F480443

General Info

Members Datasets Scaffolds Average Seq Length
778 427 760 219

Family's Representative Sequence

Representative Sequence 3300059491|Ga0587070_002891|Ga0587070_002891_896_1699
Length 267
Sequence VQFQIQIVDTHESLKTRVNTDFPADGLQINRTLLMHGIFLSPINSQENKMSLRINDVAPNFTARTTQGTIDFHTWIGDQWAILFSHPKDFTPVCTTELGYMARIEPEFTRRNAKLIGLSIDPVENHDKWVADIEETQGATVKYPMIGDTDLAVAKLYNMLPAEEGGTSEGRTAATNATVRSVFIIGPDKRIKLMLTYPMTTGRNFDEILRALDSMQLTAKHKVATPANWKQGEDVIITPAVSNEEAEKTFPGFKTIKPYLRTTKQPV

Samples

Sample ID Description Type Environment
1 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
2 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
3 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
4 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
5 2643221585 Pelomonas sp. Root662 Isolate Unclassified
6 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
7 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
8 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
9 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
10 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
11 2643221656 Pelomonas sp. Root405 Isolate Unclassified
12 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
13 2842733646 Variovorax sp. R-72446 Isolate Unclassified
14 2857564685 Duganella sp. R-74599 Isolate Unclassified
15 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
16 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
17 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
18 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
19 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
20 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
21 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
22 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
23 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
24 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
25 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
28 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
29 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
30 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
31 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
32 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
33 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
34 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
35 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
36 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
37 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
38 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
39 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
40 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
41 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
42 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
43 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
46 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
51 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
54 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
57 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
60 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
61 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
62 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
63 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
64 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
65 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
66 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
77 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
78 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
96 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
107 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
108 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
109 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
121 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
137 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
141 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
143 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
144 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
145 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
147 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
148 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
152 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
154 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
156 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
205 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
206 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
209 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
210 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
214 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
215 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
216 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
217 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
219 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
220 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
221 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
222 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
223 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
224 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
225 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
226 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
227 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
228 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
229 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
230 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
231 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
232 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
233 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
234 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
235 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
236 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
237 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
238 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
239 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
240 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
241 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
242 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
243 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
244 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
245 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
246 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
247 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
248 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
249 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
251 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
253 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
254 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
255 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
256 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
257 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
258 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
259 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
260 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
261 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
262 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
263 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
264 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
265 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
266 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
267 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
268 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
269 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
270 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
271 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
272 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
273 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
274 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
275 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
276 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
277 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
278 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
279 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
280 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
281 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
282 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
283 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
284 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
285 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
286 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
287 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
288 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
289 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
290 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
291 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
292 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
293 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
294 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
295 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
296 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
297 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
298 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
299 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
300 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
301 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
302 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
303 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
304 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
305 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
306 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
307 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
308 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
309 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
310 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
311 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
312 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
313 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
314 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
315 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
316 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
317 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
318 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
319 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
320 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
321 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
322 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
323 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
324 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
325 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
326 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
327 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
328 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
329 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
330 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
331 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
332 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
333 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
334 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
335 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
336 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
337 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
338 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
339 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
340 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
341 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
342 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
343 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
344 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
345 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
346 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
347 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
348 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
349 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
350 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
351 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
352 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
353 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
354 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
355 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
356 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
357 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
358 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
359 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
360 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
361 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
362 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
363 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
364 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
365 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
366 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
367 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
368 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
369 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
370 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
373 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
374 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
376 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
377 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
378 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
379 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
380 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
381 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
382 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
383 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
384 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
385 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
386 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
387 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
388 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
389 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
390 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
391 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
392 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
393 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
394 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
395 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
396 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
397 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
398 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
399 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
400 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
401 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.8
Metatranscriptomes 4.88
Isolates 2.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.35
Nodule 1.29
Rhizoplane 0.9
Rhizosphere 74.29
Stem 0
Stem Tuber 0
Unclassified 6.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000411 3300002705 Bacteria 26753
2 JGI25156J39149_1014030 3300002705 Bacteria 1670
3 JGI25154J39366_1003427 3300002738 Bacteria 3334
4 JGI25157J39369_1000052 3300002741 Bacteria 110463
5 JGI25164J39214_1005845 3300002772 Bacteria 1315
6 JGI25152J39213_1000446 3300002773 Bacteria 24511
7 JGI25152J39213_1001630 3300002773 Bacteria 9362
8 JGI25150J39212_1002460 3300002774 Bacteria 4595
9 JGI25150J39212_1006219 3300002774 Bacteria 2484
10 JGI25150J39212_1007122 3300002774 Bacteria 2266
11 JGI25150J39212_1025271 3300002774 Bacteria 869
12 JGI25159J45721_1002937 3300002987 Bacteria 6211
13 JGI25153J46596_10000279 3300003215 Bacteria 39072
14 Ga0055539_1000234 3300003752 Bacteria 38255
15 Ga0055539_1001493 3300003752 Bacteria 4301
16 Ga0055533_1000053 3300003756 Bacteria 199478
17 Ga0055525_1000013 3300003759 Bacteria 440870
18 Ga0055525_1001043 3300003759 Bacteria 7189
19 Ga0055535_1000727 3300003761 Bacteria 24943
20 Ga0055529_1000015 3300003763 Bacteria 366950
21 Ga0055529_1000653 3300003763 Bacteria 24939
22 Ga0055526_1000280 3300003771 Bacteria 43010
23 Ga0055526_1002177 3300003771 Bacteria 13437
24 Ga0055526_1005508 3300003771 Bacteria 7255
25 Ga0055537_1000143 3300003773 Bacteria 53762
26 Ga0055537_1001454 3300003773 Bacteria 9219
27 Ga0055524_1000061 3300003775 Bacteria 135241
28 Ga0055524_1000157 3300003775 Bacteria 79002
29 Ga0055524_1003621 3300003775 Bacteria 7440
30 Ga0055524_1005836 3300003775 Bacteria 5434
31 Ga0055524_1006771 3300003775 Bacteria 4945
32 Ga0055524_1011138 3300003775 Bacteria 3534
33 Ga0055534_1000308 3300003784 Bacteria 32899
34 Ga0055534_1000712 3300003784 Bacteria 16284
35 Ga0055528_1000430 3300003790 Bacteria 33765
36 Ga0055530_10000524 3300003791 Bacteria 33249
37 Ga0055530_10000645 3300003791 Bacteria 30022
38 Ga0055540_1000026 3300003792 Bacteria 189071
39 Ga0055531_10001224 3300003794 Bacteria 19583
40 Ga0055531_10003738 3300003794 Bacteria 9559
41 Ga0055531_10009114 3300003794 Bacteria 5117
42 Ga0055543_1001250 3300004625 Bacteria 10529
43 Ga0055543_1010209 3300004625 Bacteria 1979
44 Ga0065165_1000241 3300005262 Bacteria 93644
45 Ga0065165_1000268 3300005262 Bacteria 89520
46 Ga0065165_1000498 3300005262 Bacteria 60773
47 Ga0065712_10350414 3300005290 Bacteria 788
48 Ga0065707_10003061 3300005295 Bacteria 7358
49 Ga0065707_10032055 3300005295 Bacteria 1065
50 Ga0070658_10072234 3300005327 Bacteria 2827
51 Ga0070658_10256953 3300005327 Bacteria 1483
52 Ga0070658_10299480 3300005327 Bacteria 1371
53 Ga0070658_10670810 3300005327 Bacteria 900
54 Ga0070658_10673660 3300005327 Bacteria 898
55 Ga0070676_10039630 3300005328 Bacteria 2725
56 Ga0070676_10061249 3300005328 Bacteria 2237
57 Ga0070690_100023202 3300005330 Bacteria 3804
58 Ga0070690_100265886 3300005330 Bacteria 1218
59 Ga0070670_100003146 3300005331 Bacteria 13648
60 Ga0070670_100603262 3300005331 Bacteria 982
61 Ga0068869_100002141 3300005334 Bacteria 11868
62 Ga0068869_100048099 3300005334 Bacteria 3082
63 Ga0068869_100175546 3300005334 Bacteria 1676
64 Ga0070680_100056543 3300005336 Bacteria 3207
65 Ga0070680_100173735 3300005336 Bacteria 1814
66 Ga0070682_100034077 3300005337 Bacteria 3098
67 Ga0068868_100143840 3300005338 Bacteria 1960
68 Ga0070660_100018170 3300005339 Bacteria 5133
69 Ga0070660_100187089 3300005339 Bacteria 1677
70 Ga0070691_10155511 3300005341 Bacteria 1175
71 Ga0070687_100392502 3300005343 Bacteria 908
72 Ga0070668_100048017 3300005347 Bacteria 3283
73 Ga0070669_100005491 3300005353 Bacteria 9153
74 Ga0070669_100087500 3300005353 Bacteria 2330
75 Ga0070669_100165396 3300005353 Bacteria 1721
76 Ga0070669_100219175 3300005353 Bacteria 1504
77 Ga0070675_100000072 3300005354 Bacteria 58324
78 Ga0070675_100061753 3300005354 Bacteria 3095
79 Ga0070671_100039005 3300005355 Bacteria 3943
80 Ga0070671_100055959 3300005355 Bacteria 3282
81 Ga0070671_100245284 3300005355 Bacteria 1521
82 Ga0070674_100010657 3300005356 Bacteria 5569
83 Ga0070674_100054836 3300005356 Bacteria 2758
84 Ga0070674_100135474 3300005356 Bacteria 1841
85 Ga0070673_100000785 3300005364 Bacteria 17673
86 Ga0070673_100213740 3300005364 Bacteria 1667
87 Ga0070673_100629416 3300005364 Bacteria 981
88 Ga0070688_100259659 3300005365 Bacteria 1240
89 Ga0070659_100018413 3300005366 Bacteria 5271
90 Ga0070659_100053173 3300005366 Bacteria 3187
91 Ga0070659_100080967 3300005366 Bacteria 2593
92 Ga0070667_100108890 3300005367 Bacteria 2401
93 Ga0070714_100065790 3300005435 Bacteria 3123
94 Ga0070701_10040182 3300005438 Bacteria 2377
95 Ga0070701_10300472 3300005438 Bacteria 987
96 Ga0070678_100018675 3300005456 Bacteria 4499
97 Ga0070678_100066923 3300005456 Bacteria 2672
98 Ga0070678_100130258 3300005456 Bacteria 1997
99 Ga0070678_100309326 3300005456 Bacteria 1346
100 Ga0070662_100019823 3300005457 Bacteria 4573
101 Ga0070662_100081326 3300005457 Bacteria 2413
102 Ga0070681_10198329 3300005458 Bacteria 1926
103 Ga0070681_10766076 3300005458 Bacteria 882
104 Ga0068867_100003414 3300005459 Bacteria 11183
105 Ga0068867_100004430 3300005459 Bacteria 9872
106 Ga0068867_100006335 3300005459 Bacteria 8372
107 Ga0068867_100088266 3300005459 Bacteria 2349
108 Ga0068867_100172756 3300005459 Bacteria 1713
109 Ga0070699_100022397 3300005518 Bacteria 5444
110 Ga0070679_100035375 3300005530 Bacteria 4955
111 Ga0070684_100158031 3300005535 Bacteria 2056
112 Ga0070697_100687163 3300005536 Bacteria 902
113 Ga0068853_100090736 3300005539 Bacteria 2686
114 Ga0068853_100562867 3300005539 Bacteria 1080
115 Ga0070672_100000977 3300005543 Bacteria 17279
116 Ga0070672_100221642 3300005543 Bacteria 1587
117 Ga0070672_100237621 3300005543 Bacteria 1532
118 Ga0070672_100764405 3300005543 Bacteria 849
119 Ga0070686_100033563 3300005544 Bacteria 3155
120 Ga0070695_100187004 3300005545 Bacteria 1471
121 Ga0070693_100047005 3300005547 Bacteria 2454
122 Ga0070665_100059416 3300005548 Bacteria 3832
123 Ga0070665_100292191 3300005548 Bacteria 1632
124 Ga0068855_100007935 3300005563 Bacteria 12827
125 Ga0068855_100029432 3300005563 Bacteria 6565
126 Ga0068855_100590336 3300005563 Bacteria 1199
127 Ga0070664_100205710 3300005564 Bacteria 1758
128 Ga0068857_100001467 3300005577 Bacteria 18753
129 Ga0068857_100075039 3300005577 Bacteria 3014
130 Ga0068854_100021390 3300005578 Bacteria 4390
131 Ga0068854_100163393 3300005578 Bacteria 1726
132 Ga0068856_100007649 3300005614 Bacteria 10544
133 Ga0070702_100307034 3300005615 Bacteria 1100
134 Ga0068852_100362082 3300005616 Bacteria 1419
135 Ga0068852_100790507 3300005616 Bacteria 963
136 Ga0068859_100091484 3300005617 Bacteria 3093
137 Ga0068864_100001546 3300005618 Bacteria 18969
138 Ga0068866_10000430 3300005718 Bacteria 19430
139 Ga0068866_10021411 3300005718 Bacteria 2978
140 Ga0068861_100003155 3300005719 Bacteria 10900
141 Ga0068861_100523520 3300005719 Bacteria 1076
142 Ga0068863_100158772 3300005841 Bacteria 2165
143 Ga0068858_100086090 3300005842 Bacteria 2923
144 Ga0068860_100002904 3300005843 Bacteria 17746
145 Ga0068860_100102547 3300005843 Bacteria 2730
146 Ga0068860_100204943 3300005843 Bacteria 1912
147 Ga0068862_100018548 3300005844 Bacteria 5796
148 Ga0068862_100344778 3300005844 Bacteria 1380
149 Ga0075364_10137789 3300006051 Bacteria 1640
150 Ga0075362_10002903 3300006177 Bacteria 5868
151 Ga0075367_10010462 3300006178 Bacteria 4874
152 Ga0075366_10001896 3300006195 Bacteria 10558
153 Ga0075366_10004969 3300006195 Bacteria 7174
154 Ga0075366_10005657 3300006195 Bacteria 6777
155 Ga0075366_10011710 3300006195 Bacteria 4957
156 Ga0075366_10030492 3300006195 Bacteria 3170
157 Ga0075366_10034154 3300006195 Bacteria 2996
158 Ga0075366_10034881 3300006195 Bacteria 2965
159 Ga0097621_100302867 3300006237 Bacteria 1412
160 Ga0097621_100343135 3300006237 Bacteria 1326
161 Ga0075370_10000577 3300006353 Bacteria 14108
162 Ga0075370_10002114 3300006353 Bacteria 9064
163 Ga0075370_10026890 3300006353 Bacteria 3189
164 Ga0075370_10027005 3300006353 Bacteria 3183
165 Ga0068871_100175685 3300006358 Bacteria 1838
166 Ga0068871_100665355 3300006358 Bacteria 952
167 Ga0075430_100085982 3300006846 Bacteria 2632
168 Ga0075431_100002911 3300006847 Bacteria 16568
169 Ga0068865_100390618 3300006881 Bacteria 1137
170 Ga0097620_100091482 3300006931 Bacteria 3093
171 Ga0099824_1035904 3300006942 Bacteria 1477
172 Ga0099823_1000009 3300006944 Bacteria 99451
173 Ga0079104_1000093 3300006946 Bacteria 130633
174 Ga0079104_1043049 3300006946 Bacteria 1042
175 Ga0099795_10159958 3300007788 Bacteria 929
176 Ga0105240_10003357 3300009093 Bacteria 24898
177 Ga0105240_10011396 3300009093 Bacteria 12386
178 Ga0105240_10020177 3300009093 Bacteria 8897
179 Ga0105240_10050940 3300009093 Bacteria 5214
180 Ga0105240_10059526 3300009093 Bacteria 4766
181 Ga0111539_10091684 3300009094 Bacteria 3570
182 Ga0105245_10029752 3300009098 Bacteria 4828
183 Ga0105243_10001906 3300009148 Bacteria 17788
184 Ga0105243_10057702 3300009148 Bacteria 3092
185 Ga0105243_10102221 3300009148 Bacteria 2381
186 Ga0105243_10170483 3300009148 Bacteria 1884
187 Ga0105243_10364324 3300009148 Bacteria 1331
188 Ga0105243_10781506 3300009148 Bacteria 939
189 Ga0105242_10006750 3300009176 Bacteria 8850
190 Ga0105242_10474007 3300009176 Bacteria 1185
191 Ga0105248_10015504 3300009177 Bacteria 8402
192 Ga0105248_10423968 3300009177 Bacteria 1498
193 Ga0105237_10002251 3300009545 Bacteria 24020
194 Ga0105237_10031465 3300009545 Bacteria 5380
195 Ga0105237_10333668 3300009545 Bacteria 1521
196 Ga0105238_10083823 3300009551 Bacteria 3177
197 Ga0105249_10005323 3300009553 Bacteria 11104
198 Ga0105249_10024181 3300009553 Bacteria 5459
199 Ga0105249_10029171 3300009553 Bacteria 4982
200 Ga0105239_10002342 3300010375 Bacteria 24158
201 Ga0105239_10021943 3300010375 Bacteria 7038
202 Ga0105239_10025127 3300010375 Bacteria 6561
203 Ga0105239_10061489 3300010375 Bacteria 4122
204 Ga0105239_10065176 3300010375 Bacteria 4000
205 Ga0105239_10089281 3300010375 Bacteria 3399
206 Ga0105239_11135333 3300010375 Bacteria 900
207 Ga0157319_1000005 3300012497 Bacteria 372810
208 Ga0157327_1002797 3300012512 Bacteria 1235
209 Ga0157373_10030622 3300013100 Bacteria 3872
210 Ga0157373_10170000 3300013100 Bacteria 1534
211 Ga0157369_10054582 3300013105 Bacteria 4315
212 Ga0157369_10477878 3300013105 Bacteria 1290
213 Ga0157374_10021548 3300013296 Bacteria 5736
214 Ga0157378_10001111 3300013297 Bacteria 24480
215 Ga0157378_10029548 3300013297 Bacteria 4840
216 Ga0157378_10568832 3300013297 Bacteria 1141
217 Ga0163162_10082200 3300013306 Bacteria 3293
218 Ga0163162_10244961 3300013306 Bacteria 1924
219 Ga0163162_10958433 3300013306 Bacteria 966
220 Ga0157372_10262240 3300013307 Bacteria 2006
221 Ga0157375_10068867 3300013308 Bacteria 3542
222 Ga0157375_10108223 3300013308 Bacteria 2874
223 Ga0157375_10192986 3300013308 Bacteria 2192
224 Ga0157380_10046225 3300014326 Bacteria 3418
225 Ga0157380_10312297 3300014326 Bacteria 1453
226 Ga0157379_10008561 3300014968 Bacteria 8902
227 Ga0157379_10011067 3300014968 Bacteria 7864
228 Ga0157379_10036083 3300014968 Bacteria 4409
229 Ga0157379_10239194 3300014968 Bacteria 1647
230 Ga0157376_10396404 3300014969 Bacteria 1333
231 Ga0182005_1043544 3300015265 Bacteria 1220
232 Ga0163161_10075781 3300017792 Bacteria 2469
233 Ga0206351_10127825 3300020077 Bacteria 757
234 Ga0206350_11556907 3300020080 Bacteria 883
235 Ga0213872_10000026 3300021361 Bacteria 149852
236 Ga0213872_10000033 3300021361 Bacteria 135667
237 Ga0213872_10000160 3300021361 Bacteria 61551
238 Ga0213872_10021539 3300021361 Bacteria 2968
239 Ga0209674_100039 3300025226 Bacteria 402292
240 Ga0209672_110257 3300025228 Bacteria 1275
241 Ga0209563_100025 3300025230 Bacteria 596456
242 Ga0209563_100080 3300025230 Bacteria 199504
243 Ga0207427_100466 3300025231 Bacteria 22197
244 Ga0209258_100189 3300025242 Bacteria 128268
245 Ga0209258_100222 3300025242 Bacteria 107982
246 Ga0207425_1000001 3300025245 Bacteria 2525432
247 Ga0207425_1000441 3300025245 Bacteria 27232
248 Ga0207425_1000795 3300025245 Bacteria 16102
249 Ga0207425_1026227 3300025245 Bacteria 1197
250 Ga0209646_1000076 3300025246 Bacteria 212891
251 Ga0209646_1024723 3300025246 Bacteria 844
252 Ga0209026_1000011 3300025250 Bacteria 507291
253 Ga0209026_1005603 3300025250 Bacteria 3323
254 Ga0209677_100086 3300025253 Bacteria 112759
255 Ga0209677_100399 3300025253 Bacteria 26179
256 Ga0209759_1000034 3300025256 Bacteria 271209
257 Ga0209759_1004758 3300025256 Bacteria 4962
258 Ga0209759_1011716 3300025256 Bacteria 2473
259 Ga0209129_1000001 3300025258 Bacteria 1452436
260 Ga0209129_1000027 3300025258 Bacteria 409587
261 Ga0209565_1000009 3300025263 Bacteria 751701
262 Ga0209565_1001648 3300025263 Bacteria 9367
263 Ga0209565_1005823 3300025263 Bacteria 3537
264 Ga0209565_1017728 3300025263 Bacteria 1555
265 Ga0209455_1000031 3300025272 Bacteria 519952
266 Ga0209455_1000092 3300025272 Bacteria 220516
267 Ga0209673_1000019 3300025273 Bacteria 449094
268 Ga0209673_1005892 3300025273 Bacteria 6059
269 Ga0209130_1000143 3300025284 Bacteria 114072
270 Ga0209675_1000028 3300025291 Bacteria 281253
271 Ga0209675_1006223 3300025291 Bacteria 4833
272 Ga0209675_1018481 3300025291 Bacteria 1950
273 Ga0209025_1005287 3300025294 Bacteria 10605
274 Ga0209564_1000058 3300025295 Bacteria 332955
275 Ga0209564_1000139 3300025295 Bacteria 180328
276 Ga0209564_1000178 3300025295 Bacteria 151982
277 Ga0209758_1000052 3300025297 Bacteria 338962
278 Ga0209758_1000116 3300025297 Bacteria 198356
279 Ga0209758_1002821 3300025297 Bacteria 16907
280 Ga0209050_1000228 3300025298 Bacteria 123537
281 Ga0209050_1000271 3300025298 Bacteria 110802
282 Ga0209050_1002329 3300025298 Bacteria 16699
283 Ga0209050_1003009 3300025298 Bacteria 13085
284 Ga0209050_1014479 3300025298 Bacteria 3391
285 Ga0209256_1000030 3300025299 Bacteria 414828
286 Ga0209256_1000093 3300025299 Bacteria 209318
287 Ga0209256_1000177 3300025299 Bacteria 125603
288 Ga0209256_1000297 3300025299 Bacteria 86973
289 Ga0209256_1001157 3300025299 Bacteria 29830
290 Ga0209256_1002481 3300025299 Bacteria 14959
291 Ga0209256_1012712 3300025299 Bacteria 3190
292 Ga0209256_1056153 3300025299 Bacteria 933
293 Ga0209051_1000004 3300025303 Bacteria 1155596
294 Ga0209051_1000845 3300025303 Bacteria 31409
295 Ga0209051_1002272 3300025303 Bacteria 14079
296 Ga0209051_1002487 3300025303 Bacteria 13147
297 Ga0209051_1064372 3300025303 Bacteria 1136
298 Ga0209257_1000021 3300025304 Bacteria 771986
299 Ga0209257_1000347 3300025304 Bacteria 95122
300 Ga0209257_1000423 3300025304 Bacteria 81354
301 Ga0209257_1003909 3300025304 Bacteria 12125
302 Ga0207697_10005999 3300025315 Bacteria 5563
303 Ga0207682_10002371 3300025893 Bacteria 8480
304 Ga0207642_10000630 3300025899 Bacteria 10802
305 Ga0207642_10080456 3300025899 Bacteria 1580
306 Ga0207680_10070242 3300025903 Bacteria 2167
307 Ga0207645_10001065 3300025907 Bacteria 22694
308 Ga0207705_10037405 3300025909 Bacteria 3473
309 Ga0207705_10356187 3300025909 Bacteria 1128
310 Ga0207705_10362684 3300025909 Bacteria 1117
311 Ga0207705_10363767 3300025909 Bacteria 1116
312 Ga0207705_10398202 3300025909 Bacteria 1065
313 Ga0207705_10478678 3300025909 Bacteria 966
314 Ga0207684_10065282 3300025910 Bacteria 3090
315 Ga0207695_10010875 3300025913 Bacteria 11080
316 Ga0207695_10037384 3300025913 Bacteria 5238
317 Ga0207695_10088248 3300025913 Bacteria 3122
318 Ga0207695_10095759 3300025913 Bacteria 2971
319 Ga0207695_10109182 3300025913 Bacteria 2749
320 Ga0207671_10012208 3300025914 Bacteria 6927
321 Ga0207671_10012547 3300025914 Bacteria 6805
322 Ga0207671_10061608 3300025914 Bacteria 2784
323 Ga0207660_10303898 3300025917 Bacteria 1271
324 Ga0207662_10413945 3300025918 Bacteria 916
325 Ga0207657_10003079 3300025919 Bacteria 17838
326 Ga0207657_10024490 3300025919 Bacteria 5585
327 Ga0207657_10168314 3300025919 Bacteria 1777
328 Ga0207657_10181957 3300025919 Bacteria 1699
329 Ga0207652_10282471 3300025921 Bacteria 1497
330 Ga0207681_10034332 3300025923 Bacteria 3334
331 Ga0207681_10035725 3300025923 Bacteria 3276
332 Ga0207681_10040907 3300025923 Bacteria 3087
333 Ga0207694_10020846 3300025924 Bacteria 4962
334 Ga0207694_10112742 3300025924 Bacteria 2164
335 Ga0207694_10725086 3300025924 Bacteria 839
336 Ga0207650_10002045 3300025925 Bacteria 14115
337 Ga0207659_10000081 3300025926 Bacteria 58985
338 Ga0207687_10683519 3300025927 Bacteria 870
339 Ga0207644_10002484 3300025931 Bacteria 11874
340 Ga0207644_10104152 3300025931 Bacteria 2136
341 Ga0207644_10110673 3300025931 Bacteria 2076
342 Ga0207644_10172656 3300025931 Bacteria 1689
343 Ga0207690_10061464 3300025932 Bacteria 2554
344 Ga0207690_10064048 3300025932 Bacteria 2509
345 Ga0207690_10089746 3300025932 Bacteria 2168
346 Ga0207690_10369425 3300025932 Bacteria 1138
347 Ga0207706_10000573 3300025933 Bacteria 39137
348 Ga0207706_10001143 3300025933 Bacteria 27029
349 Ga0207686_10000819 3300025934 Bacteria 19016
350 Ga0207709_10024546 3300025935 Bacteria 3443
351 Ga0207709_10036379 3300025935 Bacteria 2917
352 Ga0207709_10076677 3300025935 Bacteria 2140
353 Ga0207709_10134166 3300025935 Bacteria 1692
354 Ga0207709_10870874 3300025935 Bacteria 731
355 Ga0207669_10011691 3300025937 Bacteria 4283
356 Ga0207669_10221304 3300025937 Bacteria 1389
357 Ga0207704_10028880 3300025938 Bacteria 3084
358 Ga0207704_10029777 3300025938 Bacteria 3050
359 Ga0207704_10175310 3300025938 Bacteria 1543
360 Ga0207704_10187161 3300025938 Bacteria 1502
361 Ga0207691_10000330 3300025940 Bacteria 47260
362 Ga0207691_10048904 3300025940 Bacteria 3875
363 Ga0207691_10116936 3300025940 Bacteria 2366
364 Ga0207691_10195782 3300025940 Bacteria 1761
365 Ga0207691_10297188 3300025940 Bacteria 1388
366 Ga0207691_10919888 3300025940 Bacteria 732
367 Ga0207711_10002273 3300025941 Bacteria 17244
368 Ga0207689_10001898 3300025942 Bacteria 19753
369 Ga0207689_10029679 3300025942 Bacteria 4564
370 Ga0207689_10687375 3300025942 Bacteria 863
371 Ga0207679_10177723 3300025945 Bacteria 1758
372 Ga0207667_10004373 3300025949 Bacteria 17299
373 Ga0207667_10358448 3300025949 Bacteria 1487
374 Ga0207651_10019150 3300025960 Bacteria 4093
375 Ga0207651_10152989 3300025960 Bacteria 1798
376 Ga0207651_10785426 3300025960 Bacteria 843
377 Ga0207712_10002233 3300025961 Bacteria 12603
378 Ga0207712_10036422 3300025961 Bacteria 3351
379 Ga0207712_10363097 3300025961 Bacteria 1207
380 Ga0207712_10628789 3300025961 Bacteria 931
381 Ga0207668_10197801 3300025972 Bacteria 1598
382 Ga0207640_10002317 3300025981 Bacteria 10231
383 Ga0207640_10161612 3300025981 Bacteria 1658
384 Ga0207703_10094321 3300026035 Bacteria 2523
385 Ga0207639_10032301 3300026041 Bacteria 3852
386 Ga0207639_10378033 3300026041 Bacteria 1271
387 Ga0207708_10119063 3300026075 Bacteria 2057
388 Ga0207708_10185253 3300026075 Bacteria 1654
389 Ga0207702_10000392 3300026078 Bacteria 49946
390 Ga0207702_10764720 3300026078 Bacteria 954
391 Ga0207648_10000837 3300026089 Bacteria 34674
392 Ga0207648_10000925 3300026089 Bacteria 33055
393 Ga0207648_10009629 3300026089 Bacteria 9240
394 Ga0207648_10069520 3300026089 Bacteria 3068
395 Ga0207676_10019848 3300026095 Bacteria 4909
396 Ga0207676_10040854 3300026095 Bacteria 3557
397 Ga0207674_10007715 3300026116 Bacteria 12523
398 Ga0207674_10093737 3300026116 Bacteria 2990
399 Ga0207675_100001504 3300026118 Bacteria 23354
400 Ga0207675_100026361 3300026118 Bacteria 5410
401 Ga0207675_100160311 3300026118 Bacteria 2145
402 Ga0207683_10082420 3300026121 Bacteria 2858
403 Ga0207683_10138720 3300026121 Bacteria 2190
404 Ga0207698_10119560 3300026142 Bacteria 2227
405 Ga0209281_1000084 3300027111 Bacteria 254215
406 Ga0209389_1004076 3300027296 Bacteria 12023
407 Ga0209970_1003044 3300027614 Bacteria 2825
408 Ga0209974_10031442 3300027876 Bacteria 1757
409 Ga0265354_1001675 3300028016 Bacteria 3072
410 Ga0265355_1006476 3300028036 Bacteria 916
411 Ga0268266_10725721 3300028379 Bacteria 958
412 Ga0268265_10024928 3300028380 Bacteria 4239
413 Ga0268265_10111076 3300028380 Bacteria 2238
414 Ga0268265_10402721 3300028380 Bacteria 1265
415 Ga0268264_10009151 3300028381 Bacteria 8210
416 Ga0268264_10155190 3300028381 Bacteria 2057
417 Ga0268264_10588861 3300028381 Bacteria 1095
418 Ga0265318_10002705 3300028577 Bacteria 9300
419 Ga0307517_10385540 3300028786 Bacteria 747
420 Ga0307515_10000020 3300028794 Bacteria 411735
421 Ga0307515_10000101 3300028794 Bacteria 199593
422 Ga0307515_10002116 3300028794 Bacteria 43530
423 Ga0307515_10002349 3300028794 Bacteria 41308
424 Ga0307515_10136546 3300028794 Bacteria 2662
425 Ga0307515_10145995 3300028794 Bacteria 2505
426 Ga0307511_10138460 3300030521 Bacteria 1440
427 Ga0265760_10000085 3300031090 Bacteria 23936
428 Ga0265332_10007049 3300031238 Bacteria 5089
429 Ga0265320_10032256 3300031240 Bacteria 2684
430 Ga0265320_10057468 3300031240 Bacteria 1866
431 Ga0265329_10025103 3300031242 Bacteria 1974
432 Ga0265331_10001855 3300031250 Bacteria 14921
433 Ga0265327_10000311 3300031251 Bacteria 93995
434 Ga0265327_10000746 3300031251 Bacteria 50605
435 Ga0265316_10132005 3300031344 Bacteria 1880
436 Ga0307513_10055948 3300031456 Bacteria 4217
437 Ga0307513_10271380 3300031456 Bacteria 1479
438 Ga0307509_10256664 3300031507 Bacteria 1527
439 Ga0307408_100000098 3300031548 Bacteria 95689
440 Ga0307408_100000099 3300031548 Bacteria 95526
441 Ga0307408_100005262 3300031548 Bacteria 8669
442 Ga0307408_100049249 3300031548 Bacteria 3025
443 Ga0307408_100049951 3300031548 Bacteria 3005
444 Ga0307408_100478010 3300031548 Bacteria 1086
445 Ga0307408_100558421 3300031548 Bacteria 1011
446 Ga0307408_100621489 3300031548 Bacteria 962
447 Ga0265314_10000947 3300031711 Bacteria 34148
448 Ga0307516_10000405 3300031730 Bacteria 56495
449 Ga0307516_10002516 3300031730 Bacteria 24408
450 Ga0307405_10238888 3300031731 Bacteria 1344
451 Ga0307405_10304352 3300031731 Bacteria 1211
452 Ga0307410_10036794 3300031852 Bacteria 3191
453 Ga0307410_10051824 3300031852 Bacteria 2768
454 Ga0307406_10010909 3300031901 Bacteria 5139
455 Ga0307406_10016612 3300031901 Bacteria 4282
456 Ga0307407_10356298 3300031903 Bacteria 1038
457 Ga0307412_10026971 3300031911 Bacteria 3577
458 Ga0307412_10032653 3300031911 Bacteria 3301
459 Ga0307409_100804370 3300031995 Bacteria 948
460 Ga0307416_100017128 3300032002 Bacteria 5058
461 Ga0307416_100030133 3300032002 Bacteria 4067
462 Ga0307416_100720995 3300032002 Bacteria 1088
463 Ga0307414_10028351 3300032004 Bacteria 3631
464 Ga0307411_10000301 3300032005 Bacteria 16473
465 Ga0307411_10021264 3300032005 Bacteria 3792
466 Ga0307411_10027072 3300032005 Bacteria 3463
467 Ga0307411_10083154 3300032005 Bacteria 2210
468 Ga0307411_10414543 3300032005 Bacteria 1117
469 Ga0307415_100065489 3300032126 Bacteria 2532
470 Ga0307510_10027809 3300033180 Bacteria 6469
471 Ga0307510_10171624 3300033180 Bacteria 1747
472 Ga0373959_0003495 3300034820 Bacteria 2505
473 Ga0373940_0007581 3300035088 Bacteria 2453
474 Ga0373944_0162151 3300035089 Bacteria 793
475 Ga0373951_0012083 3300035091 Bacteria 1942
476 Ga0373939_0000006 3300035114 Bacteria 78721
477 Ga0373939_0076758 3300035114 Bacteria 1101
478 Ga0373960_0001743 3300035121 Bacteria 4872
479 Ga0373946_0183911 3300035171 Bacteria 993
480 Ga0373962_0055727 3300035242 Bacteria 1149
481 Ga0373931_0000353 3300035691 Bacteria 18867
482 Ga0373935_0183497 3300035692 Bacteria 1438
483 Ga0373927_0021580 3300035695 Bacteria 4220
484 Ga0373925_0017082 3300037068 Bacteria 5253
485 Ga0373925_0035301 3300037068 Bacteria 3688
486 Ga0395899_0008516 3300037312 Bacteria 7898
487 Ga0395899_0172226 3300037312 Bacteria 1524
488 Ga0395900_0331778 3300037418 Bacteria 1499
489 Ga0395898_0220647 3300037466 Bacteria 1808
490 Ga0395898_0254895 3300037466 Bacteria 1673
491 Ga0395898_0403315 3300037466 Bacteria 1304
492 Ga0395905_0008204 3300037471 Bacteria 10315
493 Ga0395905_0023105 3300037471 Bacteria 5878
494 Ga0395905_0027487 3300037471 Bacteria 5365
495 Ga0395905_0073435 3300037471 Bacteria 3206
496 Ga0395905_0127109 3300037471 Bacteria 2397
497 Ga0395905_0146033 3300037471 Bacteria 2225
498 Ga0395901_0002301 3300038443 Bacteria 19466
499 Ga0395901_0115759 3300038443 Bacteria 2816
500 Ga0436361_0147565 3300039447 Bacteria 50932
501 Ga0436361_0237057 3300039447 Bacteria 1309
502 Ga0436361_0287447 3300039447 Bacteria 113524
503 Ga0436361_0601867 3300039447 Bacteria 31361
504 Ga0439436_0001618 3300041404 Bacteria 6553
505 Ga0439436_0002563 3300041404 Bacteria 5463
506 Ga0439436_0036358 3300041404 Bacteria 1421
507 Ga0439447_005664 3300041407 Bacteria 4136
508 Ga0439466_0063517 3300041411 Bacteria 1185
509 Ga0439465_0003102 3300041413 Bacteria 5436
510 Ga0439465_0117790 3300041413 Bacteria 929
511 Ga0451800_1277621 3300041459 Bacteria 1061
512 Ga0451853_3953217 3300041512 Bacteria 959
513 Ga0439445_0000407 3300042004 Bacteria 8691
514 Ga0439449_0002680 3300042007 Bacteria 6936
515 Ga0439455_0068922 3300042012 Bacteria 948
516 Ga0450917_004735 3300042120 Bacteria 1000
517 Ga0450923_000481 3300042125 Bacteria 4380
518 Ga0450888_001982 3300042126 Bacteria 1996
519 Ga0450890_034542 3300042127 Bacteria 730
520 Ga0450891_001521 3300042129 Bacteria 2387
521 Ga0450892_000421 3300042130 Bacteria 5020
522 Ga0450889_000380 3300042144 Bacteria 4930
523 Ga0450907_022205 3300042146 Bacteria 1069
524 Ga0439459_0012332 3300042438 Bacteria 1520
525 Ga0450918_000377 3300042531 Bacteria 9735
526 Ga0450918_003844 3300042531 Bacteria 2766
527 Ga0450893_0038466 3300042532 Bacteria 870
528 Ga0451577_0383272 3300042876 Bacteria 1276
529 Ga0451577_0555699 3300042876 Bacteria 1042
530 Ga0466964_0036245 3300044706 Bacteria 1977
531 Ga0466968_0061387 3300044735 Bacteria 1621
532 Ga0451576_0045972 3300045051 Bacteria 4597
533 Ga0466967_0342898 3300045976 Bacteria 1445
534 Ga0495592_0015786 3300046454 Bacteria 5730
535 Ga0495603_0008193 3300046455 Bacteria 6315
536 Ga0495590_0171762 3300046457 Bacteria 790
537 Ga0495629_0000941 3300046459 Bacteria 23400
538 Ga0495629_0003682 3300046459 Bacteria 11584
539 Ga0495638_0023738 3300046460 Bacteria 4006
540 Ga0495653_0000384 3300046463 Bacteria 35425
541 Ga0495653_0000511 3300046463 Bacteria 29855
542 Ga0495653_0051367 3300046463 Bacteria 3165
543 Ga0495650_0053283 3300046471 Bacteria 1657
544 Ga0495580_0000856 3300046472 Bacteria 26301
545 Ga0495580_0001319 3300046472 Bacteria 21881
546 Ga0495580_0372829 3300046472 Bacteria 965
547 Ga0495582_0000503 3300046473 Bacteria 21408
548 Ga0495664_0001241 3300046477 Bacteria 13343
549 Ga0495584_0005887 3300046491 Bacteria 6461
550 Ga0495596_0001182 3300046500 Bacteria 15270
551 Ga0495607_0010930 3300046501 Bacteria 6072
552 Ga0495607_0099440 3300046501 Bacteria 1560
553 Ga0495583_0000258 3300046506 Bacteria 87863
554 Ga0495606_0000101 3300046507 Bacteria 146752
555 Ga0495606_0000161 3300046507 Bacteria 117607
556 Ga0495606_0002471 3300046507 Bacteria 21403
557 Ga0495606_0011920 3300046507 Bacteria 7031
558 Ga0495606_0058610 3300046507 Bacteria 2474
559 Ga0495608_0004822 3300046511 Bacteria 9641
560 Ga0495610_0002012 3300046512 Bacteria 17381
561 Ga0495610_0025351 3300046512 Bacteria 3184
562 Ga0495610_0028675 3300046512 Bacteria 2940
563 Ga0495610_0146791 3300046512 Bacteria 1010
564 Ga0495616_0005117 3300046513 Bacteria 8147
565 Ga0495618_0001270 3300046514 Bacteria 17095
566 Ga0495628_0149979 3300046516 Bacteria 1776
567 Ga0495630_0024889 3300046517 Bacteria 4425
568 Ga0495632_0012258 3300046519 Bacteria 4949
569 Ga0495637_0000699 3300046520 Bacteria 23092
570 Ga0495643_0074698 3300046522 Bacteria 1775
571 Ga0495648_0012677 3300046524 Bacteria 6267
572 Ga0495648_0028518 3300046524 Bacteria 3717
573 Ga0495648_0047169 3300046524 Bacteria 2665
574 Ga0495648_0075085 3300046524 Bacteria 1945
575 Ga0495663_0100707 3300046525 Bacteria 951
576 Ga0495666_0000277 3300046526 Bacteria 22271
577 Ga0495666_0017842 3300046526 Bacteria 3535
578 Ga0495642_0191748 3300046528 Bacteria 890
579 Ga0495652_0015012 3300046529 Bacteria 6938
580 Ga0495652_0062951 3300046529 Bacteria 3125
581 Ga0495654_0000014 3300046530 Bacteria 312126
582 Ga0495654_0194394 3300046530 Bacteria 872
583 Ga0495640_0002781 3300046533 Bacteria 14073
584 Ga0495640_0019898 3300046533 Bacteria 4951
585 Ga0495586_0001730 3300046535 Bacteria 11912
586 Ga0495587_0000929 3300046536 Bacteria 19286
587 Ga0495587_0049911 3300046536 Bacteria 2476
588 Ga0495598_0003493 3300046537 Bacteria 3345
589 Ga0495609_0001696 3300046538 Bacteria 14298
590 Ga0495621_0020833 3300046539 Bacteria 2155
591 Ga0495597_0000172 3300046542 Bacteria 57536
592 Ga0495597_0011037 3300046542 Bacteria 4391
593 Ga0495597_0053754 3300046542 Bacteria 1770
594 Ga0495645_0008320 3300046543 Bacteria 7240
595 Ga0495645_0136815 3300046543 Bacteria 1713
596 Ga0495633_0005718 3300046558 Bacteria 7515
597 Ga0495633_0012243 3300046558 Bacteria 4574
598 Ga0495633_0021952 3300046558 Bacteria 3185
599 Ga0495667_0202054 3300046559 Bacteria 1272
600 Ga0495668_0000684 3300046616 Bacteria 40835
601 Ga0495668_0006025 3300046616 Bacteria 8041
602 Ga0495634_0004651 3300046642 Bacteria 10689
603 Ga0495634_0018150 3300046642 Bacteria 5012
604 Ga0495611_0340235 3300046648 Bacteria 689
605 Ga0495625_0015168 3300046660 Bacteria 6115
606 Ga0495635_0004874 3300046663 Bacteria 9340
607 Ga0495635_0036315 3300046663 Bacteria 3416
608 Ga0495659_0003984 3300046664 Bacteria 4675
609 Ga0495661_0013760 3300046665 Bacteria 5428
610 Ga0495661_0022967 3300046665 Bacteria 4054
611 Ga0495661_0034543 3300046665 Bacteria 3181
612 Ga0495661_0035672 3300046665 Bacteria 3118
613 Ga0495588_0119838 3300046674 Bacteria 1387
614 Ga0495599_0001289 3300046678 Bacteria 14231
615 Ga0495599_0198320 3300046678 Bacteria 1233
616 Ga0495623_0014147 3300046679 Bacteria 5168
617 Ga0495623_0073646 3300046679 Bacteria 2123
618 Ga0495646_0005054 3300046680 Bacteria 8316
619 Ga0495646_0012497 3300046680 Bacteria 5397
620 Ga0495669_0000453 3300046684 Bacteria 19290
621 Ga0495669_0029841 3300046684 Bacteria 2393
622 Ga0495613_0015748 3300046689 Bacteria 5628
623 Ga0495624_0002063 3300046690 Bacteria 15308
624 Ga0495624_0067058 3300046690 Bacteria 2239
625 Ga0495649_0001048 3300046694 Bacteria 21684
626 Ga0495649_0006112 3300046694 Bacteria 7526
627 Ga0495649_0008449 3300046694 Bacteria 6194
628 Ga0495649_0011217 3300046694 Bacteria 5267
629 Ga0495589_0011552 3300046794 Bacteria 4584
630 Ga0495589_0107721 3300046794 Bacteria 1346
631 Ga0495600_0071877 3300046809 Bacteria 2260
632 Ga0495660_0022202 3300046810 Bacteria 3626
633 Ga0495660_0117143 3300046810 Bacteria 1352
634 Ga0495660_0206962 3300046810 Bacteria 933
635 Ga0495581_0000088 3300047315 Bacteria 37592
636 Ga0495604_0010429 3300047317 Bacteria 7361
637 Ga0495604_0033888 3300047317 Bacteria 4041
638 Ga0495636_0004548 3300047318 Bacteria 5434
639 Ga0495674_0021023 3300047319 Bacteria 6038
640 Ga0495674_0043522 3300047319 Bacteria 3996
641 Ga0495674_0047875 3300047319 Bacteria 3787
642 Ga0495672_0000400 3300047320 Bacteria 52696
643 Ga0495676_0023216 3300047321 Bacteria 5386
644 Ga0495676_0079930 3300047321 Bacteria 2484
645 Ga0495676_0094469 3300047321 Bacteria 2227
646 Ga0495680_0015198 3300047322 Bacteria 6647
647 Ga0495680_0401871 3300047322 Bacteria 946
648 Ga0495683_0045692 3300047323 Bacteria 2200
649 Ga0495687_000128 3300047443 Bacteria 116626
650 Ga0495687_001059 3300047443 Bacteria 27223
651 Ga0495687_003727 3300047443 Bacteria 10810
652 Ga0495677_0006066 3300047445 Bacteria 4569
653 Ga0495677_0021727 3300047445 Bacteria 2326
654 Ga0495679_000374 3300047446 Bacteria 34258
655 Ga0495679_000724 3300047446 Bacteria 21200
656 Ga0495679_013957 3300047446 Bacteria 2995
657 Ga0495673_0040614 3300047469 Bacteria 2100
658 Ga0495681_0010735 3300047470 Bacteria 5520
659 Ga0495686_0001150 3300047472 Bacteria 31074
660 Ga0495686_0004786 3300047472 Bacteria 10936
661 Ga0495686_0008011 3300047472 Bacteria 7832
662 Ga0495686_0010321 3300047472 Bacteria 6651
663 Ga0495593_0000523 3300047673 Bacteria 21761
664 Ga0495593_0003554 3300047673 Bacteria 9325
665 Ga0495602_0018152 3300048088 Bacteria 7036
666 Ga0495602_0100904 3300048088 Bacteria 2368
667 Ga0495614_0001008 3300048089 Bacteria 12020
668 Ga0495614_0019842 3300048089 Bacteria 2908
669 Ga0495626_0094944 3300048091 Bacteria 1307
670 Ga0496100_0489473 3300048903 Bacteria 947
671 Ga0496102_0008917 3300048905 Bacteria 8606
672 Ga0496102_0541693 3300048905 Bacteria 1087
673 Ga0496108_0068954 3300048911 Bacteria 2984
674 Ga0496109_0135001 3300048912 Bacteria 2305
675 Ga0496114_0116017 3300048917 Bacteria 2298
676 Ga0496117_0166489 3300048920 Bacteria 1285
677 Ga0496121_0001461 3300048924 Bacteria 39903
678 Ga0496121_0002415 3300048924 Bacteria 28634
679 Ga0496122_0346328 3300048925 Bacteria 778
680 Ga0496123_0022900 3300048926 Bacteria 4798
681 Ga0496124_0000504 3300048927 Bacteria 67117
682 Ga0496124_0052327 3300048927 Bacteria 3469
683 Ga0496126_0167233 3300048929 Bacteria 1876
684 Ga0496126_0283081 3300048929 Bacteria 1373
685 Ga0501308_004493 3300049128 Bacteria 1347
686 Ga0501304_007572 3300049160 Bacteria 899
687 Ga0495678_039510 3300049459 Bacteria 1903
688 Ga0501298_017759 3300049521 Bacteria 1301
689 Ga0501047_0077908 3300049581 Bacteria 3188
690 Ga0501074_0043068 3300049590 Bacteria 3267
691 Ga0501201_003743 3300049651 Bacteria 1401
692 Ga0501211_000888 3300049658 Bacteria 3132
693 Ga0501222_004907 3300049662 Bacteria 1816
694 Ga0501222_013028 3300049662 Bacteria 1095
695 Ga0501235_021459 3300049669 Bacteria 1436
696 Ga0501235_089692 3300049669 Bacteria 741
697 Ga0501249_029641 3300049679 Bacteria 1217
698 Ga0501225_0019671 3300049705 Bacteria 1868
699 Ga0501229_004772 3300049706 Bacteria 1650
700 Ga0501080_0018366 3300049742 Bacteria 6473
701 Ga0501083_0037769 3300049744 Bacteria 3287
702 nmdc:mga0k408_10040_c1 3300050493 Bacteria 5113
703 nmdc:mga0k408_125019_c1 3300050493 Bacteria 1525
704 nmdc:mga0k408_134465_c1 3300050493 Bacteria 1469
705 nmdc:mga0k408_211940_c1 3300050493 Bacteria 1157
706 nmdc:mga0k408_35348_c1 3300050493 Bacteria 2866
707 nmdc:mga07m45_1126_c1 3300050496 Bacteria 11984
708 nmdc:mga07m45_1728_c1 3300050496 Bacteria 10066
709 nmdc:mga07m45_29149_c1 3300050496 Bacteria 3050
710 nmdc:mga07m45_49721_c1 3300050496 Bacteria 2361
711 nmdc:mga07m45_8512_c1 3300050496 Bacteria 5278
712 nmdc:mga06r32_180618_c1 3300050510 Bacteria 2096
713 nmdc:mga06r32_21694_c1 3300050510 Bacteria 5931
714 nmdc:mga08y16_79385_c1 3300050511 Bacteria 3420
715 Ga0500578_0059104 3300053086 Bacteria 2450
716 Ga0500644_0002846 3300053088 Bacteria 4299
717 Ga0500644_0009670 3300053088 Bacteria 2587
718 Ga0500651_0078727 3300053093 Bacteria 2044
719 Ga0500562_004854 3300053108 Bacteria 3386
720 Ga0500594_0002404 3300053118 Bacteria 4076
721 Ga0500618_000088 3300053125 Bacteria 74892
722 Ga0500658_0009111 3300053134 Bacteria 3664
723 Ga0500559_0000116 3300053136 Bacteria 63080
724 Ga0500586_002812 3300053145 Bacteria 4004
725 Ga0500622_0007450 3300053156 Bacteria 6216
726 Ga0500636_0138371 3300053177 Bacteria 1350
727 Ga0500645_002844 3300053730 Bacteria 7448
728 Ga0587084_018055 3300059477 Bacteria 1025
729 Ga0587066_019879 3300059490 Bacteria 1097
730 Ga0587066_020499 3300059490 Bacteria 1087
731 Ga0587070_002891 3300059491 Bacteria 2004
732 Ga0587070_012877 3300059491 Bacteria 1280
733 Ga0587073_0061179 3300059492 Bacteria 883
734 Ga0587077_004383 3300059493 Bacteria 1851
735 Ga0587082_023797 3300059504 Bacteria 1018
736 Ga0587083_0039397 3300059505 Bacteria 982
737 Ga0587085_039329 3300059506 Bacteria 817
738 Ga0587086_003813 3300059507 Bacteria 1541
739 Ga0587088_033941 3300059508 Bacteria 928
740 Ga0587089_015701 3300059509 Bacteria 1002
741 Ga0587090_007350 3300059510 Bacteria 1444
742 Ga0587090_010781 3300059510 Bacteria 1273
743 Ga0587091_005471 3300059511 Bacteria 1732
744 Ga0587092_003332 3300059512 Bacteria 1817
745 Ga0587092_003665 3300059512 Bacteria 1768
746 Ga0587106_017599 3300059605 Bacteria 1024
747 Ga0587109_042119 3300059624 Bacteria 909
748 Ga0587062_000926 3300059639 Bacteria 2310
749 Ga0587068_003167 3300059641 Bacteria 2074
750 Ga0587072_007303 3300059643 Bacteria 1714
751 Ga0587072_028833 3300059643 Bacteria 1026
752 Ga0587075_022753 3300059644 Bacteria 944
753 Ga0587076_005159 3300059645 Bacteria 1676
754 Ga0587078_015160 3300059646 Bacteria 927
755 Ga0587078_019490 3300059646 Bacteria 847
756 Ga0587079_034545 3300059647 Bacteria 990
757 Ga0587108_010658 3300059653 Bacteria 774
758 Ga0587124_007228 3300059660 Bacteria 931
759 Ga0587071_046836 3300060344 Bacteria 883
760 Ga0587111_0003486 3300060346 Bacteria 2241

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300020077 Ga0206351_10127825 Ga0206351_101278251 209
2 3300020080 Ga0206350_11556907 Ga0206350_115569071 209
3 iso_pu_bacteria 2510065045 2510248451 214
4 iso_pu_bacteria 2512047030 2512349548 214
5 iso_pu_bacteria 2515154122 2515684261 214
6 iso_pu_bacteria 2643221544 2643746368 214
7 iso_pu_bacteria 2643221585 2643933154 214
8 iso_pu_bacteria 2643221592 2643969464 214
9 iso_pu_bacteria 2643221625 2644143764 214
10 iso_pu_bacteria 2643221639 2644217299 214
11 iso_pu_bacteria 2643221644 2644245722 214
12 iso_pu_bacteria 2643221648 2644276530 214
13 iso_pu_bacteria 2643221656 2644314403 214
14 iso_pu_bacteria 2718217991 2719643122 214
15 iso_pu_bacteria 2842733646 2842733873 214
16 iso_pu_bacteria 2857564685 2857569722 214
17 iso_pu_bacteria 2885192300 2885193399 214
18 iso_pu_bacteria 2885270888 2885273507 214
19 iso_pu_bacteria 2886848708 2886854090 214
20 iso_pu_bacteria 2902682994 2902687509 214
21 3300005327 Ga0070658_10072234 Ga0070658_100722343 216
22 3300005339 Ga0070660_100018170 Ga0070660_1000181702 216
23 3300005366 Ga0070659_100053173 Ga0070659_1000531732 216
24 3300005548 Ga0070665_100059416 Ga0070665_1000594162 216
25 3300005563 Ga0068855_100590336 Ga0068855_1005903362 216
26 3300006846 Ga0075430_100085982 Ga0075430_1000859823 216
27 3300013105 Ga0157369_10477878 Ga0157369_104778782 216
28 3300013296 Ga0157374_10021548 Ga0157374_100215482 216
29 3300025909 Ga0207705_10037405 Ga0207705_100374052 216
30 3300025919 Ga0207657_10003079 Ga0207657_100030798 216
31 3300025932 Ga0207690_10061464 Ga0207690_100614642 216
32 3300037312 Ga0395899_0172226 Ga0395899_0172226_387_1046 216
33 3300037471 Ga0395905_0127109 Ga0395905_0127109_1335_1994 216
34 3300038443 Ga0395901_0115759 Ga0395901_0115759_1702_2361 216
35 3300041459 Ga0451800_1277621 Ga0451800_1277621_204_884 216
36 3300050510 nmdc:mga06r32_180618_c1 nmdc:mga06r32_180618_c1_1156_1809 216
37 3300005295 Ga0065707_10003061 Ga0065707_100030618 217
38 3300005327 Ga0070658_10670810 Ga0070658_106708101 217
39 3300005334 Ga0068869_100048099 Ga0068869_1000480992 217
40 3300005334 Ga0068869_100175546 Ga0068869_1001755462 217
41 3300005336 Ga0070680_100056543 Ga0070680_1000565435 217
42 3300005338 Ga0068868_100143840 Ga0068868_1001438402 217
43 3300005355 Ga0070671_100039005 Ga0070671_1000390053 217
44 3300005364 Ga0070673_100629416 Ga0070673_1006294161 217
45 3300005366 Ga0070659_100018413 Ga0070659_1000184132 217
46 3300005366 Ga0070659_100080967 Ga0070659_1000809672 217
47 3300005457 Ga0070662_100019823 Ga0070662_1000198232 217
48 3300005458 Ga0070681_10198329 Ga0070681_101983292 217
49 3300005577 Ga0068857_100075039 Ga0068857_1000750393 217
50 3300005618 Ga0068864_100001546 Ga0068864_1000015466 217
51 3300005841 Ga0068863_100158772 Ga0068863_1001587723 217
52 3300006051 Ga0075364_10137789 Ga0075364_101377892 217
53 3300006178 Ga0075367_10010462 Ga0075367_100104625 217
54 3300006195 Ga0075366_10030492 Ga0075366_100304922 217
55 3300006353 Ga0075370_10026890 Ga0075370_100268902 217
56 3300006353 Ga0075370_10027005 Ga0075370_100270052 217
57 3300006847 Ga0075431_100002911 Ga0075431_1000029116 217
58 3300007788 Ga0099795_10159958 Ga0099795_101599581 217
59 3300009545 Ga0105237_10031465 Ga0105237_100314655 217
60 3300010375 Ga0105239_10021943 Ga0105239_100219434 217
61 3300010375 Ga0105239_10025127 Ga0105239_100251273 217
62 3300010375 Ga0105239_11135333 Ga0105239_111353331 217
63 3300013100 Ga0157373_10030622 Ga0157373_100306223 217
64 3300013100 Ga0157373_10170000 Ga0157373_101700002 217
65 3300013297 Ga0157378_10568832 Ga0157378_105688321 217
66 3300013308 Ga0157375_10192986 Ga0157375_101929863 217
67 3300025909 Ga0207705_10356187 Ga0207705_103561872 217
68 3300025909 Ga0207705_10363767 Ga0207705_103637671 217
69 3300025909 Ga0207705_10398202 Ga0207705_103982022 217
70 3300025910 Ga0207684_10065282 Ga0207684_100652823 217
71 3300025914 Ga0207671_10012547 Ga0207671_100125475 217
72 3300025917 Ga0207660_10303898 Ga0207660_103038982 217
73 3300025919 Ga0207657_10168314 Ga0207657_101683142 217
74 3300025931 Ga0207644_10110673 Ga0207644_101106732 217
75 3300025932 Ga0207690_10064048 Ga0207690_100640482 217
76 3300025932 Ga0207690_10089746 Ga0207690_100897462 217
77 3300025933 Ga0207706_10001143 Ga0207706_1000114317 217
78 3300025942 Ga0207689_10029679 Ga0207689_100296792 217
79 3300025942 Ga0207689_10687375 Ga0207689_106873751 217
80 3300025960 Ga0207651_10785426 Ga0207651_107854261 217
81 3300025961 Ga0207712_10628789 Ga0207712_106287892 217
82 3300026078 Ga0207702_10764720 Ga0207702_107647201 217
83 3300026089 Ga0207648_10069520 Ga0207648_100695201 217
84 3300026095 Ga0207676_10019848 Ga0207676_100198483 217
85 3300027876 Ga0209974_10031442 Ga0209974_100314422 217
86 3300028381 Ga0268264_10155190 Ga0268264_101551903 217
87 3300028786 Ga0307517_10385540 Ga0307517_103855401 217
88 3300031456 Ga0307513_10271380 Ga0307513_102713802 217
89 3300031548 Ga0307408_100558421 Ga0307408_1005584212 217
90 3300031901 Ga0307406_10016612 Ga0307406_100166122 217
91 3300033180 Ga0307510_10027809 Ga0307510_100278092 217
92 3300033180 Ga0307510_10171624 Ga0307510_101716242 217
93 3300035089 Ga0373944_0162151 Ga0373944_0162151_62_715 217
94 3300035114 Ga0373939_0076758 Ga0373939_0076758_278_931 217
95 3300035171 Ga0373946_0183911 Ga0373946_0183911_173_826 217
96 3300035695 Ga0373927_0021580 Ga0373927_0021580_1629_2282 217
97 3300037068 Ga0373925_0017082 Ga0373925_0017082_2819_3472 217
98 3300037312 Ga0395899_0008516 Ga0395899_0008516_564_1265 217
99 3300037418 Ga0395900_0331778 Ga0395900_0331778_609_1310 217
100 3300037466 Ga0395898_0220647 Ga0395898_0220647_908_1609 217
101 3300037466 Ga0395898_0254895 Ga0395898_0254895_334_996 217
102 3300037471 Ga0395905_0023105 Ga0395905_0023105_2422_3108 217
103 3300037471 Ga0395905_0146033 Ga0395905_0146033_1263_1925 217
104 3300042012 Ga0439455_0068922 Ga0439455_0068922_28_681 217
105 3300044706 Ga0466964_0036245 Ga0466964_0036245_1050_1754 217
106 3300045976 Ga0466967_0342898 Ga0466967_0342898_380_1084 217
107 3300046512 Ga0495610_0025351 Ga0495610_0025351_1022_1678 217
108 3300046512 Ga0495610_0146791 Ga0495610_0146791_168_821 217
109 3300046519 Ga0495632_0012258 Ga0495632_0012258_2528_3196 217
110 3300046524 Ga0495648_0047169 Ga0495648_0047169_346_999 217
111 3300046530 Ga0495654_0194394 Ga0495654_0194394_144_797 217
112 3300046542 Ga0495597_0011037 Ga0495597_0011037_2789_3445 217
113 3300046542 Ga0495597_0053754 Ga0495597_0053754_435_1088 217
114 3300046648 Ga0495611_0340235 Ga0495611_0340235_21_677 217
115 3300046660 Ga0495625_0015168 Ga0495625_0015168_4406_5059 217
116 3300046694 Ga0495649_0001048 Ga0495649_0001048_4909_5565 217
117 3300046694 Ga0495649_0006112 Ga0495649_0006112_3116_3769 217
118 3300046794 Ga0495589_0107721 Ga0495589_0107721_632_1300 217
119 3300046810 Ga0495660_0117143 Ga0495660_0117143_337_990 217
120 3300047443 Ga0495687_000128 Ga0495687_000128_18264_18920 217
121 3300047443 Ga0495687_001059 Ga0495687_001059_3662_4315 217
122 3300047443 Ga0495687_003727 Ga0495687_003727_1257_1910 217
123 3300047472 Ga0495686_0001150 Ga0495686_0001150_3363_4016 217
124 3300048091 Ga0495626_0094944 Ga0495626_0094944_174_827 217
125 3300049581 Ga0501047_0077908 Ga0501047_0077908_2296_2955 217
126 3300049669 Ga0501235_089692 Ga0501235_089692_43_726 217
127 3300049679 Ga0501249_029641 Ga0501249_029641_125_808 217
128 3300049705 Ga0501225_0019671 Ga0501225_0019671_79_762 217
129 3300049744 Ga0501083_0037769 Ga0501083_0037769_1700_2353 217
130 3300050493 nmdc:mga0k408_125019_c1 nmdc:mga0k408_125019_c1_444_1097 217
131 3300050496 nmdc:mga07m45_1728_c1 nmdc:mga07m45_1728_c1_651_1304 217
132 3300050496 nmdc:mga07m45_29149_c1 nmdc:mga07m45_29149_c1_1229_1882 217
133 3300050496 nmdc:mga07m45_49721_c1 nmdc:mga07m45_49721_c1_1405_2058 217
134 3300050510 nmdc:mga06r32_21694_c1 nmdc:mga06r32_21694_c1_2011_2667 217
135 3300053086 Ga0500578_0059104 Ga0500578_0059104_1370_2026 217
136 3300053093 Ga0500651_0078727 Ga0500651_0078727_743_1399 217
137 3300053118 Ga0500594_0002404 Ga0500594_0002404_922_1575 217
138 3300053134 Ga0500658_0009111 Ga0500658_0009111_2436_3089 217
139 3300053136 Ga0500559_0000116 Ga0500559_0000116_29568_30221 217
140 3300053156 Ga0500622_0007450 Ga0500622_0007450_2655_3308 217
141 3300053177 Ga0500636_0138371 Ga0500636_0138371_667_1320 217
142 3300053730 Ga0500645_002844 Ga0500645_002844_838_1494 217
143 3300059490 Ga0587066_019879 Ga0587066_019879_157_858 217
144 3300059490 Ga0587066_020499 Ga0587066_020499_269_973 217
145 3300059491 Ga0587070_012877 Ga0587070_012877_308_1012 217
146 3300059510 Ga0587090_007350 Ga0587090_007350_394_1095 217
147 3300059605 Ga0587106_017599 Ga0587106_017599_146_850 217
148 3300059644 Ga0587075_022753 Ga0587075_022753_167_868 217
149 3300059646 Ga0587078_015160 Ga0587078_015160_103_804 217
150 3300002705 JGI25156J39149_1000411 JGI25156J39149_100041117 218
151 3300002705 JGI25156J39149_1014030 JGI25156J39149_10140302 218
152 3300002738 JGI25154J39366_1003427 JGI25154J39366_10034272 218
153 3300002741 JGI25157J39369_1000052 JGI25157J39369_100005281 218
154 3300002772 JGI25164J39214_1005845 JGI25164J39214_10058452 218
155 3300002773 JGI25152J39213_1000446 JGI25152J39213_100044611 218
156 3300002773 JGI25152J39213_1001630 JGI25152J39213_10016308 218
157 3300002774 JGI25150J39212_1002460 JGI25150J39212_10024602 218
158 3300002774 JGI25150J39212_1006219 JGI25150J39212_10062193 218
159 3300002774 JGI25150J39212_1007122 JGI25150J39212_10071221 218
160 3300002774 JGI25150J39212_1025271 JGI25150J39212_10252711 218
161 3300002987 JGI25159J45721_1002937 JGI25159J45721_10029378 218
162 3300003215 JGI25153J46596_10000279 JGI25153J46596_1000027919 218
163 3300003752 Ga0055539_1000234 Ga0055539_100023429 218
164 3300003752 Ga0055539_1001493 Ga0055539_10014934 218
165 3300003756 Ga0055533_1000053 Ga0055533_1000053109 218
166 3300003759 Ga0055525_1000013 Ga0055525_1000013386 218
167 3300003759 Ga0055525_1001043 Ga0055525_10010433 218
168 3300003761 Ga0055535_1000727 Ga0055535_100072715 218
169 3300003763 Ga0055529_1000015 Ga0055529_1000015166 218
170 3300003763 Ga0055529_1000653 Ga0055529_100065310 218
171 3300003771 Ga0055526_1000280 Ga0055526_100028038 218
172 3300003771 Ga0055526_1002177 Ga0055526_100217713 218
173 3300003771 Ga0055526_1005508 Ga0055526_10055083 218
174 3300003773 Ga0055537_1000143 Ga0055537_10001435 218
175 3300003773 Ga0055537_1001454 Ga0055537_10014542 218
176 3300003775 Ga0055524_1000061 Ga0055524_100006139 218
177 3300003775 Ga0055524_1000157 Ga0055524_100015734 218
178 3300003775 Ga0055524_1003621 Ga0055524_10036217 218
179 3300003775 Ga0055524_1005836 Ga0055524_10058362 218
180 3300003775 Ga0055524_1006771 Ga0055524_10067715 218
181 3300003775 Ga0055524_1011138 Ga0055524_10111384 218
182 3300003784 Ga0055534_1000308 Ga0055534_100030828 218
183 3300003784 Ga0055534_1000712 Ga0055534_100071212 218
184 3300003790 Ga0055528_1000430 Ga0055528_100043010 218
185 3300003791 Ga0055530_10000524 Ga0055530_1000052418 218
186 3300003791 Ga0055530_10000645 Ga0055530_1000064526 218
187 3300003792 Ga0055540_1000026 Ga0055540_10000263 218
188 3300003794 Ga0055531_10001224 Ga0055531_100012243 218
189 3300003794 Ga0055531_10003738 Ga0055531_100037384 218
190 3300003794 Ga0055531_10009114 Ga0055531_100091143 218
191 3300004625 Ga0055543_1001250 Ga0055543_10012508 218
192 3300004625 Ga0055543_1010209 Ga0055543_10102092 218
193 3300005262 Ga0065165_1000241 Ga0065165_100024184 218
194 3300005262 Ga0065165_1000268 Ga0065165_100026849 218
195 3300005262 Ga0065165_1000498 Ga0065165_100049848 218
196 3300005290 Ga0065712_10350414 Ga0065712_103504141 218
197 3300005295 Ga0065707_10032055 Ga0065707_100320551 218
198 3300005327 Ga0070658_10256953 Ga0070658_102569532 218
199 3300005327 Ga0070658_10299480 Ga0070658_102994802 218
200 3300005327 Ga0070658_10673660 Ga0070658_106736602 218
201 3300005328 Ga0070676_10039630 Ga0070676_100396302 218
202 3300005328 Ga0070676_10061249 Ga0070676_100612492 218
203 3300005330 Ga0070690_100023202 Ga0070690_1000232023 218
204 3300005330 Ga0070690_100265886 Ga0070690_1002658862 218
205 3300005331 Ga0070670_100003146 Ga0070670_10000314611 218
206 3300005331 Ga0070670_100603262 Ga0070670_1006032622 218
207 3300005334 Ga0068869_100002141 Ga0068869_1000021418 218
208 3300005336 Ga0070680_100173735 Ga0070680_1001737352 218
209 3300005337 Ga0070682_100034077 Ga0070682_1000340772 218
210 3300005339 Ga0070660_100187089 Ga0070660_1001870892 218
211 3300005341 Ga0070691_10155511 Ga0070691_101555111 218
212 3300005343 Ga0070687_100392502 Ga0070687_1003925022 218
213 3300005347 Ga0070668_100048017 Ga0070668_1000480173 218
214 3300005353 Ga0070669_100005491 Ga0070669_1000054913 218
215 3300005353 Ga0070669_100087500 Ga0070669_1000875002 218
216 3300005353 Ga0070669_100165396 Ga0070669_1001653962 218
217 3300005353 Ga0070669_100219175 Ga0070669_1002191752 218
218 3300005354 Ga0070675_100000072 Ga0070675_10000007233 218
219 3300005354 Ga0070675_100061753 Ga0070675_1000617531 218
220 3300005355 Ga0070671_100055959 Ga0070671_1000559594 218
221 3300005355 Ga0070671_100245284 Ga0070671_1002452842 218
222 3300005356 Ga0070674_100010657 Ga0070674_1000106572 218
223 3300005356 Ga0070674_100054836 Ga0070674_1000548362 218
224 3300005356 Ga0070674_100135474 Ga0070674_1001354742 218
225 3300005364 Ga0070673_100000785 Ga0070673_1000007853 218
226 3300005364 Ga0070673_100213740 Ga0070673_1002137402 218
227 3300005365 Ga0070688_100259659 Ga0070688_1002596592 218
228 3300005367 Ga0070667_100108890 Ga0070667_1001088902 218
229 3300005435 Ga0070714_100065790 Ga0070714_1000657901 218
230 3300005438 Ga0070701_10040182 Ga0070701_100401823 218
231 3300005438 Ga0070701_10300472 Ga0070701_103004721 218
232 3300005456 Ga0070678_100018675 Ga0070678_1000186755 218
233 3300005456 Ga0070678_100066923 Ga0070678_1000669233 218
234 3300005456 Ga0070678_100130258 Ga0070678_1001302581 218
235 3300005456 Ga0070678_100309326 Ga0070678_1003093261 218
236 3300005457 Ga0070662_100081326 Ga0070662_1000813262 218
237 3300005458 Ga0070681_10766076 Ga0070681_107660761 218
238 3300005459 Ga0068867_100003414 Ga0068867_1000034148 218
239 3300005459 Ga0068867_100004430 Ga0068867_1000044303 218
240 3300005459 Ga0068867_100006335 Ga0068867_1000063355 218
241 3300005459 Ga0068867_100088266 Ga0068867_1000882662 218
242 3300005459 Ga0068867_100172756 Ga0068867_1001727562 218
243 3300005518 Ga0070699_100022397 Ga0070699_1000223972 218
244 3300005530 Ga0070679_100035375 Ga0070679_1000353754 218
245 3300005535 Ga0070684_100158031 Ga0070684_1001580312 218
246 3300005536 Ga0070697_100687163 Ga0070697_1006871631 218
247 3300005539 Ga0068853_100090736 Ga0068853_1000907363 218
248 3300005539 Ga0068853_100562867 Ga0068853_1005628671 218
249 3300005543 Ga0070672_100000977 Ga0070672_1000009778 218
250 3300005543 Ga0070672_100221642 Ga0070672_1002216423 218
251 3300005543 Ga0070672_100237621 Ga0070672_1002376212 218
252 3300005543 Ga0070672_100764405 Ga0070672_1007644051 218
253 3300005544 Ga0070686_100033563 Ga0070686_1000335631 218
254 3300005545 Ga0070695_100187004 Ga0070695_1001870042 218
255 3300005547 Ga0070693_100047005 Ga0070693_1000470053 218
256 3300005548 Ga0070665_100292191 Ga0070665_1002921912 218
257 3300005563 Ga0068855_100007935 Ga0068855_1000079358 218
258 3300005563 Ga0068855_100029432 Ga0068855_1000294321 218
259 3300005564 Ga0070664_100205710 Ga0070664_1002057101 218
260 3300005577 Ga0068857_100001467 Ga0068857_10000146714 218
261 3300005578 Ga0068854_100021390 Ga0068854_1000213902 218
262 3300005578 Ga0068854_100163393 Ga0068854_1001633932 218
263 3300005614 Ga0068856_100007649 Ga0068856_1000076496 218
264 3300005615 Ga0070702_100307034 Ga0070702_1003070341 218
265 3300005616 Ga0068852_100362082 Ga0068852_1003620821 218
266 3300005616 Ga0068852_100790507 Ga0068852_1007905072 218
267 3300005617 Ga0068859_100091484 Ga0068859_1000914843 218
268 3300005718 Ga0068866_10000430 Ga0068866_100004303 218
269 3300005718 Ga0068866_10021411 Ga0068866_100214112 218
270 3300005719 Ga0068861_100003155 Ga0068861_10000315512 218
271 3300005719 Ga0068861_100523520 Ga0068861_1005235201 218
272 3300005842 Ga0068858_100086090 Ga0068858_1000860903 218
273 3300005843 Ga0068860_100002904 Ga0068860_1000029044 218
274 3300005843 Ga0068860_100102547 Ga0068860_1001025472 218
275 3300005843 Ga0068860_100204943 Ga0068860_1002049431 218
276 3300005844 Ga0068862_100018548 Ga0068862_1000185481 218
277 3300005844 Ga0068862_100344778 Ga0068862_1003447782 218
278 3300006177 Ga0075362_10002903 Ga0075362_100029034 218
279 3300006195 Ga0075366_10001896 Ga0075366_100018966 218
280 3300006195 Ga0075366_10004969 Ga0075366_100049692 218
281 3300006195 Ga0075366_10005657 Ga0075366_100056572 218
282 3300006195 Ga0075366_10011710 Ga0075366_100117106 218
283 3300006195 Ga0075366_10034154 Ga0075366_100341543 218
284 3300006195 Ga0075366_10034881 Ga0075366_100348813 218
285 3300006237 Ga0097621_100302867 Ga0097621_1003028671 218
286 3300006237 Ga0097621_100343135 Ga0097621_1003431352 218
287 3300006353 Ga0075370_10000577 Ga0075370_1000057713 218
288 3300006353 Ga0075370_10002114 Ga0075370_100021147 218
289 3300006358 Ga0068871_100175685 Ga0068871_1001756852 218
290 3300006358 Ga0068871_100665355 Ga0068871_1006653552 218
291 3300006881 Ga0068865_100390618 Ga0068865_1003906182 218
292 3300006931 Ga0097620_100091482 Ga0097620_1000914822 218
293 3300006942 Ga0099824_1035904 Ga0099824_10359042 218
294 3300006944 Ga0099823_1000009 Ga0099823_100000918 218
295 3300006946 Ga0079104_1000093 Ga0079104_100009397 218
296 3300006946 Ga0079104_1043049 Ga0079104_10430492 218
297 3300009093 Ga0105240_10003357 Ga0105240_100033571 218
298 3300009093 Ga0105240_10011396 Ga0105240_100113965 218
299 3300009093 Ga0105240_10020177 Ga0105240_100201778 218
300 3300009093 Ga0105240_10050940 Ga0105240_100509404 218
301 3300009093 Ga0105240_10059526 Ga0105240_100595262 218
302 3300009094 Ga0111539_10091684 Ga0111539_100916842 218
303 3300009098 Ga0105245_10029752 Ga0105245_100297524 218
304 3300009148 Ga0105243_10001906 Ga0105243_100019062 218
305 3300009148 Ga0105243_10057702 Ga0105243_100577022 218
306 3300009148 Ga0105243_10102221 Ga0105243_101022211 218
307 3300009148 Ga0105243_10170483 Ga0105243_101704832 218
308 3300009148 Ga0105243_10364324 Ga0105243_103643242 218
309 3300009148 Ga0105243_10781506 Ga0105243_107815061 218
310 3300009176 Ga0105242_10006750 Ga0105242_100067502 218
311 3300009176 Ga0105242_10474007 Ga0105242_104740072 218
312 3300009177 Ga0105248_10015504 Ga0105248_100155042 218
313 3300009177 Ga0105248_10423968 Ga0105248_104239681 218
314 3300009545 Ga0105237_10002251 Ga0105237_1000225113 218
315 3300009545 Ga0105237_10333668 Ga0105237_103336683 218
316 3300009551 Ga0105238_10083823 Ga0105238_100838233 218
317 3300009553 Ga0105249_10005323 Ga0105249_1000532310 218
318 3300009553 Ga0105249_10024181 Ga0105249_100241812 218
319 3300009553 Ga0105249_10029171 Ga0105249_100291712 218
320 3300010375 Ga0105239_10002342 Ga0105239_1000234213 218
321 3300010375 Ga0105239_10061489 Ga0105239_100614892 218
322 3300010375 Ga0105239_10065176 Ga0105239_100651764 218
323 3300010375 Ga0105239_10089281 Ga0105239_100892812 218
324 3300012497 Ga0157319_1000005 Ga0157319_1000005225 218
325 3300012512 Ga0157327_1002797 Ga0157327_10027971 218
326 3300013105 Ga0157369_10054582 Ga0157369_100545823 218
327 3300013297 Ga0157378_10001111 Ga0157378_1000111124 218
328 3300013297 Ga0157378_10029548 Ga0157378_100295483 218
329 3300013306 Ga0163162_10082200 Ga0163162_100822002 218
330 3300013306 Ga0163162_10244961 Ga0163162_102449612 218
331 3300013306 Ga0163162_10958433 Ga0163162_109584332 218
332 3300013307 Ga0157372_10262240 Ga0157372_102622404 218
333 3300013308 Ga0157375_10068867 Ga0157375_100688673 218
334 3300013308 Ga0157375_10108223 Ga0157375_101082233 218
335 3300014326 Ga0157380_10046225 Ga0157380_100462253 218
336 3300014326 Ga0157380_10312297 Ga0157380_103122972 218
337 3300014968 Ga0157379_10008561 Ga0157379_100085618 218
338 3300014968 Ga0157379_10011067 Ga0157379_100110675 218
339 3300014968 Ga0157379_10036083 Ga0157379_100360833 218
340 3300014968 Ga0157379_10239194 Ga0157379_102391941 218
341 3300014969 Ga0157376_10396404 Ga0157376_103964041 218
342 3300015265 Ga0182005_1043544 Ga0182005_10435441 218
343 3300017792 Ga0163161_10075781 Ga0163161_100757812 218
344 3300021361 Ga0213872_10000026 Ga0213872_100000266 218
345 3300021361 Ga0213872_10000033 Ga0213872_10000033126 218
346 3300021361 Ga0213872_10000160 Ga0213872_100001604 218
347 3300021361 Ga0213872_10021539 Ga0213872_100215393 218
348 3300025226 Ga0209674_100039 Ga0209674_10003984 218
349 3300025228 Ga0209672_110257 Ga0209672_1102572 218
350 3300025230 Ga0209563_100025 Ga0209563_100025201 218
351 3300025230 Ga0209563_100080 Ga0209563_10008084 218
352 3300025231 Ga0207427_100466 Ga0207427_1004667 218
353 3300025242 Ga0209258_100189 Ga0209258_10018911 218
354 3300025242 Ga0209258_100222 Ga0209258_10022252 218
355 3300025245 Ga0207425_1000001 Ga0207425_10000011670 218
356 3300025245 Ga0207425_1000441 Ga0207425_100044113 218
357 3300025245 Ga0207425_1000795 Ga0207425_100079511 218
358 3300025245 Ga0207425_1026227 Ga0207425_10262271 218
359 3300025246 Ga0209646_1000076 Ga0209646_100007680 218
360 3300025246 Ga0209646_1024723 Ga0209646_10247232 218
361 3300025250 Ga0209026_1000011 Ga0209026_1000011264 218
362 3300025250 Ga0209026_1005603 Ga0209026_10056032 218
363 3300025253 Ga0209677_100086 Ga0209677_10008684 218
364 3300025253 Ga0209677_100399 Ga0209677_10039914 218
365 3300025256 Ga0209759_1000034 Ga0209759_1000034212 218
366 3300025256 Ga0209759_1004758 Ga0209759_10047582 218
367 3300025256 Ga0209759_1011716 Ga0209759_10117163 218
368 3300025258 Ga0209129_1000001 Ga0209129_1000001847 218
369 3300025258 Ga0209129_1000027 Ga0209129_100002783 218
370 3300025263 Ga0209565_1000009 Ga0209565_1000009122 218
371 3300025263 Ga0209565_1001648 Ga0209565_10016481 218
372 3300025263 Ga0209565_1005823 Ga0209565_10058233 218
373 3300025263 Ga0209565_1017728 Ga0209565_10177283 218
374 3300025272 Ga0209455_1000031 Ga0209455_1000031167 218
375 3300025272 Ga0209455_1000092 Ga0209455_100009211 218
376 3300025273 Ga0209673_1000019 Ga0209673_1000019260 218
377 3300025273 Ga0209673_1005892 Ga0209673_10058925 218
378 3300025284 Ga0209130_1000143 Ga0209130_100014361 218
379 3300025291 Ga0209675_1000028 Ga0209675_100002896 218
380 3300025291 Ga0209675_1006223 Ga0209675_10062234 218
381 3300025291 Ga0209675_1018481 Ga0209675_10184813 218
382 3300025294 Ga0209025_1005287 Ga0209025_10052876 218
383 3300025295 Ga0209564_1000058 Ga0209564_1000058198 218
384 3300025295 Ga0209564_1000139 Ga0209564_100013974 218
385 3300025295 Ga0209564_1000178 Ga0209564_100017866 218
386 3300025297 Ga0209758_1000052 Ga0209758_100005237 218
387 3300025297 Ga0209758_1000116 Ga0209758_1000116108 218
388 3300025297 Ga0209758_1002821 Ga0209758_100282115 218
389 3300025298 Ga0209050_1000228 Ga0209050_100022876 218
390 3300025298 Ga0209050_1000271 Ga0209050_100027119 218
391 3300025298 Ga0209050_1002329 Ga0209050_100232913 218
392 3300025298 Ga0209050_1003009 Ga0209050_10030094 218
393 3300025298 Ga0209050_1014479 Ga0209050_10144792 218
394 3300025299 Ga0209256_1000030 Ga0209256_100003039 218
395 3300025299 Ga0209256_1000093 Ga0209256_1000093149 218
396 3300025299 Ga0209256_1000177 Ga0209256_100017754 218
397 3300025299 Ga0209256_1000297 Ga0209256_10002977 218
398 3300025299 Ga0209256_1001157 Ga0209256_100115717 218
399 3300025299 Ga0209256_1002481 Ga0209256_100248114 218
400 3300025299 Ga0209256_1012712 Ga0209256_10127122 218
401 3300025299 Ga0209256_1056153 Ga0209256_10561532 218
402 3300025303 Ga0209051_1000004 Ga0209051_1000004482 218
403 3300025303 Ga0209051_1000845 Ga0209051_100084512 218
404 3300025303 Ga0209051_1002272 Ga0209051_10022724 218
405 3300025303 Ga0209051_1002487 Ga0209051_10024877 218
406 3300025303 Ga0209051_1064372 Ga0209051_10643722 218
407 3300025304 Ga0209257_1000021 Ga0209257_1000021556 218
408 3300025304 Ga0209257_1000347 Ga0209257_100034740 218
409 3300025304 Ga0209257_1000423 Ga0209257_100042339 218
410 3300025304 Ga0209257_1003909 Ga0209257_10039096 218
411 3300025315 Ga0207697_10005999 Ga0207697_100059993 218
412 3300025893 Ga0207682_10002371 Ga0207682_100023716 218
413 3300025899 Ga0207642_10000630 Ga0207642_100006307 218
414 3300025899 Ga0207642_10080456 Ga0207642_100804561 218
415 3300025903 Ga0207680_10070242 Ga0207680_100702422 218
416 3300025907 Ga0207645_10001065 Ga0207645_100010652 218
417 3300025909 Ga0207705_10362684 Ga0207705_103626842 218
418 3300025909 Ga0207705_10478678 Ga0207705_104786781 218
419 3300025913 Ga0207695_10010875 Ga0207695_100108752 218
420 3300025913 Ga0207695_10037384 Ga0207695_100373845 218
421 3300025913 Ga0207695_10088248 Ga0207695_100882481 218
422 3300025913 Ga0207695_10095759 Ga0207695_100957592 218
423 3300025913 Ga0207695_10109182 Ga0207695_101091822 218
424 3300025914 Ga0207671_10012208 Ga0207671_100122082 218
425 3300025914 Ga0207671_10061608 Ga0207671_100616082 218
426 3300025918 Ga0207662_10413945 Ga0207662_104139451 218
427 3300025919 Ga0207657_10024490 Ga0207657_100244903 218
428 3300025919 Ga0207657_10181957 Ga0207657_101819572 218
429 3300025921 Ga0207652_10282471 Ga0207652_102824711 218
430 3300025923 Ga0207681_10034332 Ga0207681_100343323 218
431 3300025923 Ga0207681_10035725 Ga0207681_100357254 218
432 3300025923 Ga0207681_10040907 Ga0207681_100409074 218
433 3300025924 Ga0207694_10020846 Ga0207694_100208462 218
434 3300025924 Ga0207694_10112742 Ga0207694_101127421 218
435 3300025924 Ga0207694_10725086 Ga0207694_107250861 218
436 3300025925 Ga0207650_10002045 Ga0207650_100020454 218
437 3300025926 Ga0207659_10000081 Ga0207659_1000008118 218
438 3300025927 Ga0207687_10683519 Ga0207687_106835191 218
439 3300025931 Ga0207644_10002484 Ga0207644_100024842 218
440 3300025931 Ga0207644_10104152 Ga0207644_101041522 218
441 3300025931 Ga0207644_10172656 Ga0207644_101726562 218
442 3300025932 Ga0207690_10369425 Ga0207690_103694251 218
443 3300025933 Ga0207706_10000573 Ga0207706_1000057318 218
444 3300025934 Ga0207686_10000819 Ga0207686_1000081918 218
445 3300025935 Ga0207709_10024546 Ga0207709_100245462 218
446 3300025935 Ga0207709_10036379 Ga0207709_100363793 218
447 3300025935 Ga0207709_10076677 Ga0207709_100766772 218
448 3300025935 Ga0207709_10134166 Ga0207709_101341662 218
449 3300025935 Ga0207709_10870874 Ga0207709_108708741 218
450 3300025937 Ga0207669_10011691 Ga0207669_100116913 218
451 3300025937 Ga0207669_10221304 Ga0207669_102213042 218
452 3300025938 Ga0207704_10028880 Ga0207704_100288802 218
453 3300025938 Ga0207704_10029777 Ga0207704_100297772 218
454 3300025938 Ga0207704_10175310 Ga0207704_101753102 218
455 3300025938 Ga0207704_10187161 Ga0207704_101871613 218
456 3300025940 Ga0207691_10000330 Ga0207691_1000033020 218
457 3300025940 Ga0207691_10048904 Ga0207691_100489042 218
458 3300025940 Ga0207691_10116936 Ga0207691_101169362 218
459 3300025940 Ga0207691_10195782 Ga0207691_101957822 218
460 3300025940 Ga0207691_10297188 Ga0207691_102971882 218
461 3300025940 Ga0207691_10919888 Ga0207691_109198881 218
462 3300025941 Ga0207711_10002273 Ga0207711_100022733 218
463 3300025942 Ga0207689_10001898 Ga0207689_100018983 218
464 3300025945 Ga0207679_10177723 Ga0207679_101777233 218
465 3300025949 Ga0207667_10004373 Ga0207667_100043737 218
466 3300025949 Ga0207667_10358448 Ga0207667_103584482 218
467 3300025960 Ga0207651_10019150 Ga0207651_100191503 218
468 3300025960 Ga0207651_10152989 Ga0207651_101529892 218
469 3300025961 Ga0207712_10002233 Ga0207712_100022333 218
470 3300025961 Ga0207712_10036422 Ga0207712_100364224 218
471 3300025961 Ga0207712_10363097 Ga0207712_103630972 218
472 3300025972 Ga0207668_10197801 Ga0207668_101978011 218
473 3300025981 Ga0207640_10002317 Ga0207640_100023173 218
474 3300025981 Ga0207640_10161612 Ga0207640_101616122 218
475 3300026035 Ga0207703_10094321 Ga0207703_100943212 218
476 3300026041 Ga0207639_10032301 Ga0207639_100323012 218
477 3300026041 Ga0207639_10378033 Ga0207639_103780332 218
478 3300026075 Ga0207708_10119063 Ga0207708_101190632 218
479 3300026075 Ga0207708_10185253 Ga0207708_101852532 218
480 3300026078 Ga0207702_10000392 Ga0207702_1000039210 218
481 3300026089 Ga0207648_10000837 Ga0207648_1000083720 218
482 3300026089 Ga0207648_10000925 Ga0207648_1000092519 218
483 3300026089 Ga0207648_10009629 Ga0207648_100096298 218
484 3300026095 Ga0207676_10040854 Ga0207676_100408542 218
485 3300026116 Ga0207674_10007715 Ga0207674_100077152 218
486 3300026116 Ga0207674_10093737 Ga0207674_100937373 218
487 3300026118 Ga0207675_100001504 Ga0207675_1000015042 218
488 3300026118 Ga0207675_100026361 Ga0207675_1000263615 218
489 3300026118 Ga0207675_100160311 Ga0207675_1001603113 218
490 3300026121 Ga0207683_10082420 Ga0207683_100824203 218
491 3300026121 Ga0207683_10138720 Ga0207683_101387202 218
492 3300026142 Ga0207698_10119560 Ga0207698_101195602 218
493 3300027111 Ga0209281_1000084 Ga0209281_1000084205 218
494 3300027296 Ga0209389_1004076 Ga0209389_10040766 218
495 3300027614 Ga0209970_1003044 Ga0209970_10030442 218
496 3300028016 Ga0265354_1001675 Ga0265354_10016753 218
497 3300028036 Ga0265355_1006476 Ga0265355_10064761 218
498 3300028379 Ga0268266_10725721 Ga0268266_107257212 218
499 3300028380 Ga0268265_10024928 Ga0268265_100249282 218
500 3300028380 Ga0268265_10111076 Ga0268265_101110763 218
501 3300028380 Ga0268265_10402721 Ga0268265_104027211 218
502 3300028381 Ga0268264_10009151 Ga0268264_100091514 218
503 3300028381 Ga0268264_10588861 Ga0268264_105888611 218
504 3300028577 Ga0265318_10002705 Ga0265318_100027057 218
505 3300028794 Ga0307515_10000020 Ga0307515_10000020290 218
506 3300028794 Ga0307515_10000101 Ga0307515_1000010114 218
507 3300028794 Ga0307515_10002116 Ga0307515_1000211636 218
508 3300028794 Ga0307515_10002349 Ga0307515_1000234916 218
509 3300028794 Ga0307515_10136546 Ga0307515_101365462 218
510 3300028794 Ga0307515_10145995 Ga0307515_101459952 218
511 3300030521 Ga0307511_10138460 Ga0307511_101384602 218
512 3300031090 Ga0265760_10000085 Ga0265760_100000854 218
513 3300031238 Ga0265332_10007049 Ga0265332_100070496 218
514 3300031240 Ga0265320_10032256 Ga0265320_100322561 218
515 3300031240 Ga0265320_10057468 Ga0265320_100574681 218
516 3300031242 Ga0265329_10025103 Ga0265329_100251032 218
517 3300031250 Ga0265331_10001855 Ga0265331_100018552 218
518 3300031251 Ga0265327_10000311 Ga0265327_100003111 218
519 3300031251 Ga0265327_10000746 Ga0265327_1000074649 218
520 3300031344 Ga0265316_10132005 Ga0265316_101320051 218
521 3300031456 Ga0307513_10055948 Ga0307513_100559483 218
522 3300031507 Ga0307509_10256664 Ga0307509_102566641 218
523 3300031548 Ga0307408_100000098 Ga0307408_10000009857 218
524 3300031548 Ga0307408_100000099 Ga0307408_10000009913 218
525 3300031548 Ga0307408_100005262 Ga0307408_1000052625 218
526 3300031548 Ga0307408_100049249 Ga0307408_1000492493 218
527 3300031548 Ga0307408_100049951 Ga0307408_1000499513 218
528 3300031548 Ga0307408_100478010 Ga0307408_1004780102 218
529 3300031548 Ga0307408_100621489 Ga0307408_1006214892 218
530 3300031711 Ga0265314_10000947 Ga0265314_1000094711 218
531 3300031730 Ga0307516_10000405 Ga0307516_1000040516 218
532 3300031730 Ga0307516_10002516 Ga0307516_1000251623 218
533 3300031731 Ga0307405_10238888 Ga0307405_102388882 218
534 3300031731 Ga0307405_10304352 Ga0307405_103043521 218
535 3300031852 Ga0307410_10036794 Ga0307410_100367943 218
536 3300031852 Ga0307410_10051824 Ga0307410_100518243 218
537 3300031901 Ga0307406_10010909 Ga0307406_100109095 218
538 3300031903 Ga0307407_10356298 Ga0307407_103562981 218
539 3300031911 Ga0307412_10026971 Ga0307412_100269712 218
540 3300031911 Ga0307412_10032653 Ga0307412_100326534 218
541 3300031995 Ga0307409_100804370 Ga0307409_1008043702 218
542 3300032002 Ga0307416_100017128 Ga0307416_1000171285 218
543 3300032002 Ga0307416_100030133 Ga0307416_1000301332 218
544 3300032002 Ga0307416_100720995 Ga0307416_1007209951 218
545 3300032004 Ga0307414_10028351 Ga0307414_100283512 218
546 3300032005 Ga0307411_10000301 Ga0307411_100003015 218
547 3300032005 Ga0307411_10021264 Ga0307411_100212644 218
548 3300032005 Ga0307411_10027072 Ga0307411_100270723 218
549 3300032005 Ga0307411_10083154 Ga0307411_100831542 218
550 3300032005 Ga0307411_10414543 Ga0307411_104145432 218
551 3300032126 Ga0307415_100065489 Ga0307415_1000654892 218
552 3300034820 Ga0373959_0003495 Ga0373959_0003495_484_1143 218
553 3300035088 Ga0373940_0007581 Ga0373940_0007581_1574_2233 218
554 3300035091 Ga0373951_0012083 Ga0373951_0012083_15_674 218
555 3300035114 Ga0373939_0000006 Ga0373939_0000006_76548_77207 218
556 3300035121 Ga0373960_0001743 Ga0373960_0001743_3866_4525 218
557 3300035242 Ga0373962_0055727 Ga0373962_0055727_27_686 218
558 3300035691 Ga0373931_0000353 Ga0373931_0000353_155_814 218
559 3300035692 Ga0373935_0183497 Ga0373935_0183497_538_1197 218
560 3300037068 Ga0373925_0035301 Ga0373925_0035301_929_1588 218
561 3300037466 Ga0395898_0403315 Ga0395898_0403315_342_1001 218
562 3300037471 Ga0395905_0008204 Ga0395905_0008204_576_1235 218
563 3300037471 Ga0395905_0027487 Ga0395905_0027487_4366_5025 218
564 3300037471 Ga0395905_0073435 Ga0395905_0073435_2135_2797 218
565 3300038443 Ga0395901_0002301 Ga0395901_0002301_12659_13315 218
566 3300039447 Ga0436361_0147565 Ga0436361_0147565_20021_20683 218
567 3300039447 Ga0436361_0237057 Ga0436361_0237057_582_1238 218
568 3300039447 Ga0436361_0287447 Ga0436361_0287447_107717_108373 218
569 3300039447 Ga0436361_0601867 Ga0436361_0601867_22059_22715 218
570 3300041404 Ga0439436_0001618 Ga0439436_0001618_3967_4626 218
571 3300041404 Ga0439436_0002563 Ga0439436_0002563_2237_2896 218
572 3300041404 Ga0439436_0036358 Ga0439436_0036358_53_712 218
573 3300041407 Ga0439447_005664 Ga0439447_005664_3045_3704 218
574 3300041411 Ga0439466_0063517 Ga0439466_0063517_73_732 218
575 3300041413 Ga0439465_0003102 Ga0439465_0003102_2201_2860 218
576 3300041413 Ga0439465_0117790 Ga0439465_0117790_113_772 218
577 3300041512 Ga0451853_3953217 Ga0451853_3953217_255_914 218
578 3300042004 Ga0439445_0000407 Ga0439445_0000407_1470_2129 218
579 3300042007 Ga0439449_0002680 Ga0439449_0002680_5980_6639 218
580 3300042120 Ga0450917_004735 Ga0450917_004735_223_882 218
581 3300042125 Ga0450923_000481 Ga0450923_000481_3554_4213 218
582 3300042126 Ga0450888_001982 Ga0450888_001982_637_1296 218
583 3300042127 Ga0450890_034542 Ga0450890_034542_32_691 218
584 3300042129 Ga0450891_001521 Ga0450891_001521_1549_2208 218
585 3300042130 Ga0450892_000421 Ga0450892_000421_402_1061 218
586 3300042144 Ga0450889_000380 Ga0450889_000380_1194_1853 218
587 3300042146 Ga0450907_022205 Ga0450907_022205_168_827 218
588 3300042438 Ga0439459_0012332 Ga0439459_0012332_286_945 218
589 3300042531 Ga0450918_000377 Ga0450918_000377_1870_2526 218
590 3300042531 Ga0450918_003844 Ga0450918_003844_312_971 218
591 3300042532 Ga0450893_0038466 Ga0450893_0038466_32_691 218
592 3300042876 Ga0451577_0383272 Ga0451577_0383272_333_992 218
593 3300042876 Ga0451577_0555699 Ga0451577_0555699_33_692 218
594 3300044735 Ga0466968_0061387 Ga0466968_0061387_300_962 218
595 3300045051 Ga0451576_0045972 Ga0451576_0045972_43_699 218
596 3300046454 Ga0495592_0015786 Ga0495592_0015786_2406_3062 218
597 3300046455 Ga0495603_0008193 Ga0495603_0008193_2669_3325 218
598 3300046457 Ga0495590_0171762 Ga0495590_0171762_94_756 218
599 3300046459 Ga0495629_0000941 Ga0495629_0000941_19065_19721 218
600 3300046459 Ga0495629_0003682 Ga0495629_0003682_10237_10893 218
601 3300046460 Ga0495638_0023738 Ga0495638_0023738_3003_3665 218
602 3300046463 Ga0495653_0000384 Ga0495653_0000384_16128_16784 218
603 3300046463 Ga0495653_0000511 Ga0495653_0000511_3220_3876 218
604 3300046463 Ga0495653_0051367 Ga0495653_0051367_26_682 218
605 3300046471 Ga0495650_0053283 Ga0495650_0053283_213_869 218
606 3300046472 Ga0495580_0000856 Ga0495580_0000856_10801_11460 218
607 3300046472 Ga0495580_0001319 Ga0495580_0001319_16922_17578 218
608 3300046472 Ga0495580_0372829 Ga0495580_0372829_16_672 218
609 3300046473 Ga0495582_0000503 Ga0495582_0000503_17073_17729 218
610 3300046477 Ga0495664_0001241 Ga0495664_0001241_10019_10675 218
611 3300046491 Ga0495584_0005887 Ga0495584_0005887_547_1209 218
612 3300046500 Ga0495596_0001182 Ga0495596_0001182_1854_2510 218
613 3300046501 Ga0495607_0010930 Ga0495607_0010930_379_1035 218
614 3300046501 Ga0495607_0099440 Ga0495607_0099440_149_811 218
615 3300046506 Ga0495583_0000258 Ga0495583_0000258_54739_55395 218
616 3300046507 Ga0495606_0000101 Ga0495606_0000101_80680_81336 218
617 3300046507 Ga0495606_0000161 Ga0495606_0000161_56274_56930 218
618 3300046507 Ga0495606_0002471 Ga0495606_0002471_8746_9402 218
619 3300046507 Ga0495606_0011920 Ga0495606_0011920_1069_1725 218
620 3300046507 Ga0495606_0058610 Ga0495606_0058610_1337_1993 218
621 3300046511 Ga0495608_0004822 Ga0495608_0004822_4994_5650 218
622 3300046512 Ga0495610_0002012 Ga0495610_0002012_12354_13010 218
623 3300046512 Ga0495610_0028675 Ga0495610_0028675_1514_2170 218
624 3300046513 Ga0495616_0005117 Ga0495616_0005117_5730_6392 218
625 3300046514 Ga0495618_0001270 Ga0495618_0001270_14118_14774 218
626 3300046516 Ga0495628_0149979 Ga0495628_0149979_10_666 218
627 3300046517 Ga0495630_0024889 Ga0495630_0024889_2668_3324 218
628 3300046520 Ga0495637_0000699 Ga0495637_0000699_20780_21436 218
629 3300046522 Ga0495643_0074698 Ga0495643_0074698_739_1401 218
630 3300046524 Ga0495648_0012677 Ga0495648_0012677_2943_3599 218
631 3300046524 Ga0495648_0028518 Ga0495648_0028518_1355_2011 218
632 3300046524 Ga0495648_0075085 Ga0495648_0075085_312_968 218
633 3300046525 Ga0495663_0100707 Ga0495663_0100707_229_924 218
634 3300046526 Ga0495666_0000277 Ga0495666_0000277_19069_19725 218
635 3300046526 Ga0495666_0017842 Ga0495666_0017842_2484_3140 218
636 3300046528 Ga0495642_0191748 Ga0495642_0191748_193_855 218
637 3300046529 Ga0495652_0015012 Ga0495652_0015012_4409_5065 218
638 3300046529 Ga0495652_0062951 Ga0495652_0062951_2213_2869 218
639 3300046530 Ga0495654_0000014 Ga0495654_0000014_40616_41272 218
640 3300046533 Ga0495640_0002781 Ga0495640_0002781_495_1151 218
641 3300046533 Ga0495640_0019898 Ga0495640_0019898_13_669 218
642 3300046535 Ga0495586_0001730 Ga0495586_0001730_2802_3458 218
643 3300046536 Ga0495587_0000929 Ga0495587_0000929_385_1041 218
644 3300046536 Ga0495587_0049911 Ga0495587_0049911_396_1052 218
645 3300046537 Ga0495598_0003493 Ga0495598_0003493_1979_2674 218
646 3300046538 Ga0495609_0001696 Ga0495609_0001696_7495_8157 218
647 3300046539 Ga0495621_0020833 Ga0495621_0020833_469_1128 218
648 3300046542 Ga0495597_0000172 Ga0495597_0000172_50774_51430 218
649 3300046543 Ga0495645_0008320 Ga0495645_0008320_3712_4368 218
650 3300046543 Ga0495645_0136815 Ga0495645_0136815_912_1571 218
651 3300046558 Ga0495633_0005718 Ga0495633_0005718_2254_2910 218
652 3300046558 Ga0495633_0012243 Ga0495633_0012243_583_1239 218
653 3300046558 Ga0495633_0021952 Ga0495633_0021952_833_1528 218
654 3300046559 Ga0495667_0202054 Ga0495667_0202054_241_897 218
655 3300046616 Ga0495668_0000684 Ga0495668_0000684_19306_19962 218
656 3300046616 Ga0495668_0006025 Ga0495668_0006025_5909_6571 218
657 3300046642 Ga0495634_0004651 Ga0495634_0004651_5625_6281 218
658 3300046642 Ga0495634_0018150 Ga0495634_0018150_2342_2998 218
659 3300046663 Ga0495635_0004874 Ga0495635_0004874_4153_4809 218
660 3300046663 Ga0495635_0036315 Ga0495635_0036315_872_1528 218
661 3300046664 Ga0495659_0003984 Ga0495659_0003984_606_1268 218
662 3300046665 Ga0495661_0013760 Ga0495661_0013760_2560_3216 218
663 3300046665 Ga0495661_0022967 Ga0495661_0022967_1609_2265 218
664 3300046665 Ga0495661_0034543 Ga0495661_0034543_1913_2608 218
665 3300046665 Ga0495661_0035672 Ga0495661_0035672_746_1408 218
666 3300046674 Ga0495588_0119838 Ga0495588_0119838_394_1050 218
667 3300046678 Ga0495599_0001289 Ga0495599_0001289_181_837 218
668 3300046678 Ga0495599_0198320 Ga0495599_0198320_402_1058 218
669 3300046679 Ga0495623_0014147 Ga0495623_0014147_1889_2545 218
670 3300046679 Ga0495623_0073646 Ga0495623_0073646_221_877 218
671 3300046680 Ga0495646_0005054 Ga0495646_0005054_1524_2180 218
672 3300046680 Ga0495646_0012497 Ga0495646_0012497_2073_2729 218
673 3300046684 Ga0495669_0000453 Ga0495669_0000453_16843_17505 218
674 3300046684 Ga0495669_0029841 Ga0495669_0029841_1409_2104 218
675 3300046689 Ga0495613_0015748 Ga0495613_0015748_17_673 218
676 3300046690 Ga0495624_0002063 Ga0495624_0002063_2873_3529 218
677 3300046690 Ga0495624_0067058 Ga0495624_0067058_359_1015 218
678 3300046694 Ga0495649_0008449 Ga0495649_0008449_4426_5082 218
679 3300046694 Ga0495649_0011217 Ga0495649_0011217_2335_2997 218
680 3300046794 Ga0495589_0011552 Ga0495589_0011552_3855_4511 218
681 3300046809 Ga0495600_0071877 Ga0495600_0071877_1461_2117 218
682 3300046810 Ga0495660_0022202 Ga0495660_0022202_1112_1768 218
683 3300046810 Ga0495660_0206962 Ga0495660_0206962_110_772 218
684 3300047315 Ga0495581_0000088 Ga0495581_0000088_4520_5176 218
685 3300047317 Ga0495604_0010429 Ga0495604_0010429_441_1097 218
686 3300047317 Ga0495604_0033888 Ga0495604_0033888_850_1506 218
687 3300047318 Ga0495636_0004548 Ga0495636_0004548_4023_4685 218
688 3300047319 Ga0495674_0021023 Ga0495674_0021023_3920_4576 218
689 3300047319 Ga0495674_0043522 Ga0495674_0043522_1550_2206 218
690 3300047319 Ga0495674_0047875 Ga0495674_0047875_1241_1897 218
691 3300047320 Ga0495672_0000400 Ga0495672_0000400_50902_51558 218
692 3300047321 Ga0495676_0023216 Ga0495676_0023216_2062_2718 218
693 3300047321 Ga0495676_0079930 Ga0495676_0079930_504_1160 218
694 3300047321 Ga0495676_0094469 Ga0495676_0094469_889_1545 218
695 3300047322 Ga0495680_0015198 Ga0495680_0015198_3119_3775 218
696 3300047322 Ga0495680_0401871 Ga0495680_0401871_135_791 218
697 3300047323 Ga0495683_0045692 Ga0495683_0045692_749_1405 218
698 3300047445 Ga0495677_0006066 Ga0495677_0006066_2765_3427 218
699 3300047445 Ga0495677_0021727 Ga0495677_0021727_515_1210 218
700 3300047446 Ga0495679_000374 Ga0495679_000374_30382_31038 218
701 3300047446 Ga0495679_000724 Ga0495679_000724_7851_8507 218
702 3300047446 Ga0495679_013957 Ga0495679_013957_838_1500 218
703 3300047469 Ga0495673_0040614 Ga0495673_0040614_340_996 218
704 3300047470 Ga0495681_0010735 Ga0495681_0010735_4636_5298 218
705 3300047472 Ga0495686_0004786 Ga0495686_0004786_1896_2552 218
706 3300047472 Ga0495686_0008011 Ga0495686_0008011_4618_5280 218
707 3300047472 Ga0495686_0010321 Ga0495686_0010321_5136_5792 218
708 3300047673 Ga0495593_0000523 Ga0495593_0000523_2551_3207 218
709 3300047673 Ga0495593_0003554 Ga0495593_0003554_4342_4998 218
710 3300048088 Ga0495602_0018152 Ga0495602_0018152_2669_3325 218
711 3300048088 Ga0495602_0100904 Ga0495602_0100904_546_1202 218
712 3300048089 Ga0495614_0001008 Ga0495614_0001008_8825_9481 218
713 3300048089 Ga0495614_0019842 Ga0495614_0019842_1034_1690 218
714 3300048903 Ga0496100_0489473 Ga0496100_0489473_109_768 218
715 3300048905 Ga0496102_0008917 Ga0496102_0008917_3565_4221 218
716 3300048905 Ga0496102_0541693 Ga0496102_0541693_256_915 218
717 3300048911 Ga0496108_0068954 Ga0496108_0068954_1374_2030 218
718 3300048912 Ga0496109_0135001 Ga0496109_0135001_1233_1889 218
719 3300048917 Ga0496114_0116017 Ga0496114_0116017_1500_2159 218
720 3300048920 Ga0496117_0166489 Ga0496117_0166489_170_835 218
721 3300048924 Ga0496121_0001461 Ga0496121_0001461_19361_20113 218
722 3300048924 Ga0496121_0002415 Ga0496121_0002415_12225_12881 218
723 3300048925 Ga0496122_0346328 Ga0496122_0346328_40_696 218
724 3300048926 Ga0496123_0022900 Ga0496123_0022900_3245_3901 218
725 3300048927 Ga0496124_0000504 Ga0496124_0000504_47446_48102 218
726 3300048927 Ga0496124_0052327 Ga0496124_0052327_2110_2766 218
727 3300048929 Ga0496126_0167233 Ga0496126_0167233_223_888 218
728 3300048929 Ga0496126_0283081 Ga0496126_0283081_185_895 218
729 3300049128 Ga0501308_004493 Ga0501308_004493_341_1000 218
730 3300049160 Ga0501304_007572 Ga0501304_007572_190_849 218
731 3300049459 Ga0495678_039510 Ga0495678_039510_159_815 218
732 3300049521 Ga0501298_017759 Ga0501298_017759_558_1217 218
733 3300049590 Ga0501074_0043068 Ga0501074_0043068_337_993 218
734 3300049651 Ga0501201_003743 Ga0501201_003743_331_990 218
735 3300049658 Ga0501211_000888 Ga0501211_000888_2161_2820 218
736 3300049662 Ga0501222_004907 Ga0501222_004907_49_708 218
737 3300049662 Ga0501222_013028 Ga0501222_013028_137_796 218
738 3300049669 Ga0501235_021459 Ga0501235_021459_301_960 218
739 3300049706 Ga0501229_004772 Ga0501229_004772_843_1502 218
740 3300049742 Ga0501080_0018366 Ga0501080_0018366_3483_4139 218
741 3300050493 nmdc:mga0k408_10040_c1 nmdc:mga0k408_10040_c1_3877_4536 218
742 3300050493 nmdc:mga0k408_134465_c1 nmdc:mga0k408_134465_c1_43_702 218
743 3300050493 nmdc:mga0k408_211940_c1 nmdc:mga0k408_211940_c1_183_845 218
744 3300050493 nmdc:mga0k408_35348_c1 nmdc:mga0k408_35348_c1_1059_1718 218
745 3300050496 nmdc:mga07m45_1126_c1 nmdc:mga07m45_1126_c1_9648_10307 218
746 3300050496 nmdc:mga07m45_8512_c1 nmdc:mga07m45_8512_c1_2799_3458 218
747 3300050511 nmdc:mga08y16_79385_c1 nmdc:mga08y16_79385_c1_208_867 218
748 3300053088 Ga0500644_0002846 Ga0500644_0002846_3085_3744 218
749 3300053088 Ga0500644_0009670 Ga0500644_0009670_1840_2499 218
750 3300053108 Ga0500562_004854 Ga0500562_004854_129_788 218
751 3300053125 Ga0500618_000088 Ga0500618_000088_32006_32662 218
752 3300053145 Ga0500586_002812 Ga0500586_002812_2508_3167 218
753 3300059477 Ga0587084_018055 Ga0587084_018055_148_804 218
754 3300059491 Ga0587070_002891 Ga0587070_002891_896_1699 218
755 3300059492 Ga0587073_0061179 Ga0587073_0061179_25_681 218
756 3300059493 Ga0587077_004383 Ga0587077_004383_130_786 218
757 3300059504 Ga0587082_023797 Ga0587082_023797_207_908 218
758 3300059505 Ga0587083_0039397 Ga0587083_0039397_108_764 218
759 3300059506 Ga0587085_039329 Ga0587085_039329_71_727 218
760 3300059507 Ga0587086_003813 Ga0587086_003813_817_1524 218
761 3300059508 Ga0587088_033941 Ga0587088_033941_38_697 218
762 3300059509 Ga0587089_015701 Ga0587089_015701_245_901 218
763 3300059510 Ga0587090_010781 Ga0587090_010781_210_992 218
764 3300059511 Ga0587091_005471 Ga0587091_005471_896_1552 218
765 3300059512 Ga0587092_003332 Ga0587092_003332_158_940 218
766 3300059512 Ga0587092_003665 Ga0587092_003665_923_1630 218
767 3300059624 Ga0587109_042119 Ga0587109_042119_156_812 218
768 3300059639 Ga0587062_000926 Ga0587062_000926_275_1057 218
769 3300059641 Ga0587068_003167 Ga0587068_003167_1061_1843 218
770 3300059643 Ga0587072_007303 Ga0587072_007303_817_1524 218
771 3300059643 Ga0587072_028833 Ga0587072_028833_261_917 218
772 3300059645 Ga0587076_005159 Ga0587076_005159_226_1008 218
773 3300059646 Ga0587078_019490 Ga0587078_019490_70_771 218
774 3300059647 Ga0587079_034545 Ga0587079_034545_215_871 218
775 3300059653 Ga0587108_010658 Ga0587108_010658_103_759 218
776 3300059660 Ga0587124_007228 Ga0587124_007228_157_813 218
777 3300060344 Ga0587071_046836 Ga0587071_046836_119_775 218
778 3300060346 Ga0587111_0003486 Ga0587111_0003486_216_872 218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

54

194

0.96

PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

214

252

0.95

PF08534

Redoxin

Redoxin

53

212

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9534 3 218
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9488 3 218
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9471 3 218
5ykj-assembly1.cif.gz_A structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems 0.9391 3 215
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.938 3 218
ID Description Score Start End Superfamily
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9749 155 217 3.30.1020.10
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9654 5 106 3.40.30.10
af_P34227_199_260_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9639 155 215 3.30.1020.10
af_O08709_156_224_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9508 155 217 3.30.1020.10
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9457 155 217 3.30.1020.10
ID Description Score Start End GO Terms
AF-A0A7C7WM65-F1-model_v4 Redoxin domain-containing protein 0.9926 1 169 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A3D2S068-F1-model_v4 Peroxidase 0.9922 1 106 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A659YRX5-F1-model_v4 deleted 0.9909 1 99
AF-A0A534YD48-F1-model_v4 Peroxiredoxin 0.9893 1 184 GO:0005829
GO:0045454
GO:0051920
AF-C3KLK5-F1-model_v4 Peroxiredoxin 6 (EC 1.11.1.-) 0.9874 1 218 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454

Feature Viewer

pLDDT pTM Quality
91.68 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map