572 | 218 |
| 350 | 3300025230 | Ga0209563_100025 | Ga0209563_100025201 | 218 |
| 351 | 3300025230 | Ga0209563_100080 | Ga0209563_10008084 | 218 |
| 352 | 3300025231 | Ga0207427_100466 | Ga0207427_1004667 | 218 |
| 353 | 3300025242 | Ga0209258_100189 | Ga0209258_10018911 | 218 |
| 354 | 3300025242 | Ga0209258_100222 | Ga0209258_10022252 | 218 |
| 355 | 3300025245 | Ga0207425_1000001 | Ga0207425_10000011670 | 218 |
| 356 | 3300025245 | Ga0207425_1000441 | Ga0207425_100044113 | 218 |
| 357 | 3300025245 | Ga0207425_1000795 | Ga0207425_100079511 | 218 |
| 358 | 3300025245 | Ga0207425_1026227 | Ga0207425_10262271 | 218 |
| 359 | 3300025246 | Ga0209646_1000076 | Ga0209646_100007680 | 218 |
| 360 | 3300025246 | Ga0209646_1024723 | Ga0209646_10247232 | 218 |
| 361 | 3300025250 | Ga0209026_1000011 | Ga0209026_1000011264 | 218 |
| 362 | 3300025250 | Ga0209026_1005603 | Ga0209026_10056032 | 218 |
| 363 | 3300025253 | Ga0209677_100086 | Ga0209677_10008684 | 218 |
| 364 | 3300025253 | Ga0209677_100399 | Ga0209677_10039914 | 218 |
| 365 | 3300025256 | Ga0209759_1000034 | Ga0209759_1000034212 | 218 |
| 366 | 3300025256 | Ga0209759_1004758 | Ga0209759_10047582 | 218 |
| 367 | 3300025256 | Ga0209759_1011716 | Ga0209759_10117163 | 218 |
| 368 | 3300025258 | Ga0209129_1000001 | Ga0209129_1000001847 | 218 |
| 369 | 3300025258 | Ga0209129_1000027 | Ga0209129_100002783 | 218 |
| 370 | 3300025263 | Ga0209565_1000009 | Ga0209565_1000009122 | 218 |
| 371 | 3300025263 | Ga0209565_1001648 | Ga0209565_10016481 | 218 |
| 372 | 3300025263 | Ga0209565_1005823 | Ga0209565_10058233 | 218 |
| 373 | 3300025263 | Ga0209565_1017728 | Ga0209565_10177283 | 218 |
| 374 | 3300025272 | Ga0209455_1000031 | Ga0209455_1000031167 | 218 |
| 375 | 3300025272 | Ga0209455_1000092 | Ga0209455_100009211 | 218 |
| 376 | 3300025273 | Ga0209673_1000019 | Ga0209673_1000019260 | 218 |
| 377 | 3300025273 | Ga0209673_1005892 | Ga0209673_10058925 | 218 |
| 378 | 3300025284 | Ga0209130_1000143 | Ga0209130_100014361 | 218 |
| 379 | 3300025291 | Ga0209675_1000028 | Ga0209675_100002896 | 218 |
| 380 | 3300025291 | Ga0209675_1006223 | Ga0209675_10062234 | 218 |
| 381 | 3300025291 | Ga0209675_1018481 | Ga0209675_10184813 | 218 |
| 382 | 3300025294 | Ga0209025_1005287 | Ga0209025_10052876 | 218 |
| 383 | 3300025295 | Ga0209564_1000058 | Ga0209564_1000058198 | 218 |
| 384 | 3300025295 | Ga0209564_1000139 | Ga0209564_100013974 | 218 |
| 385 | 3300025295 | Ga0209564_1000178 | Ga0209564_100017866 | 218 |
| 386 | 3300025297 | Ga0209758_1000052 | Ga0209758_100005237 | 218 |
| 387 | 3300025297 | Ga0209758_1000116 | Ga0209758_1000116108 | 218 |
| 388 | 3300025297 | Ga0209758_1002821 | Ga0209758_100282115 | 218 |
| 389 | 3300025298 | Ga0209050_1000228 | Ga0209050_100022876 | 218 |
| 390 | 3300025298 | Ga0209050_1000271 | Ga0209050_100027119 | 218 |
| 391 | 3300025298 | Ga0209050_1002329 | Ga0209050_100232913 | 218 |
| 392 | 3300025298 | Ga0209050_1003009 | Ga0209050_10030094 | 218 |
| 393 | 3300025298 | Ga0209050_1014479 | Ga0209050_10144792 | 218 |
| 394 | 3300025299 | Ga0209256_1000030 | Ga0209256_100003039 | 218 |
| 395 | 3300025299 | Ga0209256_1000093 | Ga0209256_1000093149 | 218 |
| 396 | 3300025299 | Ga0209256_1000177 | Ga0209256_100017754 | 218 |
| 397 | 3300025299 | Ga0209256_1000297 | Ga0209256_10002977 | 218 |
| 398 | 3300025299 | Ga0209256_1001157 | Ga0209256_100115717 | 218 |
| 399 | 3300025299 | Ga0209256_1002481 | Ga0209256_100248114 | 218 |
| 400 | 3300025299 | Ga0209256_1012712 | Ga0209256_10127122 | 218 |
| 401 | 3300025299 | Ga0209256_1056153 | Ga0209256_10561532 | 218 |
| 402 | 3300025303 | Ga0209051_1000004 | Ga0209051_1000004482 | 218 |
| 403 | 3300025303 | Ga0209051_1000845 | Ga0209051_100084512 | 218 |
| 404 | 3300025303 | Ga0209051_1002272 | Ga0209051_10022724 | 218 |
| 405 | 3300025303 | Ga0209051_1002487 | Ga0209051_10024877 | 218 |
| 406 | 3300025303 | Ga0209051_1064372 | Ga0209051_10643722 | 218 |
| 407 | 3300025304 | Ga0209257_1000021 | Ga0209257_1000021556 | 218 |
| 408 | 3300025304 | Ga0209257_1000347 | Ga0209257_100034740 | 218 |
| 409 | 3300025304 | Ga0209257_1000423 | Ga0209257_100042339 | 218 |
| 410 | 3300025304 | Ga0209257_1003909 | Ga0209257_10039096 | 218 |
| 411 | 3300025315 | Ga0207697_10005999 | Ga0207697_100059993 | 218 |
| 412 | 3300025893 | Ga0207682_10002371 | Ga0207682_100023716 | 218 |
| 413 | 3300025899 | Ga0207642_10000630 | Ga0207642_100006307 | 218 |
| 414 | 3300025899 | Ga0207642_10080456 | Ga0207642_100804561 | 218 |
| 415 | 3300025903 | Ga0207680_10070242 | Ga0207680_100702422 | 218 |
| 416 | 3300025907 | Ga0207645_10001065 | Ga0207645_100010652 | 218 |
| 417 | 3300025909 | Ga0207705_10362684 | Ga0207705_103626842 | 218 |
| 418 | 3300025909 | Ga0207705_10478678 | Ga0207705_104786781 | 218 |
| 419 | 3300025913 | Ga0207695_10010875 | Ga0207695_100108752 | 218 |
| 420 | 3300025913 | Ga0207695_10037384 | Ga0207695_100373845 | 218 |
| 421 | 3300025913 | Ga0207695_10088248 | Ga0207695_100882481 | 218 |
| 422 | 3300025913 | Ga0207695_10095759 | Ga0207695_100957592 | 218 |
| 423 | 3300025913 | Ga0207695_10109182 | Ga0207695_101091822 | 218 |
| 424 | 3300025914 | Ga0207671_10012208 | Ga0207671_100122082 | 218 |
| 425 | 3300025914 | Ga0207671_10061608 | Ga0207671_100616082 | 218 |
| 426 | 3300025918 | Ga0207662_10413945 | Ga0207662_104139451 | 218 |
| 427 | 3300025919 | Ga0207657_10024490 | Ga0207657_100244903 | 218 |
| 428 | 3300025919 | Ga0207657_10181957 | Ga0207657_101819572 | 218 |
| 429 | 3300025921 | Ga0207652_10282471 | Ga0207652_102824711 | 218 |
| 430 | 3300025923 | Ga0207681_10034332 | Ga0207681_100343323 | 218 |
| 431 | 3300025923 | Ga0207681_10035725 | Ga0207681_100357254 | 218 |
| 432 | 3300025923 | Ga0207681_10040907 | Ga0207681_100409074 | 218 |
| 433 | 3300025924 | Ga0207694_10020846 | Ga0207694_100208462 | 218 |
| 434 | 3300025924 | Ga0207694_10112742 | Ga0207694_101127421 | 218 |
| 435 | 3300025924 | Ga0207694_10725086 | Ga0207694_107250861 | 218 |
| 436 | 3300025925 | Ga0207650_10002045 | Ga0207650_100020454 | 218 |
| 437 | 3300025926 | Ga0207659_10000081 | Ga0207659_1000008118 | 218 |
| 438 | 3300025927 | Ga0207687_10683519 | Ga0207687_106835191 | 218 |
| 439 | 3300025931 | Ga0207644_10002484 | Ga0207644_100024842 | 218 |
| 440 | 3300025931 | Ga0207644_10104152 | Ga0207644_101041522 | 218 |
| 441 | 3300025931 | Ga0207644_10172656 | Ga0207644_101726562 | 218 |
| 442 | 3300025932 | Ga0207690_10369425 | Ga0207690_103694251 | 218 |
| 443 | 3300025933 | Ga0207706_10000573 | Ga0207706_1000057318 | 218 |
| 444 | 3300025934 | Ga0207686_10000819 | Ga0207686_1000081918 | 218 |
| 445 | 3300025935 | Ga0207709_10024546 | Ga0207709_100245462 | 218 |
| 446 | 3300025935 | Ga0207709_10036379 | Ga0207709_100363793 | 218 |
| 447 | 3300025935 | Ga0207709_10076677 | Ga0207709_100766772 | 218 |
| 448 | 3300025935 | Ga0207709_10134166 | Ga0207709_101341662 | 218 |
| 449 | 3300025935 | Ga0207709_10870874 | Ga0207709_108708741 | 218 |
| 450 | 3300025937 | Ga0207669_10011691 | Ga0207669_100116913 | 218 |
| 451 | 3300025937 | Ga0207669_10221304 | Ga0207669_102213042 | 218 |
| 452 | 3300025938 | Ga0207704_10028880 | Ga0207704_100288802 | 218 |
| 453 | 3300025938 | Ga0207704_10029777 | Ga0207704_100297772 | 218 |
| 454 | 3300025938 | Ga0207704_10175310 | Ga0207704_101753102 | 218 |
| 455 | 3300025938 | Ga0207704_10187161 | Ga0207704_101871613 | 218 |
| 456 | 3300025940 | Ga0207691_10000330 | Ga0207691_1000033020 | 218 |
| 457 | 3300025940 | Ga0207691_10048904 | Ga0207691_100489042 | 218 |
| 458 | 3300025940 | Ga0207691_10116936 | Ga0207691_101169362 | 218 |
| 459 | 3300025940 | Ga0207691_10195782 | Ga0207691_101957822 | 218 |
| 460 | 3300025940 | Ga0207691_10297188 | Ga0207691_102971882 | 218 |
| 461 | 3300025940 | Ga0207691_10919888 | Ga0207691_109198881 | 218 |
| 462 | 3300025941 | Ga0207711_10002273 | Ga0207711_100022733 | 218 |
| 463 | 3300025942 | Ga0207689_10001898 | Ga0207689_100018983 | 218 |
| 464 | 3300025945 | Ga0207679_10177723 | Ga0207679_101777233 | 218 |
| 465 | 3300025949 | Ga0207667_10004373 | Ga0207667_100043737 | 218 |
| 466 | 3300025949 | Ga0207667_10358448 | Ga0207667_103584482 | 218 |
| 467 | 3300025960 | Ga0207651_10019150 | Ga0207651_100191503 | 218 |
| 468 | 3300025960 | Ga0207651_10152989 | Ga0207651_101529892 | 218 |
| 469 | 3300025961 | Ga0207712_10002233 | Ga0207712_100022333 | 218 |
| 470 | 3300025961 | Ga0207712_10036422 | Ga0207712_100364224 | 218 |
| 471 | 3300025961 | Ga0207712_10363097 | Ga0207712_103630972 | 218 |
| 472 | 3300025972 | Ga0207668_10197801 | Ga0207668_101978011 | 218 |
| 473 | 3300025981 | Ga0207640_10002317 | Ga0207640_100023173 | 218 |
| 474 | 3300025981 | Ga0207640_10161612 | Ga0207640_101616122 | 218 |
| 475 | 3300026035 | Ga0207703_10094321 | Ga0207703_100943212 | 218 |
| 476 | 3300026041 | Ga0207639_10032301 | Ga0207639_100323012 | 218 |
| 477 | 3300026041 | Ga0207639_10378033 | Ga0207639_103780332 | 218 |
| 478 | 3300026075 | Ga0207708_10119063 | Ga0207708_101190632 | 218 |
| 479 | 3300026075 | Ga0207708_10185253 | Ga0207708_101852532 | 218 |
| 480 | 3300026078 | Ga0207702_10000392 | Ga0207702_1000039210 | 218 |
| 481 | 3300026089 | Ga0207648_10000837 | Ga0207648_1000083720 | 218 |
| 482 | 3300026089 | Ga0207648_10000925 | Ga0207648_1000092519 | 218 |
| 483 | 3300026089 | Ga0207648_10009629 | Ga0207648_100096298 | 218 |
| 484 | 3300026095 | Ga0207676_10040854 | Ga0207676_100408542 | 218 |
| 485 | 3300026116 | Ga0207674_10007715 | Ga0207674_100077152 | 218 |
| 486 | 3300026116 | Ga0207674_10093737 | Ga0207674_100937373 | 218 |
| 487 | 3300026118 | Ga0207675_100001504 | Ga0207675_1000015042 | 218 |
| 488 | 3300026118 | Ga0207675_100026361 | Ga0207675_1000263615 | 218 |
| 489 | 3300026118 | Ga0207675_100160311 | Ga0207675_1001603113 | 218 |
| 490 | 3300026121 | Ga0207683_10082420 | Ga0207683_100824203 | 218 |
| 491 | 3300026121 | Ga0207683_10138720 | Ga0207683_101387202 | 218 |
| 492 | 3300026142 | Ga0207698_10119560 | Ga0207698_101195602 | 218 |
| 493 | 3300027111 | Ga0209281_1000084 | Ga0209281_1000084205 | 218 |
| 494 | 3300027296 | Ga0209389_1004076 | Ga0209389_10040766 | 218 |
| 495 | 3300027614 | Ga0209970_1003044 | Ga0209970_10030442 | 218 |
| 496 | 3300028016 | Ga0265354_1001675 | Ga0265354_10016753 | 218 |
| 497 | 3300028036 | Ga0265355_1006476 | Ga0265355_10064761 | 218 |
| 498 | 3300028379 | Ga0268266_10725721 | Ga0268266_107257212 | 218 |
| 499 | 3300028380 | Ga0268265_10024928 | Ga0268265_100249282 | 218 |
| 500 | 3300028380 | Ga0268265_10111076 | Ga0268265_101110763 | 218 |
| 501 | 3300028380 | Ga0268265_10402721 | Ga0268265_104027211 | 218 |
| 502 | 3300028381 | Ga0268264_10009151 | Ga0268264_100091514 | 218 |
| 503 | 3300028381 | Ga0268264_10588861 | Ga0268264_105888611 | 218 |
| 504 | 3300028577 | Ga0265318_10002705 | Ga0265318_100027057 | 218 |
| 505 | 3300028794 | Ga0307515_10000020 | Ga0307515_10000020290 | 218 |
| 506 | 3300028794 | Ga0307515_10000101 | Ga0307515_1000010114 | 218 |
| 507 | 3300028794 | Ga0307515_10002116 | Ga0307515_1000211636 | 218 |
| 508 | 3300028794 | Ga0307515_10002349 | Ga0307515_1000234916 | 218 |
| 509 | 3300028794 | Ga0307515_10136546 | Ga0307515_101365462 | 218 |
| 510 | 3300028794 | Ga0307515_10145995 | Ga0307515_101459952 | 218 |
| 511 | 3300030521 | Ga0307511_10138460 | Ga0307511_101384602 | 218 |
| 512 | 3300031090 | Ga0265760_10000085 | Ga0265760_100000854 | 218 |
| 513 | 3300031238 | Ga0265332_10007049 | Ga0265332_100070496 | 218 |
| 514 | 3300031240 | Ga0265320_10032256 | Ga0265320_100322561 | 218 |
| 515 | 3300031240 | Ga0265320_10057468 | Ga0265320_100574681 | 218 |
| 516 | 3300031242 | Ga0265329_10025103 | Ga0265329_100251032 | 218 |
| 517 | 3300031250 | Ga0265331_10001855 | Ga0265331_100018552 | 218 |
| 518 | 3300031251 | Ga0265327_10000311 | Ga0265327_100003111 | 218 |
| 519 | 3300031251 | Ga0265327_10000746 | Ga0265327_1000074649 | 218 |
| 520 | 3300031344 | Ga0265316_10132005 | Ga0265316_101320051 | 218 |
| 521 | 3300031456 | Ga0307513_10055948 | Ga0307513_100559483 | 218 |
| 522 | 3300031507 | Ga0307509_10256664 | Ga0307509_102566641 | 218 |
| 523 | 3300031548 | Ga0307408_100000098 | Ga0307408_10000009857 | 218 |
| 524 | 3300031548 | Ga0307408_100000099 | Ga0307408_10000009913 | 218 |
| 525 | 3300031548 | Ga0307408_100005262 | Ga0307408_1000052625 | 218 |
| 526 | 3300031548 | Ga0307408_100049249 | Ga0307408_1000492493 | 218 |
| 527 | 3300031548 | Ga0307408_100049951 | Ga0307408_1000499513 | 218 |
| 528 | 3300031548 | Ga0307408_100478010 | Ga0307408_1004780102 | 218 |
| 529 | 3300031548 | Ga0307408_100621489 | Ga0307408_1006214892 | 218 |
| 530 | 3300031711 | Ga0265314_10000947 | Ga0265314_1000094711 | 218 |
| 531 | 3300031730 | Ga0307516_10000405 | Ga0307516_1000040516 | 218 |
| 532 | 3300031730 | Ga0307516_10002516 | Ga0307516_1000251623 | 218 |
| 533 | 3300031731 | Ga0307405_10238888 | Ga0307405_102388882 | 218 |
| 534 | 3300031731 | Ga0307405_10304352 | Ga0307405_103043521 | 218 |
| 535 | 3300031852 | Ga0307410_10036794 | Ga0307410_100367943 | 218 |
| 536 | 3300031852 | Ga0307410_10051824 | Ga0307410_100518243 | 218 |
| 537 | 3300031901 | Ga0307406_10010909 | Ga0307406_100109095 | 218 |
| 538 | 3300031903 | Ga0307407_10356298 | Ga0307407_103562981 | 218 |
| 539 | 3300031911 | Ga0307412_10026971 | Ga0307412_100269712 | 218 |
| 540 | 3300031911 | Ga0307412_10032653 | Ga0307412_100326534 | 218 |
| 541 | 3300031995 | Ga0307409_100804370 | Ga0307409_1008043702 | 218 |
| 542 | 3300032002 | Ga0307416_100017128 | Ga0307416_1000171285 | 218 |
| 543 | 3300032002 | Ga0307416_100030133 | Ga0307416_1000301332 | 218 |
| 544 | 3300032002 | Ga0307416_100720995 | Ga0307416_1007209951 | 218 |
| 545 | 3300032004 | Ga0307414_10028351 | Ga0307414_100283512 | 218 |
| 546 | 3300032005 | Ga0307411_10000301 | Ga0307411_100003015 | 218 |
| 547 | 3300032005 | Ga0307411_10021264 | Ga0307411_100212644 | 218 |
| 548 | 3300032005 | Ga0307411_10027072 | Ga0307411_100270723 | 218 |
| 549 | 3300032005 | Ga0307411_10083154 | Ga0307411_100831542 | 218 |
| 550 | 3300032005 | Ga0307411_10414543 | Ga0307411_104145432 | 218 |
| 551 | 3300032126 | Ga0307415_100065489 | Ga0307415_1000654892 | 218 |
| 552 | 3300034820 | Ga0373959_0003495 | Ga0373959_0003495_484_1143 | 218 |
| 553 | 3300035088 | Ga0373940_0007581 | Ga0373940_0007581_1574_2233 | 218 |
| 554 | 3300035091 | Ga0373951_0012083 | Ga0373951_0012083_15_674 | 218 |
| 555 | 3300035114 | Ga0373939_0000006 | Ga0373939_0000006_76548_77207 | 218 |
| 556 | 3300035121 | Ga0373960_0001743 | Ga0373960_0001743_3866_4525 | 218 |
| 557 | 3300035242 | Ga0373962_0055727 | Ga0373962_0055727_27_686 | 218 |
| 558 | 3300035691 | Ga0373931_0000353 | Ga0373931_0000353_155_814 | 218 |
| 559 | 3300035692 | Ga0373935_0183497 | Ga0373935_0183497_538_1197 | 218 |
| 560 | 3300037068 | Ga0373925_0035301 | Ga0373925_0035301_929_1588 | 218 |
| 561 | 3300037466 | Ga0395898_0403315 | Ga0395898_0403315_342_1001 | 218 |
| 562 | 3300037471 | Ga0395905_0008204 | Ga0395905_0008204_576_1235 | 218 |
| 563 | 3300037471 | Ga0395905_0027487 | Ga0395905_0027487_4366_5025 | 218 |
| 564 | 3300037471 | Ga0395905_0073435 | Ga0395905_0073435_2135_2797 | 218 |
| 565 | 3300038443 | Ga0395901_0002301 | Ga0395901_0002301_12659_13315 | 218 |
| 566 | 3300039447 | Ga0436361_0147565 | Ga0436361_0147565_20021_20683 | 218 |
| 567 | 3300039447 | Ga0436361_0237057 | Ga0436361_0237057_582_1238 | 218 |
| 568 | 3300039447 | Ga0436361_0287447 | Ga0436361_0287447_107717_108373 | 218 |
| 569 | 3300039447 | Ga0436361_0601867 | Ga0436361_0601867_22059_22715 | 218 |
| 570 | 3300041404 | Ga0439436_0001618 | Ga0439436_0001618_3967_4626 | 218 |
| 571 | 3300041404 | Ga0439436_0002563 | Ga0439436_0002563_2237_2896 | 218 |
| 572 | 3300041404 | Ga0439436_0036358 | Ga0439436_0036358_53_712 | 218 |
| 573 | 3300041407 | Ga0439447_005664 | Ga0439447_005664_3045_3704 | 218 |
| 574 | 3300041411 | Ga0439466_0063517 | Ga0439466_0063517_73_732 | 218 |
| 575 | 3300041413 | Ga0439465_0003102 | Ga0439465_0003102_2201_2860 | 218 |
| 576 | 3300041413 | Ga0439465_0117790 | Ga0439465_0117790_113_772 | 218 |
| 577 | 3300041512 | Ga0451853_3953217 | Ga0451853_3953217_255_914 | 218 |
| 578 | 3300042004 | Ga0439445_0000407 | Ga0439445_0000407_1470_2129 | 218 |
| 579 | 3300042007 | Ga0439449_0002680 | Ga0439449_0002680_5980_6639 | 218 |
| 580 | 3300042120 | Ga0450917_004735 | Ga0450917_004735_223_882 | 218 |
| 581 | 3300042125 | Ga0450923_000481 | Ga0450923_000481_3554_4213 | 218 |
| 582 | 3300042126 | Ga0450888_001982 | Ga0450888_001982_637_1296 | 218 |
| 583 | 3300042127 | Ga0450890_034542 | Ga0450890_034542_32_691 | 218 |
| 584 | 3300042129 | Ga0450891_001521 | Ga0450891_001521_1549_2208 | 218 |
| 585 | 3300042130 | Ga0450892_000421 | Ga0450892_000421_402_1061 | 218 |
| 586 | 3300042144 | Ga0450889_000380 | Ga0450889_000380_1194_1853 | 218 |
| 587 | 3300042146 | Ga0450907_022205 | Ga0450907_022205_168_827 | 218 |
| 588 | 3300042438 | Ga0439459_0012332 | Ga0439459_0012332_286_945 | 218 |
| 589 | 3300042531 | Ga0450918_000377 | Ga0450918_000377_1870_2526 | 218 |
| 590 | 3300042531 | Ga0450918_003844 | Ga0450918_003844_312_971 | 218 |
| 591 | 3300042532 | Ga0450893_0038466 | Ga0450893_0038466_32_691 | 218 |
| 592 | 3300042876 | Ga0451577_0383272 | Ga0451577_0383272_333_992 | 218 |
| 593 | 3300042876 | Ga0451577_0555699 | Ga0451577_0555699_33_692 | 218 |
| 594 | 3300044735 | Ga0466968_0061387 | Ga0466968_0061387_300_962 | 218 |
| 595 | 3300045051 | Ga0451576_0045972 | Ga0451576_0045972_43_699 | 218 |
| 596 | 3300046454 | Ga0495592_0015786 | Ga0495592_0015786_2406_3062 | 218 |
| 597 | 3300046455 | Ga0495603_0008193 | Ga0495603_0008193_2669_3325 | 218 |
| 598 | 3300046457 | Ga0495590_0171762 | Ga0495590_0171762_94_756 | 218 |
| 599 | 3300046459 | Ga0495629_0000941 | Ga0495629_0000941_19065_19721 | 218 |
| 600 | 3300046459 | Ga0495629_0003682 | Ga0495629_0003682_10237_10893 | 218 |
| 601 | 3300046460 | Ga0495638_0023738 | Ga0495638_0023738_3003_3665 | 218 |
| 602 | 3300046463 | Ga0495653_0000384 | Ga0495653_0000384_16128_16784 | 218 |
| 603 | 3300046463 | Ga0495653_0000511 | Ga0495653_0000511_3220_3876 | 218 |
| 604 | 3300046463 | Ga0495653_0051367 | Ga0495653_0051367_26_682 | 218 |
| 605 | 3300046471 | Ga0495650_0053283 | Ga0495650_0053283_213_869 | 218 |
| 606 | 3300046472 | Ga0495580_0000856 | Ga0495580_0000856_10801_11460 | 218 |
| 607 | 3300046472 | Ga0495580_0001319 | Ga0495580_0001319_16922_17578 | 218 |
| 608 | 3300046472 | Ga0495580_0372829 | Ga0495580_0372829_16_672 | 218 |
| 609 | 3300046473 | Ga0495582_0000503 | Ga0495582_0000503_17073_17729 | 218 |
| 610 | 3300046477 | Ga0495664_0001241 | Ga0495664_0001241_10019_10675 | 218 |
| 611 | 3300046491 | Ga0495584_0005887 | Ga0495584_0005887_547_1209 | 218 |
| 612 | 3300046500 | Ga0495596_0001182 | Ga0495596_0001182_1854_2510 | 218 |
| 613 | 3300046501 | Ga0495607_0010930 | Ga0495607_0010930_379_1035 | 218 |
| 614 | 3300046501 | Ga0495607_0099440 | Ga0495607_0099440_149_811 | 218 |
| 615 | 3300046506 | Ga0495583_0000258 | Ga0495583_0000258_54739_55395 | 218 |
| 616 | 3300046507 | Ga0495606_0000101 | Ga0495606_0000101_80680_81336 | 218 |
| 617 | 3300046507 | Ga0495606_0000161 | Ga0495606_0000161_56274_56930 | 218 |
| 618 | 3300046507 | Ga0495606_0002471 | Ga0495606_0002471_8746_9402 | 218 |
| 619 | 3300046507 | Ga0495606_0011920 | Ga0495606_0011920_1069_1725 | 218 |
| 620 | 3300046507 | Ga0495606_0058610 | Ga0495606_0058610_1337_1993 | 218 |
| 621 | 3300046511 | Ga0495608_0004822 | Ga0495608_0004822_4994_5650 | 218 |
| 622 | 3300046512 | Ga0495610_0002012 | Ga0495610_0002012_12354_13010 | 218 |
| 623 | 3300046512 | Ga0495610_0028675 | Ga0495610_0028675_1514_2170 | 218 |
| 624 | 3300046513 | Ga0495616_0005117 | Ga0495616_0005117_5730_6392 | 218 |
| 625 | 3300046514 | Ga0495618_0001270 | Ga0495618_0001270_14118_14774 | 218 |
| 626 | 3300046516 | Ga0495628_0149979 | Ga0495628_0149979_10_666 | 218 |
| 627 | 3300046517 | Ga0495630_0024889 | Ga0495630_0024889_2668_3324 | 218 |
| 628 | 3300046520 | Ga0495637_0000699 | Ga0495637_0000699_20780_21436 | 218 |
| 629 | 3300046522 | Ga0495643_0074698 | Ga0495643_0074698_739_1401 | 218 |
| 630 | 3300046524 | Ga0495648_0012677 | Ga0495648_0012677_2943_3599 | 218 |
| 631 | 3300046524 | Ga0495648_0028518 | Ga0495648_0028518_1355_2011 | 218 |
| 632 | 3300046524 | Ga0495648_0075085 | Ga0495648_0075085_312_968 | 218 |
| 633 | 3300046525 | Ga0495663_0100707 | Ga0495663_0100707_229_924 | 218 |
| 634 | 3300046526 | Ga0495666_0000277 | Ga0495666_0000277_19069_19725 | 218 |
| 635 | 3300046526 | Ga0495666_0017842 | Ga0495666_0017842_2484_3140 | 218 |
| 636 | 3300046528 | Ga0495642_0191748 | Ga0495642_0191748_193_855 | 218 |
| 637 | 3300046529 | Ga0495652_0015012 | Ga0495652_0015012_4409_5065 | 218 |
| 638 | 3300046529 | Ga0495652_0062951 | Ga0495652_0062951_2213_2869 | 218 |
| 639 | 3300046530 | Ga0495654_0000014 | Ga0495654_0000014_40616_41272 | 218 |
| 640 | 3300046533 | Ga0495640_0002781 | Ga0495640_0002781_495_1151 | 218 |
| 641 | 3300046533 | Ga0495640_0019898 | Ga0495640_0019898_13_669 | 218 |
| 642 | 3300046535 | Ga0495586_0001730 | Ga0495586_0001730_2802_3458 | 218 |
| 643 | 3300046536 | Ga0495587_0000929 | Ga0495587_0000929_385_1041 | 218 |
| 644 | 3300046536 | Ga0495587_0049911 | Ga0495587_0049911_396_1052 | 218 |
| 645 | 3300046537 | Ga0495598_0003493 | Ga0495598_0003493_1979_2674 | 218 |
| 646 | 3300046538 | Ga0495609_0001696 | Ga0495609_0001696_7495_8157 | 218 |
| 647 | 3300046539 | Ga0495621_0020833 | Ga0495621_0020833_469_1128 | 218 |
| 648 | 3300046542 | Ga0495597_0000172 | Ga0495597_0000172_50774_51430 | 218 |
| 649 | 3300046543 | Ga0495645_0008320 | Ga0495645_0008320_3712_4368 | 218 |
| 650 | 3300046543 | Ga0495645_0136815 | Ga0495645_0136815_912_1571 | 218 |
| 651 | 3300046558 | Ga0495633_0005718 | Ga0495633_0005718_2254_2910 | 218 |
| 652 | 3300046558 | Ga0495633_0012243 | Ga0495633_0012243_583_1239 | 218 |
| 653 | 3300046558 | Ga0495633_0021952 | Ga0495633_0021952_833_1528 | 218 |
| 654 | 3300046559 | Ga0495667_0202054 | Ga0495667_0202054_241_897 | 218 |
| 655 | 3300046616 | Ga0495668_0000684 | Ga0495668_0000684_19306_19962 | 218 |
| 656 | 3300046616 | Ga0495668_0006025 | Ga0495668_0006025_5909_6571 | 218 |
| 657 | 3300046642 | Ga0495634_0004651 | Ga0495634_0004651_5625_6281 | 218 |
| 658 | 3300046642 | Ga0495634_0018150 | Ga0495634_0018150_2342_2998 | 218 |
| 659 | 3300046663 | Ga0495635_0004874 | Ga0495635_0004874_4153_4809 | 218 |
| 660 | 3300046663 | Ga0495635_0036315 | Ga0495635_0036315_872_1528 | 218 |
| 661 | 3300046664 | Ga0495659_0003984 | Ga0495659_0003984_606_1268 | 218 |
| 662 | 3300046665 | Ga0495661_0013760 | Ga0495661_0013760_2560_3216 | 218 |
| 663 | 3300046665 | Ga0495661_0022967 | Ga0495661_0022967_1609_2265 | 218 |
| 664 | 3300046665 | Ga0495661_0034543 | Ga0495661_0034543_1913_2608 | 218 |
| 665 | 3300046665 | Ga0495661_0035672 | Ga0495661_0035672_746_1408 | 218 |
| 666 | 3300046674 | Ga0495588_0119838 | Ga0495588_0119838_394_1050 | 218 |
| 667 | 3300046678 | Ga0495599_0001289 | Ga0495599_0001289_181_837 | 218 |
| 668 | 3300046678 | Ga0495599_0198320 | Ga0495599_0198320_402_1058 | 218 |
| 669 | 3300046679 | Ga0495623_0014147 | Ga0495623_0014147_1889_2545 | 218 |
| 670 | 3300046679 | Ga0495623_0073646 | Ga0495623_0073646_221_877 | 218 |
| 671 | 3300046680 | Ga0495646_0005054 | Ga0495646_0005054_1524_2180 | 218 |
| 672 | 3300046680 | Ga0495646_0012497 | Ga0495646_0012497_2073_2729 | 218 |
| 673 | 3300046684 | Ga0495669_0000453 | Ga0495669_0000453_16843_17505 | 218 |
| 674 | 3300046684 | Ga0495669_0029841 | Ga0495669_0029841_1409_2104 | 218 |
| 675 | 3300046689 | Ga0495613_0015748 | Ga0495613_0015748_17_673 | 218 |
| 676 | 3300046690 | Ga0495624_0002063 | Ga0495624_0002063_2873_3529 | 218 |
| 677 | 3300046690 | Ga0495624_0067058 | Ga0495624_0067058_359_1015 | 218 |
| 678 | 3300046694 | Ga0495649_0008449 | Ga0495649_0008449_4426_5082 | 218 |
| 679 | 3300046694 | Ga0495649_0011217 | Ga0495649_0011217_2335_2997 | 218 |
| 680 | 3300046794 | Ga0495589_0011552 | Ga0495589_0011552_3855_4511 | 218 |
| 681 | 3300046809 | Ga0495600_0071877 | Ga0495600_0071877_1461_2117 | 218 |
| 682 | 3300046810 | Ga0495660_0022202 | Ga0495660_0022202_1112_1768 | 218 |
| 683 | 3300046810 | Ga0495660_0206962 | Ga0495660_0206962_110_772 | 218 |
| 684 | 3300047315 | Ga0495581_0000088 | Ga0495581_0000088_4520_5176 | 218 |
| 685 | 3300047317 | Ga0495604_0010429 | Ga0495604_0010429_441_1097 | 218 |
| 686 | 3300047317 | Ga0495604_0033888 | Ga0495604_0033888_850_1506 | 218 |
| 687 | 3300047318 | Ga0495636_0004548 | Ga0495636_0004548_4023_4685 | 218 |
| 688 | 3300047319 | Ga0495674_0021023 | Ga0495674_0021023_3920_4576 | 218 |
| 689 | 3300047319 | Ga0495674_0043522 | Ga0495674_0043522_1550_2206 | 218 |
| 690 | 3300047319 | Ga0495674_0047875 | Ga0495674_0047875_1241_1897 | 218 |
| 691 | 3300047320 | Ga0495672_0000400 | Ga0495672_0000400_50902_51558 | 218 |
| 692 | 3300047321 | Ga0495676_0023216 | Ga0495676_0023216_2062_2718 | 218 |
| 693 | 3300047321 | Ga0495676_0079930 | Ga0495676_0079930_504_1160 | 218 |
| 694 | 3300047321 | Ga0495676_0094469 | Ga0495676_0094469_889_1545 | 218 |
| 695 | 3300047322 | Ga0495680_0015198 | Ga0495680_0015198_3119_3775 | 218 |
| 696 | 3300047322 | Ga0495680_0401871 | Ga0495680_0401871_135_791 | 218 |
| 697 | 3300047323 | Ga0495683_0045692 | Ga0495683_0045692_749_1405 | 218 |
| 698 | 3300047445 | Ga0495677_0006066 | Ga0495677_0006066_2765_3427 | 218 |
| 699 | 3300047445 | Ga0495677_0021727 | Ga0495677_0021727_515_1210 | 218 |
| 700 | 3300047446 | Ga0495679_000374 | Ga0495679_000374_30382_31038 | 218 |
| 701 | 3300047446 | Ga0495679_000724 | Ga0495679_000724_7851_8507 | 218 |
| 702 | 3300047446 | Ga0495679_013957 | Ga0495679_013957_838_1500 | 218 |
| 703 | 3300047469 | Ga0495673_0040614 | Ga0495673_0040614_340_996 | 218 |
| 704 | 3300047470 | Ga0495681_0010735 | Ga0495681_0010735_4636_5298 | 218 |
| 705 | 3300047472 | Ga0495686_0004786 | Ga0495686_0004786_1896_2552 | 218 |
| 706 | 3300047472 | Ga0495686_0008011 | Ga0495686_0008011_4618_5280 | 218 |
| 707 | 3300047472 | Ga0495686_0010321 | Ga0495686_0010321_5136_5792 | 218 |
| 708 | 3300047673 | Ga0495593_0000523 | Ga0495593_0000523_2551_3207 | 218 |
| 709 | 3300047673 | Ga0495593_0003554 | Ga0495593_0003554_4342_4998 | 218 |
| 710 | 3300048088 | Ga0495602_0018152 | Ga0495602_0018152_2669_3325 | 218 |
| 711 | 3300048088 | Ga0495602_0100904 | Ga0495602_0100904_546_1202 | 218 |
| 712 | 3300048089 | Ga0495614_0001008 | Ga0495614_0001008_8825_9481 | 218 |
| 713 | 3300048089 | Ga0495614_0019842 | Ga0495614_0019842_1034_1690 | 218 |
| 714 | 3300048903 | Ga0496100_0489473 | Ga0496100_0489473_109_768 | 218 |
| 715 | 3300048905 | Ga0496102_0008917 | Ga0496102_0008917_3565_4221 | 218 |
| 716 | 3300048905 | Ga0496102_0541693 | Ga0496102_0541693_256_915 | 218 |
| 717 | 3300048911 | Ga0496108_0068954 | Ga0496108_0068954_1374_2030 | 218 |
| 718 | 3300048912 | Ga0496109_0135001 | Ga0496109_0135001_1233_1889 | 218 |
| 719 | 3300048917 | Ga0496114_0116017 | Ga0496114_0116017_1500_2159 | 218 |
| 720 | 3300048920 | Ga0496117_0166489 | Ga0496117_0166489_170_835 | 218 |
| 721 | 3300048924 | Ga0496121_0001461 | Ga0496121_0001461_19361_20113 | 218 |
| 722 | 3300048924 | Ga0496121_0002415 | Ga0496121_0002415_12225_12881 | 218 |
| 723 | 3300048925 | Ga0496122_0346328 | Ga0496122_0346328_40_696 | 218 |
| 724 | 3300048926 | Ga0496123_0022900 | Ga0496123_0022900_3245_3901 | 218 |
| 725 | 3300048927 | Ga0496124_0000504 | Ga0496124_0000504_47446_48102 | 218 |
| 726 | 3300048927 | Ga0496124_0052327 | Ga0496124_0052327_2110_2766 | 218 |
| 727 | 3300048929 | Ga0496126_0167233 | Ga0496126_0167233_223_888 | 218 |
| 728 | 3300048929 | Ga0496126_0283081 | Ga0496126_0283081_185_895 | 218 |
| 729 | 3300049128 | Ga0501308_004493 | Ga0501308_004493_341_1000 | 218 |
| 730 | 3300049160 | Ga0501304_007572 | Ga0501304_007572_190_849 | 218 |
| 731 | 3300049459 | Ga0495678_039510 | Ga0495678_039510_159_815 | 218 |
| 732 | 3300049521 | Ga0501298_017759 | Ga0501298_017759_558_1217 | 218 |
| 733 | 3300049590 | Ga0501074_0043068 | Ga0501074_0043068_337_993 | 218 |
| 734 | 3300049651 | Ga0501201_003743 | Ga0501201_003743_331_990 | 218 |
| 735 | 3300049658 | Ga0501211_000888 | Ga0501211_000888_2161_2820 | 218 |
| 736 | 3300049662 | Ga0501222_004907 | Ga0501222_004907_49_708 | 218 |
| 737 | 3300049662 | Ga0501222_013028 | Ga0501222_013028_137_796 | 218 |
| 738 | 3300049669 | Ga0501235_021459 | Ga0501235_021459_301_960 | 218 |
| 739 | 3300049706 | Ga0501229_004772 | Ga0501229_004772_843_1502 | 218 |
| 740 | 3300049742 | Ga0501080_0018366 | Ga0501080_0018366_3483_4139 | 218 |
| 741 | 3300050493 | nmdc:mga0k408_10040_c1 | nmdc:mga0k408_10040_c1_3877_4536 | 218 |
| 742 | 3300050493 | nmdc:mga0k408_134465_c1 | nmdc:mga0k408_134465_c1_43_702 | 218 |
| 743 | 3300050493 | nmdc:mga0k408_211940_c1 | nmdc:mga0k408_211940_c1_183_845 | 218 |
| 744 | 3300050493 | nmdc:mga0k408_35348_c1 | nmdc:mga0k408_35348_c1_1059_1718 | 218 |
| 745 | 3300050496 | nmdc:mga07m45_1126_c1 | nmdc:mga07m45_1126_c1_9648_10307 | 218 |
| 746 | 3300050496 | nmdc:mga07m45_8512_c1 | nmdc:mga07m45_8512_c1_2799_3458 | 218 |
| 747 | 3300050511 | nmdc:mga08y16_79385_c1 | nmdc:mga08y16_79385_c1_208_867 | 218 |
| 748 | 3300053088 | Ga0500644_0002846 | Ga0500644_0002846_3085_3744 | 218 |
| 749 | 3300053088 | Ga0500644_0009670 | Ga0500644_0009670_1840_2499 | 218 |
| 750 | 3300053108 | Ga0500562_004854 | Ga0500562_004854_129_788 | 218 |
| 751 | 3300053125 | Ga0500618_000088 | Ga0500618_000088_32006_32662 | 218 |
| 752 | 3300053145 | Ga0500586_002812 | Ga0500586_002812_2508_3167 | 218 |
| 753 | 3300059477 | Ga0587084_018055 | Ga0587084_018055_148_804 | 218 |
| 754 | 3300059491 | Ga0587070_002891 | Ga0587070_002891_896_1699 | 218 |
| 755 | 3300059492 | Ga0587073_0061179 | Ga0587073_0061179_25_681 | 218 |
| 756 | 3300059493 | Ga0587077_004383 | Ga0587077_004383_130_786 | 218 |
| 757 | 3300059504 | Ga0587082_023797 | Ga0587082_023797_207_908 | 218 |
| 758 | 3300059505 | Ga0587083_0039397 | Ga0587083_0039397_108_764 | 218 |
| 759 | 3300059506 | Ga0587085_039329 | Ga0587085_039329_71_727 | 218 |
| 760 | 3300059507 | Ga0587086_003813 | Ga0587086_003813_817_1524 | 218 |
| 761 | 3300059508 | Ga0587088_033941 | Ga0587088_033941_38_697 | 218 |
| 762 | 3300059509 | Ga0587089_015701 | Ga0587089_015701_245_901 | 218 |
| 763 | 3300059510 | Ga0587090_010781 | Ga0587090_010781_210_992 | 218 |
| 764 | 3300059511 | Ga0587091_005471 | Ga0587091_005471_896_1552 | 218 |
| 765 | 3300059512 | Ga0587092_003332 | Ga0587092_003332_158_940 | 218 |
| 766 | 3300059512 | Ga0587092_003665 | Ga0587092_003665_923_1630 | 218 |
| 767 | 3300059624 | Ga0587109_042119 | Ga0587109_042119_156_812 | 218 |
| 768 | 3300059639 | Ga0587062_000926 | Ga0587062_000926_275_1057 | 218 |
| 769 | 3300059641 | Ga0587068_003167 | Ga0587068_003167_1061_1843 | 218 |
| 770 | 3300059643 | Ga0587072_007303 | Ga0587072_007303_817_1524 | 218 |
| 771 | 3300059643 | Ga0587072_028833 | Ga0587072_028833_261_917 | 218 |
| 772 | 3300059645 | Ga0587076_005159 | Ga0587076_005159_226_1008 | 218 |
| 773 | 3300059646 | Ga0587078_019490 | Ga0587078_019490_70_771 | 218 |
| 774 | 3300059647 | Ga0587079_034545 | Ga0587079_034545_215_871 | 218 |
| 775 | 3300059653 | Ga0587108_010658 | Ga0587108_010658_103_759 | 218 |
| 776 | 3300059660 | Ga0587124_007228 | Ga0587124_007228_157_813 | 218 |
| 777 | 3300060344 | Ga0587071_046836 | Ga0587071_046836_119_775 | 218 |
| 778 | 3300060346 | Ga0587111_0003486 | Ga0587111_0003486_216_872 | 218 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7kuu-assembly1.cif.gz_B | lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form | 0.9534 | 3 | 218 |
| 7kuu-assembly1.cif.gz_B | lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form | 0.9488 | 3 | 218 |
| 6p0w-assembly1.cif.gz_A-2 | lsfa from p. aeruginosa, a 1-cys prx in reduced form | 0.9471 | 3 | 218 |
| 5ykj-assembly1.cif.gz_A | structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems | 0.9391 | 3 | 215 |
| 6p0w-assembly1.cif.gz_A-2 | lsfa from p. aeruginosa, a 1-cys prx in reduced form | 0.938 | 3 | 218 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54SE2_176_239_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9749 | 155 | 217 | 3.30.1020.10 |
| af_A0A0R0K508_6_109_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9654 | 5 | 106 | 3.40.30.10 |
| af_P34227_199_260_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9639 | 155 | 215 | 3.30.1020.10 |
| af_O08709_156_224_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9508 | 155 | 217 | 3.30.1020.10 |
| af_Q54SE2_176_239_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9457 | 155 | 217 | 3.30.1020.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C7WM65-F1-model_v4 | Redoxin domain-containing protein | 0.9926 | 1 | 169 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A3D2S068-F1-model_v4 | Peroxidase | 0.9922 | 1 | 106 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A659YRX5-F1-model_v4 | deleted | 0.9909 | 1 | 99 |
|
| AF-A0A534YD48-F1-model_v4 | Peroxiredoxin | 0.9893 | 1 | 184 |
GO:0005829
GO:0045454 GO:0051920 |
| AF-C3KLK5-F1-model_v4 | Peroxiredoxin 6 (EC 1.11.1.-) | 0.9874 | 1 | 218 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar